F422784

General Info

Members Datasets Scaffolds Average Seq Length
362 200 724 166

Family's Representative Sequence

Representative Sequence 3300049774|Ga0501278_002755|Ga0501278_002755_595_1161
Length 188
Sequence VRQIVLVLVRRGAKADRQGGFMESRAKVLGHPIHQMLIPFPFGLLATAVIFDIVYLIWGNPTMATVSYYMIIAGIIGAVAAAPFGLIDWLAIPKGTRAKSVGLIHGLGNVGVLLLFLASWYLRYTTPDIVPHIPSTSALLLSFVGFALAAVTGWLGGELVDRLSVGVDDGANLDAPSSLTGPATRRAS

Samples

Sample ID Description Type Environment
1 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
106 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
107 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
108 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
109 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
110 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
111 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
112 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
113 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
114 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
115 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
116 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
117 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
118 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
119 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
120 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
121 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
134 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
135 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
136 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
137 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
138 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
139 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
140 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
141 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
149 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
150 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
151 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
152 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
153 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
154 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
155 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
156 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
157 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
158 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
159 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
160 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
161 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
162 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
163 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
164 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
165 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
166 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
167 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
168 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
169 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
170 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
171 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
172 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
173 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
174 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
175 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
176 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
177 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
178 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
181 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
182 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
186 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
187 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
188 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
189 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
