F422669

General Info

Members Datasets Scaffolds Average Seq Length
362 225 724 237

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0016771|Ga0373947_0016771_2339_3121
Length 260
Sequence MLTDDEVQRALVIVAHPDDVDFGAAGTVATWTGAGIEVAYCIVTDGDAGGFDPDVPRAEIPGIRRAEQTAAAKEVGVADLAFLGYPDGRLVTSLDLRRDLAREIRRVRPQRVLCPSPERNWQRIFASHPDHLAAGEASMAAVYPDARNPFAHPELLDEGYEPWSVLEVWMMASPVRNRWVDVTDALPSKLDALRNHVSQHTDVDGKLEDRMRGWAAMVAQEAGLPDGRLAEGFFAIDSAGCRAARVRRSRSGSPRPPSSP

Samples

Sample ID Description Type Environment
1 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
156 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
163 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.28
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 7.18
Rhizosphere 90.61
Stem 0
Stem Tuber 0
Unclassified 2.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373947_0016771 3300035725 Bacteria 4209
2 JGI24740J21852_10022376 3300001979 Bacteria 2177
3 JGI24735J21928_10004957 3300002067 Bacteria 4437
4 JGI24751J29686_10010574 3300002459 Bacteria 1901
5 Ga0065715_10004065 3300005293 Bacteria 6278
6 Ga0065715_10006698 3300005293 Bacteria 3293
7 Ga0065707_10214360 3300005295 Bacteria 1251
8 Ga0070658_10000394 3300005327 Bacteria 37936
9 Ga0070658_10456657 3300005327 Bacteria 1101
10 Ga0070676_10172852 3300005328 Bacteria 1399
11 Ga0070690_100059887 3300005330 Unclassified 2449
12 Ga0068869_100010112 3300005334 Bacteria 6139
13 Ga0070666_10126602 3300005335 Bacteria 1773
14 Ga0070680_100047354 3300005336 Bacteria 3500
15 Ga0070682_100009333 3300005337 Bacteria 5553
16 Ga0068868_100118686 3300005338 Bacteria 2156
17 Ga0068868_100140896 3300005338 Bacteria 1979
18 Ga0070660_100106143 3300005339 Bacteria 2230
19 Ga0070689_100017154 3300005340 Bacteria 5313
20 Ga0070691_10001412 3300005341 Bacteria 10249
21 Ga0070691_10034819 3300005341 Bacteria 2371
22 Ga0070687_100034191 3300005343 Bacteria 2514
23 Ga0070687_100127725 3300005343 Bacteria 1464
24 Ga0070661_100011713 3300005344 Bacteria 6117
25 Ga0070692_10013126 3300005345 Bacteria 3855
26 Ga0070692_10073617 3300005345 Bacteria 1825
27 Ga0070675_100051158 3300005354 Bacteria 3394
28 Ga0070671_100002217 3300005355 Bacteria 14999
29 Ga0070674_100345588 3300005356 Bacteria 1200
30 Ga0070673_100039988 3300005364 Bacteria 3594
31 Ga0070673_100870985 3300005364 Unclassified 834
32 Ga0070667_100133578 3300005367 Bacteria 2168
33 Ga0070703_10002106 3300005406 Bacteria 5799
34 Ga0070703_10004402 3300005406 Bacteria 3964
35 Ga0070709_10000174 3300005434 Bacteria 40653
36 Ga0070709_10341745 3300005434 Bacteria 1104
37 Ga0070714_100010868 3300005435 Bacteria 7211
38 Ga0070714_100047793 3300005435 Bacteria 3637
39 Ga0070714_100214820 3300005435 Bacteria 1765
40 Ga0070713_100002601 3300005436 Bacteria 11791
41 Ga0070713_100021755 3300005436 Bacteria 4942
42 Ga0070701_10107279 3300005438 Bacteria 1555
43 Ga0070705_100110105 3300005440 Bacteria 1758
44 Ga0070700_100000015 3300005441 Bacteria 149873
45 Ga0070700_100041120 3300005441 Bacteria 2833
46 Ga0070694_100141764 3300005444 Bacteria 1747
47 Ga0070694_100174328 3300005444 Bacteria 1586
48 Ga0070708_100028491 3300005445 Bacteria 4806
49 Ga0070708_100068227 3300005445 Bacteria 3196
50 Ga0070663_100006009 3300005455 Bacteria 7265
51 Ga0070663_100351780 3300005455 Bacteria 1193
52 Ga0070678_100003351 3300005456 Bacteria 8923
53 Ga0070681_10021307 3300005458 Bacteria 6497
54 Ga0070681_10220963 3300005458 Bacteria 1810
55 Ga0070681_10295035 3300005458 Bacteria 1531
56 Ga0070685_10083782 3300005466 Unclassified 1916