192 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
193 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.21
Rhizosphere 96.41
Stem 0
Stem Tuber 0
Unclassified 35.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501278_002755 3300049774 Unclassified 1229
2 MRS1b_contig_7156251 2162886011 Bacteria 1958
3 JGI24748J21848_1000035 3300002074 Bacteria 73922
4 JGI24034J26672_10000039 3300002239 Bacteria 73907
5 JGI25406J46586_10002772 3300003203 Bacteria 8233
6 JGI25406J46586_10012994 3300003203 Bacteria 3595
7 JGI25406J46586_10068027 3300003203 Unclassified 1126
8 Ga0065714_10064428 3300005288 Bacteria 144890
9 Ga0065712_10000115 3300005290 Bacteria 144502
10 Ga0065712_10552695 3300005290 Unclassified 616
11 Ga0065715_10091197 3300005293 Bacteria 6008
12 Ga0065707_10107923 3300005295 Bacteria 2532
13 Ga0070683_100205778 3300005329 Bacteria 1869
14 Ga0070683_100479158 3300005329 Unclassified 1188
15 Ga0070670_100146129 3300005331 Unclassified 2046
16 Ga0068869_100056204 3300005334 Bacteria 2870
17 Ga0068868_101424587 3300005338 Unclassified 647
18 Ga0070687_100632484 3300005343 Bacteria 739
19 Ga0070661_100540608 3300005344 Bacteria 936
20 Ga0070692_10282390 3300005345 Bacteria 1006
21 Ga0070671_100121375 3300005355 Bacteria 2199
22 Ga0070671_100600019 3300005355 Unclassified 951
23 Ga0070673_100001252 3300005364 Bacteria 14759
24 Ga0070673_101551513 3300005364 Bacteria 625
25 Ga0070705_100654690 3300005440 Bacteria 819
26 Ga0070700_100000376 3300005441 Bacteria 22892
27 Ga0070694_100000333 3300005444 Bacteria 25382
28 Ga0070694_100024695 3300005444 Bacteria 3880
29 Ga0070694_100085434 3300005444 Unclassified 2204
30 Ga0070694_100087315 3300005444 Unclassified 2181
31 Ga0070708_100724335 3300005445 Unclassified 936
32 Ga0070663_100065457 3300005455 Unclassified 2631
33 Ga0070681_10035163 3300005458 Bacteria 5032
34 Ga0070681_10042099 3300005458 Bacteria 4577
35 Ga0070685_10076660 3300005466 Bacteria 1994
36 Ga0070707_100138681 3300005468 Bacteria 2366
37 Ga0070698_100003561 3300005471 Bacteria 17110
38 Ga0070699_100021104 3300005518 Bacteria 5614
39 Ga0070695_100234034 3300005545 Bacteria 1329
40 Ga0070695_100505971 3300005545 Bacteria 935
41 Ga0070695_101073914 3300005545 Unclassified 658
42 Ga0070696_100012363 3300005546 Bacteria 5727
43 Ga0070696_100015700 3300005546 Bacteria 5089
44 Ga0070696_100099190 3300005546 Bacteria 2084
45 Ga0070693_100062844 3300005547 Bacteria 2162
46 Ga0070693_100221562 3300005547 Unclassified 1240
47 Ga0070704_100009865 3300005549 Bacteria 5792
48 Ga0070704_100062852 3300005549 Bacteria 2663
49 Ga0070704_100141873 3300005549 Unclassified 1877
50 Ga0068857_100309278 3300005577 Bacteria 1458
51 Ga0068856_100146235 3300005614 Bacteria 2371
52 Ga0070702_100048665 3300005615 Unclassified 2414
53 Ga0070702_100086263 3300005615 Bacteria 1893
54 Ga0068852_100187256 3300005616 Bacteria 1950
55 Ga0068859_100005896 3300005617 Bacteria 12434
56 Ga0068859_100177620 3300005617 Bacteria 2211
57 Ga0068859_100210157 3300005617 Bacteria 2032
58 Ga0068864_100862843 3300005618 Unclassified 892
59 Ga0068861_100012524 3300005719 Bacteria 5917
60 Ga0068861_100115863 3300005719 Bacteria 2154
61 Ga0068858_100000053 3300005842 Bacteria 119869
62 Ga0068858_100119685 3300005842 Bacteria 2462
63 Ga0068860_100064255 3300005843 Bacteria 3486
64 Ga0068860_101389687 3300005843 Unclassified 723
65 Ga0068862_100157413 3300005844 Bacteria 2026
66 Ga0081539_10001576 3300005985 Bacteria 37698
67 Ga0081539_10002118 3300005985 Bacteria 29395
68 Ga0081539_10007822 3300005985 Bacteria 9558
69 Ga0081539_10069395 3300005985 Bacteria 1897
70 Ga0075428_100262636 3300006844 Bacteria 1859
71 Ga0075428_101154190 3300006844 Unclassified 817
72 Ga0075431_100277116 3300006847 Bacteria 1698
73 Ga0075433_10314190 3300006852 Unclassified 1386
74 Ga0075433_10523224 3300006852 Bacteria 1043
75 Ga0075434_100044770 3300006871 Bacteria 4389
76 Ga0075434_100203821 3300006871 Unclassified 1998
77 Ga0075434_100865597 3300006871 Unclassified 919
78 Ga0075429_100620826 3300006880 Unclassified 947
79 Ga0097620_100005896 3300006931 Bacteria 12434
80 Ga0097620_100177607 3300006931 Bacteria 2211
81 Ga0097620_100210170 3300006931 Bacteria 2032
82 Ga0075435_100252040 3300007076 Unclassified 1503
83 Ga0111539_10169289 3300009094 Bacteria 2553
84 Ga0105247_10000052 3300009101 Bacteria 141465
85 Ga0105247_10702674 3300009101 Unclassified 761
86 Ga0114129_10142202 3300009147 Bacteria 3288
87 Ga0114129_10177290 3300009147 Unclassified 2902
88 Ga0114129_10456251 3300009147 Bacteria 1676
89 Ga0105243_10280529 3300009148 Unclassified 1500
90 Ga0105241_10386728 3300009174 Bacteria 1224
91 Ga0105241_10810284 3300009174 Unclassified 863
92 Ga0105248_10006441 3300009177 Bacteria 12880
93 Ga0105248_10155007 3300009177 Unclassified 2585
94 Ga0105248_10964538 3300009177 Bacteria 963
95 Ga0105249_10120836 3300009553 Unclassified 2489
96 Ga0105239_10144504 3300010375 Bacteria 2652
97 Ga0163162_10383599 3300013306 Bacteria 1538
98 Ga0163162_10647623 3300013306 Unclassified 1180
99 Ga0163162_11082483 3300013306 Unclassified 908
100 Ga0163162_11215960 3300013306 Unclassified 855
101 Ga0157375_10021407 3300013308 Bacteria 5928
102 Ga0157375_12511499 3300013308 Unclassified 615
103 Ga0163163_10105659 3300014325 Bacteria 2841
104 Ga0213876_10000047 3300021384 Bacteria 146737
105 Ga0213876_10000133 3300021384 Bacteria 81090
106 Ga0207672_1000342 3300025223 Bacteria 6176
107 Ga0207710_10000004 3300025900 Bacteria 846540
108 Ga0207710_10401515 3300025900 Unclassified 703
109 Ga0207707_10259343 3300025912 Bacteria 1508
110 Ga0207662_10095240 3300025918 Bacteria 1837
111 Ga0207662_10775373 3300025918 Bacteria 675
112 Ga0207646_10117591 3300025922 Bacteria 2388
113 Ga0207681_10937411 3300025923 Unclassified 726
114 Ga0207650_10035124 3300025925 Unclassified 3638
115 Ga0207644_10000470 3300025931 Bacteria 25963
116 Ga0207706_10003614 3300025933 Bacteria 14775
117 Ga0207686_10000272 3300025934 Bacteria 38411
118 Ga0207670_10366822 3300025936 Unclassified 1144
119 Ga0207691_10697454 3300025940 Unclassified 856
120 Ga0207691_10797640 3300025940 Unclassified 794
121 Ga0207711_10002310 3300025941 Bacteria 17085
122 Ga0207689_10273709 3300025942 Bacteria 1398
123 Ga0207689_10291066 3300025942 Unclassified 1353
124 Ga0207651_10002037 3300025960 Bacteria 9505
125 Ga0207651_10992690 3300025960 Bacteria 750
126 Ga0207703_10000093 3300026035 Bacteria 104313
127 Ga0207703_10049342 3300026035 Bacteria 3403
128 Ga0207703_10186744 3300026035 Bacteria 1833
129 Ga0207639_10169660 3300026041 Bacteria 1847
130 Ga0207708_10000088 3300026075 Bacteria 72618
131 Ga0207641_10777244 3300026088 Unclassified 946
132 Ga0207676_10132825 3300026095 Archaea 2119
133 Ga0207676_10251286 3300026095 Bacteria 1592
134 Ga0207676_11170631 3300026095 Unclassified 761
135 Ga0207674_10322443 3300026116 Unclassified 1494
136 Ga0207674_10378242 3300026116 Unclassified 1369
137 Ga0207675_100048714 3300026118 Bacteria 3955
138 Ga0207675_100313178 3300026118 Bacteria 1531
139 Ga0207698_10917007 3300026142 Bacteria 884
140 Ga0207428_10401322 3300027907 Bacteria 1004
141 Ga0268264_10046995 3300028381 Bacteria 3588
142 Ga0307408_100089806 3300031548 Bacteria 2317
143 Ga0307408_100150821 3300031548 Bacteria 1835
144 Ga0307408_100162007 3300031548 Bacteria 1777
145 Ga0307408_100288236 3300031548 Bacteria 1370
146 Ga0307408_101071641 3300031548 Bacteria 746
147 Ga0307408_101136810 3300031548 Bacteria 726
148 Ga0307405_10056434 3300031731 Unclassified 2463
149 Ga0307405_10059147 3300031731 Bacteria 2414
150 Ga0307405_10073701 3300031731 Bacteria 2205
151 Ga0307413_10042347 3300031824 Bacteria 2675
152 Ga0307413_10159602 3300031824 Bacteria 1582
153 Ga0307413_10475617 3300031824 Bacteria 997
154 Ga0307410_10010353 3300031852 Bacteria 5277
155 Ga0307410_10025145 3300031852 Unclassified 3731
156 Ga0307410_10188834 3300031852 Unclassified 1565