57 Ga0070706_100000805 3300005467 Bacteria 34769
58 Ga0070706_100040574 3300005467 Bacteria 4297
59 Ga0070706_100074231 3300005467 Unclassified 3148
60 Ga0070706_100168121 3300005467 Bacteria 2047
61 Ga0070707_100064238 3300005468 Bacteria 3524
62 Ga0070707_100185164 3300005468 Bacteria 2030
63 Ga0070707_100296370 3300005468 Bacteria 1571
64 Ga0070698_100098615 3300005471 Unclassified 2895
65 Ga0070698_100101002 3300005471 Bacteria 2856
66 Ga0070698_100106100 3300005471 Bacteria 2778
67 Ga0070698_100168946 3300005471 Bacteria 2128
68 Ga0070699_100022957 3300005518 Bacteria 5374
69 Ga0070699_100155648 3300005518 Bacteria 2023
70 Ga0070699_100223311 3300005518 Unclassified 1679
71 Ga0070699_100379738 3300005518 Bacteria 1276
72 Ga0070699_100448892 3300005518 Bacteria 1169
73 Ga0070679_100370807 3300005530 Bacteria 1379
74 Ga0070697_100101863 3300005536 Bacteria 2386
75 Ga0068853_100016602 3300005539 Bacteria 6062
76 Ga0070695_100033207 3300005545 Bacteria 3228
77 Ga0070695_100120181 3300005545 Bacteria 1796
78 Ga0070695_100354539 3300005545 Bacteria 1100
79 Ga0070696_100044713 3300005546 Bacteria 3067
80 Ga0070693_100003175 3300005547 Bacteria 7629
81 Ga0068855_100094449 3300005563 Bacteria 3448
82 Ga0070664_100028535 3300005564 Bacteria 4643
83 Ga0070664_100089345 3300005564 Bacteria 2665
84 Ga0068857_100003577 3300005577 Bacteria 13001
85 Ga0068857_100240579 3300005577 Bacteria 1657
86 Ga0068857_100354513 3300005577 Bacteria 1359
87 Ga0068854_100035278 3300005578 Bacteria 3499
88 Ga0068856_100202196 3300005614 Bacteria 2001
89 Ga0070702_100000031 3300005615 Bacteria 37489
90 Ga0070702_100168281 3300005615 Bacteria 1423
91 Ga0068852_100193149 3300005616 Bacteria 1922
92 Ga0068864_100004525 3300005618 Bacteria 11419
93 Ga0068861_100132926 3300005719 Bacteria 2021
94 Ga0068851_10016339 3300005834 Bacteria 3550
95 Ga0068870_10000797 3300005840 Bacteria 12206
96 Ga0068870_10441475 3300005840 Bacteria 856
97 Ga0068863_100026018 3300005841 Bacteria 5583
98 Ga0068863_100490702 3300005841 Bacteria 1209
99 Ga0068858_100065451 3300005842 Bacteria 3363
100 Ga0068860_100030103 3300005843 Bacteria 5221
101 Ga0070717_10245294 3300006028 Bacteria 1581
102 Ga0075432_10010633 3300006058 Bacteria 3127
103 Ga0097621_100055011 3300006237 Bacteria 3249
104 Ga0068871_100023010 3300006358 Bacteria 4812
105 Ga0075428_100062393 3300006844 Bacteria 4081
106 Ga0075428_100076895 3300006844 Bacteria 3644
107 Ga0075428_100219238 3300006844 Bacteria 2054
108 Ga0075428_100287748 3300006844 Bacteria 1768
109 Ga0075430_100063708 3300006846 Bacteria 3096
110 Ga0075430_100136853 3300006846 Bacteria 2040
111 Ga0075430_100192832 3300006846 Bacteria 1693
112 Ga0075431_100036210 3300006847 Bacteria 5083
113 Ga0075431_100055919 3300006847 Bacteria 4071
114 Ga0075431_100101096 3300006847 Bacteria 2975
115 Ga0075433_10002409 3300006852 Bacteria 14226
116 Ga0075433_10003449 3300006852 Bacteria 12199
117 Ga0075433_10057399 3300006852 Bacteria 3402
118 Ga0075433_10250544 3300006852 Bacteria 1571
119 Ga0075433_10352920 3300006852 Bacteria 1300
120 Ga0075434_100004660 3300006871 Bacteria 12394
121 Ga0075434_100117769 3300006871 Bacteria 2669
122 Ga0075434_100614339 3300006871 Bacteria 1106
123 Ga0075429_100010469 3300006880 Bacteria 8024
124 Ga0075429_100052737 3300006880 Bacteria 3539
125 Ga0075436_100019211 3300006914 Bacteria 4682
126 Ga0075435_100009924 3300007076 Bacteria 6935
127 Ga0075435_100013753 3300007076 Bacteria 6031
128 Ga0075435_100115138 3300007076 Bacteria 2238
129 Ga0105251_10030682 3300009011 Bacteria 2696
130 Ga0111539_10008409 3300009094 Bacteria 13131
131 Ga0105245_10018312 3300009098 Bacteria 6123
132 Ga0105245_10030591 3300009098 Bacteria 4761
133 Ga0105245_10218779 3300009098 Bacteria 1837
134 Ga0105247_10015279 3300009101 Bacteria 4600
135 Ga0114129_10001061 3300009147 Bacteria 36092
136 Ga0114129_10002869 3300009147 Bacteria 24122
137 Ga0114129_10018249 3300009147 Bacteria 9990
138 Ga0114129_10110969 3300009147 Bacteria 3785
139 Ga0114129_10295405 3300009147 Bacteria 2161
140 Ga0114129_10358227 3300009147 Bacteria 1931
141 Ga0114129_10545752 3300009147 Bacteria 1508
142 Ga0105243_10173046 3300009148 Bacteria 1872
143 Ga0105243_10463843 3300009148 Bacteria 1192
144 Ga0105241_10007760 3300009174 Bacteria 7888
145 Ga0105242_10182828 3300009176 Bacteria 1851
146 Ga0105248_10015355 3300009177 Bacteria 8446
147 Ga0105248_10290721 3300009177 Bacteria 1840
148 Ga0105237_10212932 3300009545 Bacteria 1932
149 Ga0105238_10062046 3300009551 Bacteria 3739
150 Ga0105249_10200439 3300009553 Bacteria 1953
151 Ga0105246_10002591 3300011119 Bacteria 10936
152 Ga0157369_10513858 3300013105 Bacteria 1239
153 Ga0157374_10106813 3300013296 Bacteria 2690
154 Ga0157372_10225318 3300013307 Bacteria 2173
155 Ga0157375_10209358 3300013308 Bacteria 2107
156 Ga0157375_10852741 3300013308 Unclassified 1057
157 Ga0157380_10276525 3300014326 Bacteria 1534
158 Ga0182008_10088574 3300014497 Bacteria 1525
159 Ga0157377_10038070 3300014745 Bacteria 2653
160 Ga0157376_10194572 3300014969 Bacteria 1862
161 Ga0207656_10019521 3300025321 Bacteria 2682
162 Ga0207653_10000215 3300025885 Bacteria 38761
163 Ga0207653_10013748 3300025885 Bacteria 2536
164 Ga0207710_10008526 3300025900 Bacteria 4321
165 Ga0207688_10002409 3300025901 Bacteria 10081
166 Ga0207647_10017799 3300025904 Bacteria 4821
167 Ga0207647_10101593 3300025904 Bacteria 1706
168 Ga0207699_10000113 3300025906 Bacteria 57081
169 Ga0207645_10102494 3300025907 Bacteria 1847
170 Ga0207645_10467578 3300025907 Bacteria 852
171 Ga0207643_10000993 3300025908 Bacteria 16925
172 Ga0207705_10439165 3300025909 Bacteria 1011
173 Ga0207684_10000294 3300025910 Bacteria 71779
174 Ga0207684_10013589 3300025910 Bacteria 7037
175 Ga0207684_10029782 3300025910 Bacteria 4647
176 Ga0207684_10477795 3300025910 Bacteria 1069
177 Ga0207684_10817232 3300025910 Unclassified 787
178 Ga0207654_10009785 3300025911 Bacteria 4877
179 Ga0207707_10374121 3300025912 Bacteria 1225
180 Ga0207693_10105681 3300025915 Bacteria 2208
181 Ga0207660_10003807 3300025917 Bacteria 9825
182 Ga0207660_10015733 3300025917 Bacteria 4998
183 Ga0207657_10016459 3300025919 Bacteria 7132
184 Ga0207649_10008857 3300025920 Bacteria 5496
185 Ga0207652_10010687 3300025921 Bacteria 7393
186 Ga0207652_10057992 3300025921 Unclassified 3336
187 Ga0207646_10000004 3300025922 Bacteria 529176
188 Ga0207646_10183880 3300025922 Bacteria 1888
189 Ga0207694_10091973 3300025924 Bacteria 2394
190 Ga0207650_10002602 3300025925 Bacteria 12489
191 Ga0207687_10014620 3300025927 Bacteria 5139
192 Ga0207687_10040608 3300025927 Bacteria 3190
193 Ga0207700_10002124 3300025928 Bacteria 11328
194 Ga0207700_10344651 3300025928 Bacteria 1296
195 Ga0207664_10005731 3300025929 Bacteria 8494
196 Ga0207664_10651901 3300025929 Bacteria 946
197 Ga0207644_10012274 3300025931 Bacteria 5686
198 Ga0207690_10052179 3300025932 Bacteria 2738
199 Ga0207706_10012460 3300025933 Bacteria 7749
200 Ga0207686_10218353 3300025934 Bacteria 1375
201 Ga0207709_10212418 3300025935 Bacteria 1390
202 Ga0207670_10018977 3300025936 Bacteria 4192