157 Ga0307410_10213212 3300031852 Unclassified 1481
158 Ga0307410_10260408 3300031852 Unclassified 1352
159 Ga0307410_10270644 3300031852 Bacteria 1329
160 Ga0307410_10303487 3300031852 Bacteria 1261
161 Ga0307410_10445285 3300031852 Unclassified 1055
162 Ga0307410_10700271 3300031852 Unclassified 854
163 Ga0307406_10007799 3300031901 Bacteria 5952
164 Ga0307406_10152903 3300031901 Bacteria 1648
165 Ga0307406_10906672 3300031901 Bacteria 751
166 Ga0307406_11232130 3300031901 Bacteria 651
167 Ga0307407_10081329 3300031903 Bacteria 1960
168 Ga0307407_10127263 3300031903 Bacteria 1624
169 Ga0307407_10684823 3300031903 Bacteria 771
170 Ga0307412_10057893 3300031911 Bacteria 2589
171 Ga0307412_10062366 3300031911 Bacteria 2510
172 Ga0307412_10140423 3300031911 Bacteria 1768
173 Ga0307412_10254944 3300031911 Bacteria 1364
174 Ga0307412_10348164 3300031911 Bacteria 1188
175 Ga0307409_100018238 3300031995 Bacteria 4710
176 Ga0307409_100044284 3300031995 Unclassified 3350
177 Ga0307409_100358121 3300031995 Bacteria 1379
178 Ga0307409_101632021 3300031995 Bacteria 673
179 Ga0307416_100022618 3300032002 Bacteria 4541
180 Ga0307416_100064795 3300032002 Unclassified 2999
181 Ga0307416_100097275 3300032002 Bacteria 2548
182 Ga0307416_100753637 3300032002 Bacteria 1066
183 Ga0307414_10008653 3300032004 Bacteria 5791
184 Ga0307414_10229481 3300032004 Bacteria 1530
185 Ga0307414_10235688 3300032004 Bacteria 1512
186 Ga0307414_10463937 3300032004 Bacteria 1114
187 Ga0307411_10013817 3300032005 Bacteria 4472
188 Ga0307411_10039559 3300032005 Bacteria 2984
189 Ga0307411_10135510 3300032005 Unclassified 1807
190 Ga0307411_10304013 3300032005 Unclassified 1280
191 Ga0307411_10328565 3300032005 Bacteria 1238
192 Ga0307415_100029448 3300032126 Bacteria 3509
193 Ga0307415_100039285 3300032126 Unclassified 3126
194 Ga0307415_100044044 3300032126 Bacteria 2981
195 Ga0307415_100566902 3300032126 Bacteria 1005
196 Ga0307415_100921902 3300032126 Unclassified 807
197 Ga0307415_101001451 3300032126 Unclassified 777
198 Ga0373941_0039183 3300035115 Bacteria 1455
199 Ga0373931_0236492 3300035691 Bacteria 1106
200 Ga0395900_0683203 3300037418 Bacteria 961
201 Ga0436364_0915494 3300037853 Bacteria 646
202 Ga0436365_0510131 3300039437 Bacteria 75570
203 Ga0436365_0760749 3300039437 Bacteria 74685
204 Ga0439439_0023561 3300041406 Bacteria 1542
205 Ga0439447_025678 3300041407 Bacteria 1516
206 Ga0439466_0050781 3300041411 Bacteria 1359
207 Ga0439431_0054324 3300041997 Bacteria 1045
208 Ga0439448_0091711 3300042005 Unclassified 1027
209 Ga0439432_016770 3300042006 Bacteria 2463
210 Ga0439432_080771 3300042006 Bacteria 985
211 Ga0439452_015730 3300042010 Bacteria 2068
212 Ga0439455_0066646 3300042012 Unclassified 962
213 Ga0439462_0102482 3300042015 Bacteria 789
214 Ga0450894_010194 3300042131 Bacteria 1218
215 Ga0450898_007597 3300042134 Bacteria 1690
216 Ga0439458_0013577 3300042157 Bacteria 1834
217 Ga0450909_022679 3300042185 Bacteria 940
218 Ga0439434_0102634 3300042435 Bacteria 922
219 Ga0439435_0002660 3300042436 Bacteria 3592
220 Ga0439459_0128028 3300042438 Unclassified 646
221 Ga0450918_021874 3300042531 Bacteria 1117
222 Ga0466972_0001312 3300044658 Bacteria 12038
223 Ga0466964_0110642 3300044706 Bacteria 1224
224 Ga0451576_1060732 3300045051 Unclassified 849
225 Ga0451576_1387220 3300045051 Bacteria 731
226 Ga0495659_0049646 3300046664 Bacteria 1524
227 Ga0496102_0424898 3300048905 Unclassified 1248
228 Ga0496104_0190066 3300048907 Bacteria 1964
229 Ga0496106_0251593 3300048909 Bacteria 1413
230 Ga0496106_0255497 3300048909 Bacteria 1402
231 Ga0496106_0318640 3300048909 Bacteria 1248
232 Ga0496107_0070382 3300048910 Bacteria 2540
233 Ga0496110_0224660 3300048913 Bacteria 1708
234 Ga0496112_0765912 3300048915 Bacteria 891
235 Ga0501305_085282 3300049161 Unclassified 572
236 Ga0501290_029956 3300049513 Bacteria 777
237 Ga0501291_004525 3300049514 Unclassified 1778
238 Ga0501291_004649 3300049514 Bacteria 1759
239 Ga0501292_005446 3300049515 Bacteria 1774
240 Ga0501292_040906 3300049515 Unclassified 800
241 Ga0501292_077938 3300049515 Unclassified 626
242 Ga0501293_004096 3300049516 Unclassified 1142
243 Ga0501296_002827 3300049519 Unclassified 1838
244 Ga0501296_016829 3300049519 Unclassified 911
245 Ga0501298_009503 3300049521 Bacteria 1656
246 Ga0501298_022615 3300049521 Unclassified 1185
247 Ga0501299_001574 3300049522 Bacteria 2975
248 Ga0501299_010283 3300049522 Unclassified 1560
249 Ga0501300_014901 3300049523 Unclassified 1134
250 Ga0501303_010111 3300049526 Unclassified 879
251 Ga0501036_0085328 3300049572 Bacteria 2669
252 Ga0501037_0941117 3300049573 Bacteria 565
253 Ga0501040_0445431 3300049576 Bacteria 932
254 Ga0501075_0085291 3300049591 Bacteria 2393
255 Ga0501075_0509415 3300049591 Unclassified 918
256 Ga0501076_0100743 3300049592 Unclassified 2328
257 Ga0501076_0264813 3300049592 Bacteria 1407
258 Ga0501076_0492995 3300049592 Unclassified 1010
259 Ga0501077_0024285 3300049593 Bacteria 3849
260 Ga0501077_0177817 3300049593 Bacteria 1352
261 Ga0501198_003172 3300049649 Unclassified 2239
262 Ga0501198_055140 3300049649 Unclassified 716
263 Ga0501198_104493 3300049649 Unclassified 578
264 Ga0501199_004455 3300049650 Bacteria 1380
265 Ga0501201_012984 3300049651 Unclassified 834
266 Ga0501202_009471 3300049652 Bacteria 1792
267 Ga0501202_011572 3300049652 Bacteria 1654
268 Ga0501202_051272 3300049652 Unclassified 915
269 Ga0501206_009514 3300049653 Bacteria 1294
270 Ga0501206_014304 3300049653 Unclassified 1090
271 Ga0501206_027997 3300049653 Unclassified 828
272 Ga0501207_000247 3300049654 Bacteria 5533
273 Ga0501207_003189 3300049654 Bacteria 2168
274 Ga0501208_093260 3300049655 Unclassified 636
275 Ga0501209_015774 3300049656 Unclassified 1692
276 Ga0501209_054589 3300049656 Unclassified 1099
277 Ga0501214_016495 3300049659 Unclassified 893
278 Ga0501216_028993 3300049660 Unclassified 1012
279 Ga0501216_030231 3300049660 Bacteria 997
280 Ga0501217_001885 3300049661 Bacteria 4023
281 Ga0501217_006966 3300049661 Bacteria 2415
282 Ga0501217_129132 3300049661 Bacteria 740
283 Ga0501223_002018 3300049663 Bacteria 4555
284 Ga0501223_014546 3300049663 Unclassified 1560
285 Ga0501223_015244 3300049663 Bacteria 1522
286 Ga0501224_001094 3300049664 Bacteria 3527
287 Ga0501224_002006 3300049664 Bacteria 2755
288 Ga0501224_005511 3300049664 Bacteria 1816
289 Ga0501224_028778 3300049664 Unclassified 832
290 Ga0501227_003129 3300049665 Bacteria 3597
291 Ga0501227_008157 3300049665 Unclassified 2249
292 Ga0501228_020418 3300049666 Bacteria 745
293 Ga0501230_023343 3300049667 Unclassified 1100
294 Ga0501230_036536 3300049667 Bacteria 937
295 Ga0501233_008567 3300049668 Bacteria 1975
296 Ga0501233_022022 3300049668 Unclassified 1373
297 Ga0501233_028886 3300049668 Unclassified 1240
298 Ga0501235_005966 3300049669 Unclassified 2652
299 Ga0501235_009326 3300049669 Bacteria 2145
300 Ga0501235_030045 3300049669 Bacteria 1224
301 Ga0501235_046430 3300049669 Unclassified 1000
302 Ga0501238_078175 3300049671 Unclassified 519
303 Ga0501239_002121 3300049672 Unclassified 1776
304 Ga0501239_014634 3300049672 Unclassified 909
305 Ga0501240_007050 3300049673 Bacteria 1401
306 Ga0501240_007568 3300049673 Unclassified 1369
307 Ga0501242_022719 3300049674 Unclassified 816
308 Ga0501243_004196 3300049675 Bacteria 2157
309 Ga0501243_007629 3300049675 Unclassified 1656
310 Ga0501243_008580 3300049675 Bacteria 1577
311 Ga0501249_009006 3300049679 Bacteria 2074
312 Ga0501249_016688 3300049679 Bacteria 1578
313 Ga0501251_007864 3300049681 Unclassified 1195
314 Ga0501253_167104 3300049683 Unclassified 564
315 Ga0501257_010004 3300049686 Bacteria 2147
316 Ga0501257_013407 3300049686 Bacteria 1879
317 Ga0501257_019386 3300049686 Bacteria 1591
318 Ga0501259_013501 3300049688 Bacteria 1373
319 Ga0501259_020047 3300049688 Unclassified 1183
320 Ga0501260_005722 3300049689 Unclassified 1177
321 Ga0501219_018531 3300049703 Unclassified 587