203 Ga0207691_10034194 3300025940 Bacteria 4728
204 Ga0207689_10007673 3300025942 Bacteria 9447
205 Ga0207689_10287685 3300025942 Bacteria 1361
206 Ga0207679_10014467 3300025945 Bacteria 5190
207 Ga0207679_10026689 3300025945 Bacteria 3986
208 Ga0207667_10074695 3300025949 Bacteria 3520
209 Ga0207658_10082438 3300025986 Bacteria 2470
210 Ga0207677_10001744 3300026023 Bacteria 11515
211 Ga0207677_10096935 3300026023 Bacteria 2159
212 Ga0207703_10122808 3300026035 Bacteria 2231
213 Ga0207639_10158907 3300026041 Bacteria 1902
214 Ga0207678_10002478 3300026067 Bacteria 16776
215 Ga0207708_10000004 3300026075 Bacteria 293087
216 Ga0207708_10007823 3300026075 Bacteria 7917
217 Ga0207708_10162045 3300026075 Bacteria 1767
218 Ga0207702_10004395 3300026078 Bacteria 12555
219 Ga0207702_10040973 3300026078 Bacteria 3883
220 Ga0207641_10055302 3300026088 Bacteria 3369
221 Ga0207641_10274045 3300026088 Bacteria 1584
222 Ga0207641_10721078 3300026088 Bacteria 983
223 Ga0207648_10392060 3300026089 Bacteria 1257
224 Ga0207676_10003678 3300026095 Bacteria 10839
225 Ga0207674_10007812 3300026116 Bacteria 12433
226 Ga0207674_10266096 3300026116 Bacteria 1662
227 Ga0207683_10008265 3300026121 Bacteria 8902
228 Ga0207698_10028157 3300026142 Bacteria 4002
229 Ga0207698_10153429 3300026142 Bacteria 2003
230 Ga0209999_1047434 3300027543 Bacteria 809
231 Ga0207428_10007694 3300027907 Bacteria 9805
232 Ga0268266_10061960 3300028379 Bacteria 3227
233 Ga0268265_10614955 3300028380 Bacteria 1040
234 Ga0268264_10213781 3300028381 Bacteria 1771
235 Ga0265760_10051993 3300031090 Bacteria 1235
236 Ga0265327_10104539 3300031251 Bacteria 1361
237 Ga0316576_10127013 3300031727 Bacteria 1917
238 Ga0307406_10750533 3300031901 Bacteria 819
239 Ga0373941_0157352 3300035115 Bacteria 838
240 Ga0316574_0053607 3300035398 Bacteria 2518
241 Ga0316574_0066054 3300035398 Bacteria 2278
242 Ga0316574_0215914 3300035398 Bacteria 1230
243 Ga0373931_0071675 3300035691 Bacteria 1893
244 Ga0373935_0442526 3300035692 Bacteria 938
245 Ga0316582_0392489 3300036647 Bacteria 956
246 Ga0316584_0091115 3300036712 Bacteria 2282
247 Ga0316584_0102458 3300036712 Bacteria 2144
248 Ga0395900_0218586 3300037418 Bacteria 1922
249 Ga0395905_0428371 3300037471 Bacteria 1220
250 Ga0395901_0540468 3300038443 Bacteria 1182
251 Ga0400483_009059 3300039062 Bacteria 2692
252 Ga0400483_041505 3300039062 Bacteria 1762
253 Ga0400483_135548 3300039062 Bacteria 11027
254 Ga0400483_171620 3300039062 Bacteria 1554
255 Ga0400483_263403 3300039062 Bacteria 4036
256 Ga0400483_266413 3300039062 Bacteria 7023
257 Ga0436365_1535494 3300039437 Bacteria 6911
258 Ga0436362_0176685 3300039453 Bacteria 994
259 Ga0439463_024343 3300042016 Bacteria 1517
260 Ga0466963_0165672 3300044694 Bacteria 1539
261 Ga0466971_0112930 3300044719 Bacteria 1255
262 Ga0466957_0181130 3300044842 Bacteria 1376
263 Ga0466960_0115722 3300044901 Bacteria 1398
264 Ga0466960_0281632 3300044901 Bacteria 932
265 Ga0466960_0430775 3300044901 Bacteria 764
266 Ga0466958_0022758 3300045836 Bacteria 3673
267 Ga0466967_0061477 3300045976 Bacteria 3332
268 Ga0495592_0049937 3300046454 Bacteria 3109
269 Ga0495629_0217323 3300046459 Bacteria 1319
270 Ga0495629_0533727 3300046459 Bacteria 789
271 Ga0495653_0078448 3300046463 Bacteria 2449
272 Ga0495582_0156509 3300046473 Bacteria 1295
273 Ga0495582_0245353 3300046473 Bacteria 1027
274 Ga0495639_0130847 3300046475 Bacteria 1201
275 Ga0495585_0128121 3300046492 Bacteria 1338
276 Ga0495608_0014059 3300046511 Bacteria 5555
277 Ga0495608_0214871 3300046511 Bacteria 1208
278 Ga0495628_0002848 3300046516 Bacteria 15505
279 Ga0495628_0015308 3300046516 Bacteria 6406
280 Ga0495630_0025399 3300046517 Bacteria 4380
281 Ga0495630_0082721 3300046517 Bacteria 2423
282 Ga0495630_0247054 3300046517 Bacteria 1363
283 Ga0495666_0010373 3300046526 Bacteria 4644
284 Ga0495652_0451534 3300046529 Bacteria 900
285 Ga0495586_0238715 3300046535 Bacteria 1035
286 Ga0495645_0045999 3300046543 Bacteria 3183
287 Ga0495667_0115756 3300046559 Bacteria 1732
288 Ga0495634_0144499 3300046642 Bacteria 1508
289 Ga0495635_0329725 3300046663 Bacteria 1021
290 Ga0495657_0092940 3300046675 Bacteria 1932
291 Ga0495657_0163400 3300046675 Bacteria 1376
292 Ga0495657_0323717 3300046675 Bacteria 916
293 Ga0495658_0016079 3300046683 Bacteria 3850
294 Ga0495658_0214055 3300046683 Bacteria 1205
295 Ga0495649_0034979 3300046694 Bacteria 2763
296 Ga0495604_0210307 3300047317 Bacteria 1344
297 Ga0495674_0210771 3300047319 Bacteria 1609
298 Ga0495680_0043113 3300047322 Bacteria 3575
299 Ga0495680_0172814 3300047322 Bacteria 1564
300 Ga0495675_0022174 3300047444 Bacteria 4047
301 Ga0495675_0160795 3300047444 Bacteria 1383
302 Ga0496100_0183421 3300048903 Bacteria 1515
303 Ga0496101_0004975 3300048904 Bacteria 8438
304 Ga0496102_0044443 3300048905 Bacteria 4031
305 Ga0496102_0170032 3300048905 Bacteria 2052
306 Ga0496104_0027598 3300048907 Bacteria 5255
307 Ga0496105_0013907 3300048908 Bacteria 6395
308 Ga0496106_0008854 3300048909 Bacteria 7439
309 Ga0496107_0023217 3300048910 Bacteria 4385
310 Ga0496108_0062528 3300048911 Bacteria 3135
311 Ga0496108_0117629 3300048911 Bacteria 2277
312 Ga0496109_0043865 3300048912 Bacteria 4054
313 Ga0496109_0378667 3300048912 Bacteria 1337
314 Ga0496109_0534370 3300048912 Bacteria 1106
315 Ga0496110_0015677 3300048913 Bacteria 6314
316 Ga0496110_0191565 3300048913 Bacteria 1857
317 Ga0496110_0259800 3300048913 Bacteria 1581
318 Ga0496110_0345335 3300048913 Bacteria 1356
319 Ga0496110_0362447 3300048913 Bacteria 1321
320 Ga0496110_0442052 3300048913 Bacteria 1185
321 Ga0496111_0002113 3300048914 Bacteria 11864
322 Ga0496112_0022823 3300048915 Bacteria 5970
323 Ga0496112_0156268 3300048915 Bacteria 2248
324 Ga0496113_0018426 3300048916 Bacteria 4861
325 Ga0496113_0461925 3300048916 Unclassified 1020
326 Ga0496114_0028632 3300048917 Bacteria 4573
327 Ga0496114_0187858 3300048917 Bacteria 1807
328 Ga0501047_0354734 3300049581 Bacteria 1303
329 Ga0501067_0536688 3300049583 Bacteria 655
330 Ga0501044_0162489 3300049823 Bacteria 2209
331 nmdc:mga05p37_107458_c1 3300050507 Bacteria 3433
332 nmdc:mga05p37_17406_c1 3300050507 Bacteria 8673
333 nmdc:mga05p37_45617_c1 3300050507 Bacteria 5390
334 nmdc:mga05p37_470_c1 3300050507 Bacteria 43956
335 nmdc:mga05p37_689719_c1 3300050507 Bacteria 1137
336 nmdc:mga05p37_69818_c1 3300050507 Bacteria 4321
337 nmdc:mga05p37_73979_c1 3300050507 Bacteria 4194
338 nmdc:mga05p37_811052_c1 3300050507 Bacteria 1022
339 nmdc:mga09592_3521_c1 3300050508 Bacteria 12651
340 nmdc:mga0qj67_100021_c1 3300050509 Bacteria 2337
341 nmdc:mga0qj67_109412_c1 3300050509 Bacteria 2230
342 nmdc:mga0qj67_18384_c2 3300050509 Bacteria 3662
343 nmdc:mga06r32_509571_c1 3300050510 Bacteria 1180
344 nmdc:mga06r32_691576_c1 3300050510 Bacteria 986
345 nmdc:mga06r32_70168_c1 3300050510 Bacteria 3388
346 nmdc:mga08y16_36255_c1 3300050511 Bacteria 5179
347 nmdc:mga0n895_135558_c1 3300050512 Bacteria 2489
348 nmdc:mga0n895_352048_c1 3300050512 Bacteria 1492
349 nmdc:mga0n895_75819_c1 3300050512 Bacteria 3344
350 nmdc:mga0rr50_133982_c1 3300050513 Bacteria 1987