322 Ga0501221_004066 3300049704 Bacteria 2420
323 Ga0501225_0006198 3300049705 Bacteria 3493
324 Ga0501225_0009996 3300049705 Bacteria 2693
325 Ga0501225_0010289 3300049705 Bacteria 2652
326 Ga0501229_000408 3300049706 Bacteria 4819
327 Ga0501229_007218 3300049706 Unclassified 1381
328 Ga0501234_007174 3300049707 Unclassified 1745
329 Ga0501234_008002 3300049707 Unclassified 1652
330 Ga0501234_018965 3300049707 Bacteria 1089
331 Ga0501245_025013 3300049708 Bacteria 957
332 Ga0501245_054783 3300049708 Unclassified 715
333 Ga0501080_0578701 3300049742 Bacteria 998
334 Ga0501081_0081333 3300049743 Bacteria 2269
335 Ga0501241_015940 3300049758 Unclassified 1369
336 Ga0501263_022988 3300049760 Unclassified 847
337 Ga0501268_006811 3300049765 Unclassified 1689
338 Ga0501268_025558 3300049765 Unclassified 1038
339 Ga0501270_017824 3300049767 Bacteria 1044
340 Ga0501273_008987 3300049770 Bacteria 1205
341 Ga0501273_020582 3300049770 Unclassified 891
342 Ga0501273_021310 3300049770 Unclassified 879
343 Ga0501045_0061251 3300049824 Bacteria 2761
344 Ga0501204_004424 3300049850 Bacteria 1514
345 Ga0501204_049690 3300049850 Unclassified 639
346 Ga0501212_030257 3300049851 Bacteria 870
347 Ga0501212_047436 3300049851 Unclassified 721
348 Ga0501226_000462 3300049853 Bacteria 5728
349 Ga0501226_007927 3300049853 Bacteria 1189
350 Ga0501226_011992 3300049853 Unclassified 960
351 nmdc:mga05p37_297670_c1 3300050507 Unclassified 1918
352 nmdc:mga05p37_55546_c1 3300050507 Bacteria 4873
353 nmdc:mga05p37_557214_c1 3300050507 Unclassified 1303
354 nmdc:mga06r32_267045_c1 3300050510 Bacteria 1698
355 nmdc:mga08y16_253342_c1 3300050511 Bacteria 1819
356 nmdc:mga08y16_755387_c1 3300050511 Bacteria 968
357 nmdc:mga0n895_303407_c1 3300050512 Unclassified 1619
358 nmdc:mga0a205_123881_c1 3300050515 Unclassified 2485
359 nmdc:mga0a205_24666_c1 3300050515 Bacteria 5722
360 nmdc:mga0a205_872756_c1 3300050515 Unclassified 747
361 Ga0501084_0327268 3300054114 Bacteria 1294
362 Ga0501082_0727635 3300060353 Unclassified 868
363 Ga0501278_002755
364 MRS1b_contig_7156251
365 JGI24748J21848_1000035
366 JGI24034J26672_10000039
367 JGI25406J46586_10002772
368 JGI25406J46586_10012994
369 JGI25406J46586_10068027
370 Ga0065714_10064428
371 Ga0065712_10000115
372 Ga0065712_10552695
373 Ga0065715_10091197
374 Ga0065707_10107923
375 Ga0070683_100205778
376 Ga0070683_100479158
377 Ga0070670_100146129
378 Ga0068869_100056204
379 Ga0068868_101424587
380 Ga0070687_100632484
381 Ga0070661_100540608
382 Ga0070692_10282390
383 Ga0070671_100121375
384 Ga0070671_100600019
385 Ga0070673_100001252
386 Ga0070673_101551513
387 Ga0070705_100654690
388 Ga0070700_100000376
389 Ga0070694_100000333
390 Ga0070694_100024695
391 Ga0070694_100085434
392 Ga0070694_100087315
393 Ga0070708_100724335
394 Ga0070663_100065457
395 Ga0070681_10035163
396 Ga0070681_10042099
397 Ga0070685_10076660
398 Ga0070707_100138681
399 Ga0070698_100003561
400 Ga0070699_100021104
401 Ga0070695_100234034
402 Ga0070695_100505971
403 Ga0070695_101073914
404 Ga0070696_100012363
405 Ga0070696_100015700
406 Ga0070696_100099190
407 Ga0070693_100062844
408 Ga0070693_100221562
409 Ga0070704_100009865
410 Ga0070704_100062852
411 Ga0070704_100141873
412 Ga0068857_100309278
413 Ga0068856_100146235
414 Ga0070702_100048665
415 Ga0070702_100086263
416 Ga0068852_100187256
417 Ga0068859_100005896
418 Ga0068859_100177620
419 Ga0068859_100210157
420 Ga0068864_100862843
421 Ga0068861_100012524
422 Ga0068861_100115863
423 Ga0068858_100000053
424 Ga0068858_100119685
425 Ga0068860_100064255
426 Ga0068860_101389687
427 Ga0068862_100157413
428 Ga0081539_10001576
429 Ga0081539_10002118
430 Ga0081539_10007822
431 Ga0081539_10069395
432 Ga0075428_100262636
433 Ga0075428_101154190
434 Ga0075431_100277116
435 Ga0075433_10314190
436 Ga0075433_10523224
437 Ga0075434_100044770
438 Ga0075434_100203821
439 Ga0075434_100865597
440 Ga0075429_100620826
441 Ga0097620_100005896
442 Ga0097620_100177607
443 Ga0097620_100210170
444 Ga0075435_100252040
445 Ga0111539_10169289
446 Ga0105247_10000052
447 Ga0105247_10702674
448 Ga0114129_10142202
449 Ga0114129_10177290
450 Ga0114129_10456251
451 Ga0105243_10280529
452 Ga0105241_10386728
453 Ga0105241_10810284
454 Ga0105248_10006441
455 Ga0105248_10155007
456 Ga0105248_10964538
457 Ga0105249_10120836
458 Ga0105239_10144504
459 Ga0163162_10383599
460 Ga0163162_10647623
461 Ga0163162_11082483
462 Ga0163162_11215960
463 Ga0157375_10021407
464 Ga0157375_12511499
465 Ga0163163_10105659
466 Ga0213876_10000047
467 Ga0213876_10000133
468 Ga0207672_1000342
469 Ga0207710_10000004
470 Ga0207710_10401515
471 Ga0207707_10259343
472 Ga0207662_10095240
473 Ga0207662_10775373
474 Ga0207646_10117591
475 Ga0207681_10937411
476 Ga0207650_10035124
477 Ga0207644_10000470
478 Ga0207706_10003614
479 Ga0207686_10000272
480 Ga0207670_10366822
481 Ga0207691_10697454
482 Ga0207691_10797640
483 Ga0207711_10002310
484 Ga0207689_10273709
485 Ga0207689_10291066
486 Ga0207651_10002037
487 Ga0207651_10992690
488 Ga0207703_10000093
489 Ga0207703_10049342
490 Ga0207703_10186744
491 Ga0207639_10169660
492 Ga0207708_10000088
493 Ga0207641_10777244
494 Ga0207676_10132825
495 Ga0207676_10251286
496 Ga0207676_11170631
497 Ga0207674_10322443
498 Ga0207674_10378242
499 Ga0207675_100048714
500 Ga0207675_100313178
501 Ga0207698_10917007
502 Ga0207428_10401322
503 Ga0268264_10046995
504 Ga0307408_100089806
505 Ga0307408_100150821
506 Ga0307408_100162007
507 Ga0307408_100288236
508 Ga0307408_101071641
509 Ga0307408_101136810
510 Ga0307405_10056434
511 Ga0307405_10059147
512 Ga0307405_10073701
513 Ga0307413_10042347
514 Ga0307413_10159602
515 Ga0307413_10475617
516 Ga0307410_10010353
517 Ga0307410_10025145
518 Ga0307410_10188834
519 Ga0307410_10213212
520 Ga0307410_10260408
521 Ga0307410_10270644
522 Ga0307410_10303487
523 Ga0307410_10445285
524 Ga0307410_10700271
525 Ga0307406_10007799
526 Ga0307406_10152903
527 Ga0307406_10906672
528 Ga0307406_11232130
529 Ga0307407_10081329
530 Ga0307407_10127263
531 Ga0307407_10684823
532 Ga0307412_10057893
533 Ga0307412_10062366
534 Ga0307412_10140423
535 Ga0307412_10254944
536 Ga0307412_10348164
537 Ga0307409_100018238
538 Ga0307409_100044284
539 Ga0307409_100358121
540 Ga0307409_101632021
541 Ga0307416_100022618
542 Ga0307416_100064795
543 Ga0307416_100097275
544 Ga0307416_100753637
545 Ga0307414_10008653
546 Ga0307414_10229481
547 Ga0307414_10235688
548 Ga0307414_10463937
549 Ga0307411_10013817
550 Ga0307411_10039559
551 Ga0307411_10135510
552 Ga0307411_10304013
553 Ga0307411_10328565
554 Ga0307415_100029448
555 Ga0307415_100039285
556 Ga0307415_100044044
557 Ga0307415_100566902
558 Ga0307415_100921902
559 Ga0307415_101001451
560 Ga0373941_0039183
561 Ga0373931_0236492
562 Ga0395900_0683203
563 Ga0436364_0915494
564 Ga0436365_0510131
565 Ga0436365_0760749
566 Ga0439439_0023561
567 Ga0439447_025678
568 Ga0439466_0050781
569 Ga0439431_0054324
570 Ga0439448_0091711
571 Ga0439432_016770
572 Ga0439432_080771
573 Ga0439452_015730
574 Ga0439455_0066646
575 Ga0439462_0102482
576 Ga0450894_010194
577 Ga0450898_007597
578 Ga0439458_0013577
579 Ga0450909_022679
580 Ga0439434_0102634
581 Ga0439435_0002660
582 Ga0439459_0128028
583 Ga0450918_021874
584 Ga0466972_0001312
585 Ga0466964_0110642
586 Ga0451576_1060732
587 Ga0451576_1387220
588 Ga0495659_0049646
589 Ga0496102_0424898
590 Ga0496104_0190066
591 Ga0496106_0251593
592 Ga0496106_0255497
593 Ga0496106_0318640
594 Ga0496107_0070382
595 Ga0496110_0224660
596 Ga0496112_0765912
597 Ga0501305_085282
598 Ga0501290_029956
599 Ga0501291_004525
600 Ga0501291_004649
601 Ga0501292_005446
602 Ga0501292_040906
603 Ga0501292_077938
604 Ga0501293_004096
605 Ga0501296_002827
606 Ga0501296_016829
607 Ga0501298_009503
608 Ga0501298_022615
609 Ga0501299_001574
610 Ga0501299_010283
611 Ga0501300_014901
612 Ga0501303_010111
613 Ga0501036_0085328
614 Ga0501037_0941117
615 Ga0501040_0445431
616 Ga0501075_0085291
617 Ga0501075_0509415
618 Ga0501076_0100743
619 Ga0501076_0264813