351 nmdc:mga0rr50_9979_c1 3300050513 Bacteria 6005
352 nmdc:mga08x19_19496_c1 3300050514 Bacteria 4163
353 nmdc:mga0a205_13429_c1 3300050515 Bacteria 7626
354 nmdc:mga0a205_254778_c1 3300050515 Bacteria 1634
355 nmdc:mga0a205_42920_c1 3300050515 Bacteria 4359
356 Ga0495601_0191340 3300053077 Bacteria 1337
357 Ga0495612_0220264 3300053078 Bacteria 840
358 Ga0495619_0003297 3300053085 Bacteria 10431
359 Ga0500616_0014897 3300053153 Bacteria 4456
360 Ga0501084_0073086 3300054114 Bacteria 2872
361 Ga0501082_0539572 3300060353 Bacteria 1020
362 2816423564 2816332119 Bacteria 8120218
363 Ga0373947_0016771
364 JGI24740J21852_10022376
365 JGI24735J21928_10004957
366 JGI24751J29686_10010574
367 Ga0065715_10004065
368 Ga0065715_10006698
369 Ga0065707_10214360
370 Ga0070658_10000394
371 Ga0070658_10456657
372 Ga0070676_10172852
373 Ga0070690_100059887
374 Ga0068869_100010112
375 Ga0070666_10126602
376 Ga0070680_100047354
377 Ga0070682_100009333
378 Ga0068868_100118686
379 Ga0068868_100140896
380 Ga0070660_100106143
381 Ga0070689_100017154
382 Ga0070691_10001412
383 Ga0070691_10034819
384 Ga0070687_100034191
385 Ga0070687_100127725
386 Ga0070661_100011713
387 Ga0070692_10013126
388 Ga0070692_10073617
389 Ga0070675_100051158
390 Ga0070671_100002217
391 Ga0070674_100345588
392 Ga0070673_100039988
393 Ga0070673_100870985
394 Ga0070667_100133578
395 Ga0070703_10002106
396 Ga0070703_10004402
397 Ga0070709_10000174
398 Ga0070709_10341745
399 Ga0070714_100010868
400 Ga0070714_100047793
401 Ga0070714_100214820
402 Ga0070713_100002601
403 Ga0070713_100021755
404 Ga0070701_10107279
405 Ga0070705_100110105
406 Ga0070700_100000015
407 Ga0070700_100041120
408 Ga0070694_100141764
409 Ga0070694_100174328
410 Ga0070708_100028491
411 Ga0070708_100068227
412 Ga0070663_100006009
413 Ga0070663_100351780
414 Ga0070678_100003351
415 Ga0070681_10021307
416 Ga0070681_10220963
417 Ga0070681_10295035
418 Ga0070685_10083782
419 Ga0070706_100000805
420 Ga0070706_100040574
421 Ga0070706_100074231
422 Ga0070706_100168121
423 Ga0070707_100064238
424 Ga0070707_100185164
425 Ga0070707_100296370
426 Ga0070698_100098615
427 Ga0070698_100101002
428 Ga0070698_100106100
429 Ga0070698_100168946
430 Ga0070699_100022957
431 Ga0070699_100155648
432 Ga0070699_100223311
433 Ga0070699_100379738
434 Ga0070699_100448892
435 Ga0070679_100370807
436 Ga0070697_100101863
437 Ga0068853_100016602
438 Ga0070695_100033207
439 Ga0070695_100120181
440 Ga0070695_100354539
441 Ga0070696_100044713
442 Ga0070693_100003175
443 Ga0068855_100094449
444 Ga0070664_100028535
445 Ga0070664_100089345
446 Ga0068857_100003577
447 Ga0068857_100240579
448 Ga0068857_100354513
449 Ga0068854_100035278
450 Ga0068856_100202196
451 Ga0070702_100000031
452 Ga0070702_100168281
453 Ga0068852_100193149
454 Ga0068864_100004525
455 Ga0068861_100132926
456 Ga0068851_10016339
457 Ga0068870_10000797
458 Ga0068870_10441475
459 Ga0068863_100026018
460 Ga0068863_100490702
461 Ga0068858_100065451
462 Ga0068860_100030103
463 Ga0070717_10245294
464 Ga0075432_10010633
465 Ga0097621_100055011
466 Ga0068871_100023010
467 Ga0075428_100062393
468 Ga0075428_100076895
469 Ga0075428_100219238
470 Ga0075428_100287748
471 Ga0075430_100063708
472 Ga0075430_100136853
473 Ga0075430_100192832
474 Ga0075431_100036210
475 Ga0075431_100055919
476 Ga0075431_100101096
477 Ga0075433_10002409
478 Ga0075433_10003449
479 Ga0075433_10057399
480 Ga0075433_10250544
481 Ga0075433_10352920
482 Ga0075434_100004660
483 Ga0075434_100117769
484 Ga0075434_100614339
485 Ga0075429_100010469
486 Ga0075429_100052737
487 Ga0075436_100019211
488 Ga0075435_100009924
489 Ga0075435_100013753
490 Ga0075435_100115138
491 Ga0105251_10030682
492 Ga0111539_10008409
493 Ga0105245_10018312
494 Ga0105245_10030591
495 Ga0105245_10218779
496 Ga0105247_10015279
497 Ga0114129_10001061
498 Ga0114129_10002869
499 Ga0114129_10018249
500 Ga0114129_10110969
501 Ga0114129_10295405
502 Ga0114129_10358227
503 Ga0114129_10545752
504 Ga0105243_10173046
505 Ga0105243_10463843
506 Ga0105241_10007760
507 Ga0105242_10182828
508 Ga0105248_10015355
509 Ga0105248_10290721
510 Ga0105237_10212932
511 Ga0105238_10062046
512 Ga0105249_10200439
513 Ga0105246_10002591
514 Ga0157369_10513858
515 Ga0157374_10106813
516 Ga0157372_10225318
517 Ga0157375_10209358
518 Ga0157375_10852741
519 Ga0157380_10276525
520 Ga0182008_10088574
521 Ga0157377_10038070
522 Ga0157376_10194572
523 Ga0207656_10019521
524 Ga0207653_10000215
525 Ga0207653_10013748
526 Ga0207710_10008526
527 Ga0207688_10002409
528 Ga0207647_10017799
529 Ga0207647_10101593
530 Ga0207699_10000113
531 Ga0207645_10102494
532 Ga0207645_10467578
533 Ga0207643_10000993
534 Ga0207705_10439165
535 Ga0207684_10000294
536 Ga0207684_10013589
537 Ga0207684_10029782
538 Ga0207684_10477795
539 Ga0207684_10817232
540 Ga0207654_10009785
541 Ga0207707_10374121
542 Ga0207693_10105681
543 Ga0207660_10003807
544 Ga0207660_10015733
545 Ga0207657_10016459
546 Ga0207649_10008857
547 Ga0207652_10010687
548 Ga0207652_10057992
549 Ga0207646_10000004
550 Ga0207646_10183880
551 Ga0207694_10091973
552 Ga0207650_10002602
553 Ga0207687_10014620
554 Ga0207687_10040608
555 Ga0207700_10002124
556 Ga0207700_10344651
557 Ga0207664_10005731
558 Ga0207664_10651901
559 Ga0207644_10012274
560 Ga0207690_10052179
561 Ga0207706_10012460
562 Ga0207686_10218353
563 Ga0207709_10212418
564 Ga0207670_10018977
565 Ga0207691_10034194
566 Ga0207689_10007673
567 Ga0207689_10287685
568 Ga0207679_10014467
569 Ga0207679_10026689
570 Ga0207667_10074695
571 Ga0207658_10082438
572 Ga0207677_10001744
573 Ga0207677_10096935
574 Ga0207703_10122808
575 Ga0207639_10158907
576 Ga0207678_10002478
577 Ga0207708_10000004
578 Ga0207708_10007823
579 Ga0207708_10162045
580 Ga0207702_10004395
581 Ga0207702_10040973
582 Ga0207641_10055302
583 Ga0207641_10274045
584 Ga0207641_10721078
585 Ga0207648_10392060
586 Ga0207676_10003678
587 Ga0207674_10007812
588 Ga0207674_10266096
589 Ga0207683_10008265
590 Ga0207698_10028157
591 Ga0207698_10153429
592 Ga0209999_1047434
593 Ga0207428_10007694
594 Ga0268266_10061960
595 Ga0268265_10614955
596 Ga0268264_10213781
597 Ga0265760_10051993
598 Ga0265327_10104539
599 Ga0316576_10127013
600 Ga0307406_10750533
601 Ga0373941_0157352
602 Ga0316574_0053607
603 Ga0316574_0066054
604 Ga0316574_0215914
605 Ga0373931_0071675
606 Ga0373935_0442526
607 Ga0316582_0392489
608 Ga0316584_0091115
609 Ga0316584_0102458
610 Ga0395900_0218586
611 Ga0395905_0428371
612 Ga0395901_0540468
613 Ga0400483_009059
614 Ga0400483_041505
615 Ga0400483_135548
616 Ga0400483_171620
617 Ga0400483_263403
618 Ga0400483_266413
619 Ga0436365_1535494
620 Ga0436362_0176685
621 Ga0439463_024343
622 Ga0466963_0165672
623 Ga0466971_0112930
624 Ga0466957_0181130
625 Ga0466960_0115722
626 Ga0466960_0281632
627 Ga0466960_0430775
628 Ga0466958_0022758
629 Ga0466967_0061477
630 Ga0495592_0049937
631 Ga0495629_0217323
632 Ga0495629_0533727
633 Ga0495653_0078448
634 Ga0495582_0156509
635 Ga0495582_0245353
636 Ga0495639_0130847
637 Ga0495585_0128121
638 Ga0495608_0014059
639 Ga0495608_0214871
640 Ga0495628_0002848
641 Ga0495628_0015308
642 Ga0495630_0025399