620 Ga0501076_0492995
621 Ga0501077_0024285
622 Ga0501077_0177817
623 Ga0501198_003172
624 Ga0501198_055140
625 Ga0501198_104493
626 Ga0501199_004455
627 Ga0501201_012984
628 Ga0501202_009471
629 Ga0501202_011572
630 Ga0501202_051272
631 Ga0501206_009514
632 Ga0501206_014304
633 Ga0501206_027997
634 Ga0501207_000247
635 Ga0501207_003189
636 Ga0501208_093260
637 Ga0501209_015774
638 Ga0501209_054589
639 Ga0501214_016495
640 Ga0501216_028993
641 Ga0501216_030231
642 Ga0501217_001885
643 Ga0501217_006966
644 Ga0501217_129132
645 Ga0501223_002018
646 Ga0501223_014546
647 Ga0501223_015244
648 Ga0501224_001094
649 Ga0501224_002006
650 Ga0501224_005511
651 Ga0501224_028778
652 Ga0501227_003129
653 Ga0501227_008157
654 Ga0501228_020418
655 Ga0501230_023343
656 Ga0501230_036536
657 Ga0501233_008567
658 Ga0501233_022022
659 Ga0501233_028886
660 Ga0501235_005966
661 Ga0501235_009326
662 Ga0501235_030045
663 Ga0501235_046430
664 Ga0501238_078175
665 Ga0501239_002121
666 Ga0501239_014634
667 Ga0501240_007050
668 Ga0501240_007568
669 Ga0501242_022719
670 Ga0501243_004196
671 Ga0501243_007629
672 Ga0501243_008580
673 Ga0501249_009006
674 Ga0501249_016688
675 Ga0501251_007864
676 Ga0501253_167104
677 Ga0501257_010004
678 Ga0501257_013407
679 Ga0501257_019386
680 Ga0501259_013501
681 Ga0501259_020047
682 Ga0501260_005722
683 Ga0501219_018531
684 Ga0501221_004066
685 Ga0501225_0006198
686 Ga0501225_0009996
687 Ga0501225_0010289
688 Ga0501229_000408
689 Ga0501229_007218
690 Ga0501234_007174
691 Ga0501234_008002
692 Ga0501234_018965
693 Ga0501245_025013
694 Ga0501245_054783
695 Ga0501080_0578701
696 Ga0501081_0081333
697 Ga0501241_015940
698 Ga0501263_022988
699 Ga0501268_006811
700 Ga0501268_025558
701 Ga0501270_017824
702 Ga0501273_008987
703 Ga0501273_020582
704 Ga0501273_021310
705 Ga0501045_0061251
706 Ga0501204_004424
707 Ga0501204_049690
708 Ga0501212_030257
709 Ga0501212_047436
710 Ga0501226_000462
711 Ga0501226_007927
712 Ga0501226_011992
713 nmdc:mga05p37_297670_c1
714 nmdc:mga05p37_55546_c1
715 nmdc:mga05p37_557214_c1
716 nmdc:mga06r32_267045_c1
717 nmdc:mga08y16_253342_c1
718 nmdc:mga08y16_755387_c1
719 nmdc:mga0n895_303407_c1
720 nmdc:mga0a205_123881_c1
721 nmdc:mga0a205_24666_c1
722 nmdc:mga0a205_872756_c1
723 Ga0501084_0327268
724 Ga0501082_0727635

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09990

DUF2231

Predicted membrane protein (DUF2231)

30

169

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gyb-assembly1.cif.gz_c cryo-em structure of the bacteria-killing type iv secretion system core complex from xanthomonas citri 0.7344 103 151
8dt0-assembly2.cif.gz_B scaffolding protein functional sites using deep learning 0.6829 20 159
5j7y-assembly1.cif.gz_BC architecture of loose respirasome 0.6627 31 158
7au3-assembly1.cif.gz_C cytochrome c oxidase structure in f-state 0.6589 27 158
8dt0-assembly2.cif.gz_B scaffolding protein functional sites using deep learning 0.6566 20 159
ID Description Score Start End Superfamily
af_A0A1D6JN65_108_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7548 34 157 1.20.120.1770
af_Q1LU92_154_264_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.7438 62 159 1.20.120.230
af_A0A0N7KE83_180_366_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7376 31 160 1.20.120.1770
af_G5EGK1_821_936_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.7245 38 154 1.20.120.230
af_A0A0G2K4Q7_1684_2098_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7239 69 158 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A538EEZ6-F1-model_v4 DUF2231 domain-containing protein 0.952 28 141 GO:0016020
AF-A0A518DEY3-F1-model_v4 DUF2231 domain-containing protein 0.9458 26 169 GO:0016020
AF-A0A1C6W6A2-F1-model_v4 Uncharacterized membrane protein 0.9372 47 186 GO:0016020
AF-A0A2V5J607-F1-model_v4 DUF2231 domain-containing protein 0.936 26 150 GO:0016020
AF-A0A2V5T9N6-F1-model_v4 Rieske domain-containing protein 0.9305 34 163 GO:0016020
GO:0046872
GO:0051537

Map