643 Ga0495630_0082721
644 Ga0495630_0247054
645 Ga0495666_0010373
646 Ga0495652_0451534
647 Ga0495586_0238715
648 Ga0495645_0045999
649 Ga0495667_0115756
650 Ga0495634_0144499
651 Ga0495635_0329725
652 Ga0495657_0092940
653 Ga0495657_0163400
654 Ga0495657_0323717
655 Ga0495658_0016079
656 Ga0495658_0214055
657 Ga0495649_0034979
658 Ga0495604_0210307
659 Ga0495674_0210771
660 Ga0495680_0043113
661 Ga0495680_0172814
662 Ga0495675_0022174
663 Ga0495675_0160795
664 Ga0496100_0183421
665 Ga0496101_0004975
666 Ga0496102_0044443
667 Ga0496102_0170032
668 Ga0496104_0027598
669 Ga0496105_0013907
670 Ga0496106_0008854
671 Ga0496107_0023217
672 Ga0496108_0062528
673 Ga0496108_0117629
674 Ga0496109_0043865
675 Ga0496109_0378667
676 Ga0496109_0534370
677 Ga0496110_0015677
678 Ga0496110_0191565
679 Ga0496110_0259800
680 Ga0496110_0345335
681 Ga0496110_0362447
682 Ga0496110_0442052
683 Ga0496111_0002113
684 Ga0496112_0022823
685 Ga0496112_0156268
686 Ga0496113_0018426
687 Ga0496113_0461925
688 Ga0496114_0028632
689 Ga0496114_0187858
690 Ga0501047_0354734
691 Ga0501067_0536688
692 Ga0501044_0162489
693 nmdc:mga05p37_107458_c1
694 nmdc:mga05p37_17406_c1
695 nmdc:mga05p37_45617_c1
696 nmdc:mga05p37_470_c1
697 nmdc:mga05p37_689719_c1
698 nmdc:mga05p37_69818_c1
699 nmdc:mga05p37_73979_c1
700 nmdc:mga05p37_811052_c1
701 nmdc:mga09592_3521_c1
702 nmdc:mga0qj67_100021_c1
703 nmdc:mga0qj67_109412_c1
704 nmdc:mga0qj67_18384_c2
705 nmdc:mga06r32_509571_c1
706 nmdc:mga06r32_691576_c1
707 nmdc:mga06r32_70168_c1
708 nmdc:mga08y16_36255_c1
709 nmdc:mga0n895_135558_c1
710 nmdc:mga0n895_352048_c1
711 nmdc:mga0n895_75819_c1
712 nmdc:mga0rr50_133982_c1
713 nmdc:mga0rr50_9979_c1
714 nmdc:mga08x19_19496_c1
715 nmdc:mga0a205_13429_c1
716 nmdc:mga0a205_254778_c1
717 nmdc:mga0a205_42920_c1
718 Ga0495601_0191340
719 Ga0495612_0220264
720 Ga0495619_0003297
721 Ga0500616_0014897
722 Ga0501084_0073086
723 Ga0501082_0539572
724 2816423564

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

11

142

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bgo-assembly1.cif.gz_C n,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose 0.9251 10 240
4xm0-assembly1.cif.gz_C n,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the absence of cadmium 0.9211 10 239
3we7-assembly1.cif.gz_A crystal structure of diacetylchitobiose deacetylase from pyrococcus horikoshii 0.9191 12 240
1uan-assembly1.cif.gz_B crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.8797 14 241
5bmo-assembly1.cif.gz_A lnmx protein, a putative glcnac-pi de-n-acetylase from streptomyces atroolivaceus 0.8747 2 239
ID Description Score Start End Superfamily
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9141 10 240 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8797 14 241 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8694 15 237 3.40.50.10320
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8674 2 239 3.40.50.10320
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.867 10 240 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A7Y4L543-F1-model_v4 LmbE family N-acetylglucosaminyl deacetylase (PIG-L family deacetylase) 0.9937 1 241 GO:0016137
GO:0016811
AF-A0A2W6DXM6-F1-model_v4 PIG-L domain-containing protein 0.9916 9 116 GO:0016137
GO:0016811
AF-A0A4R2CSH3-F1-model_v4 LmbE family N-acetylglucosaminyl deacetylase 0.9912 1 241 GO:0016137
GO:0016811
AF-A0A849IWU0-F1-model_v4 PIG-L family deacetylase 0.9911 16 241 GO:0016137
GO:0016811
AF-A0A7J9VNF6-F1-model_v4 PIG-L family deacetylase 0.991 6 240 GO:0016137
GO:0016811

Map