F422659

General Info

Members Datasets Scaffolds Average Seq Length
362 185 720 335

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0008755|Ga0373934_0008755_1669_2778
Length 369
Sequence MQRVSADELFPSLKRTADMTAAGVARALHILALRALVPLFASAVAGFAETAQPLLSPTNIFAPVSTPSQWIFELSRLVLVVTAAIFIVVFSLLTYVVVKFRKRRTNDGREPAQVYGSTQLELAWTVIPVLIVMVLFLATARVIASIQNPVHPSNAIEVTVIGHQFWWEYRYPSLKVVTANELHIPVSDPAHPTPTFLTLLSADTDHSFWVPRLSGKTDLIPNHPNSMWMEPRETGLYLGQCAQFCGTQHAKMLLRVYVQTRDEFDRWIQEQSRPVQVGDISEGQKIFGRTACVNCHAVAGTAANGRFGPDLTHLKSRDTIASGAAPNTAENLRRWIQDPSLIKPGSKMPAMGLSDPELNALTAYLETLR

Samples

Sample ID Description Type Environment
1 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
139 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 1.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 4.14
Rhizosphere 93.92
Stem 0
Stem Tuber 0
Unclassified 12.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373934_0008755 3300035086 Bacteria 3779
2 LJNas_1000024 3300000546 Bacteria 19941
3 JGI25404J52841_10007526 3300003659 Bacteria 2305
4 Ga0065712_10077080 3300005290 Bacteria 3555
5 Ga0065707_10089183 3300005295 Bacteria 4443
6 Ga0070683_100101966 3300005329 Bacteria 2703
7 Ga0070680_100054120 3300005336 Bacteria 3276
8 Ga0068868_100054783 3300005338 Bacteria 3145
9 Ga0070661_100002827 3300005344 Bacteria 11929
10 Ga0070671_100009751 3300005355 Bacteria 7712
11 Ga0070667_100018006 3300005367 Bacteria 5855
12 Ga0070709_10382300 3300005434 Bacteria 1047
13 Ga0070714_100000693 3300005435 Bacteria 23817
14 Ga0070713_100034997 3300005436 Bacteria 4041
15 Ga0070713_100100497 3300005436 Unclassified 2504
16 Ga0070713_100331354 3300005436 Bacteria 1408
17 Ga0070710_10012544 3300005437 Bacteria 4211
18 Ga0070711_100023075 3300005439 Unclassified 4042
19 Ga0070711_100154307 3300005439 Bacteria 1734
20 Ga0070711_100343840 3300005439 Unclassified 1198
21 Ga0070705_100162489 3300005440 Bacteria 1494
22 Ga0070705_100206125 3300005440 Unclassified 1352
23 Ga0070694_100012791 3300005444 Bacteria 5228
24 Ga0070694_100108471 3300005444 Bacteria 1975
25 Ga0070694_100361949 3300005444 Bacteria 1127
26 Ga0070708_100004232 3300005445 Bacteria 11272
27 Ga0070708_100004675 3300005445 Bacteria 10789
28 Ga0070708_100060788 3300005445 Unclassified 3373
29 Ga0070708_100326551 3300005445 Bacteria 1445
30 Ga0070678_100033852 3300005456 Bacteria 3552
31 Ga0070685_10035193 3300005466 Bacteria 2824
32 Ga0070706_100002354 3300005467 Bacteria 19078
33 Ga0070706_100160094 3300005467 Unclassified 2102
34 Ga0070707_100002383 3300005468 Bacteria 17951
35 Ga0070707_100130636 3300005468 Bacteria 2442
36 Ga0070698_100021810 3300005471 Bacteria 6707
37 Ga0070698_100078126 3300005471 Bacteria 3308
38 Ga0070698_100098626 3300005471 Bacteria 2895
39 Ga0070699_100000881 3300005518 Bacteria 27935
40 Ga0070699_100157096 3300005518 Bacteria 2012
41 Ga0070684_100130841 3300005535 Bacteria 2264
42 Ga0070684_100165663 3300005535 Unclassified 2006
43 Ga0070684_100210706 3300005535 Bacteria 1771
44 Ga0070684_100341698 3300005535 Bacteria 1376
45 Ga0070697_100000668 3300005536 Bacteria 25780
46 Ga0070697_100012065 3300005536 Bacteria 6764
47 Ga0070697_100014271 3300005536 Bacteria 6243
48 Ga0070697_100076179 3300005536 Bacteria 2759
49 Ga0070697_100190217 3300005536 Bacteria 1742
50 Ga0070697_100271757 3300005536 Bacteria 1453
51 Ga0070697_100350582 3300005536 Bacteria 1275
52 Ga0070686_100092910 3300005544 Bacteria 2022
53 Ga0070695_100022487 3300005545 Bacteria 3867
54 Ga0070695_100033386 3300005545 Bacteria 3219
55 Ga0070695_100052200 3300005545 Bacteria 2627
56 Ga0070696_100047511 3300005546 Bacteria 2978
57 Ga0070665_100136962 3300005548 Bacteria 2451
58 Ga0070704_100021155 3300005549 Bacteria 4212
59 Ga0070664_100001333 3300005564 Bacteria 19678
60 Ga0068857_100190712 3300005577 Bacteria 1867
61 Ga0070702_100075471 3300005615 Bacteria 2004
62 Ga0068859_100250633 3300005617 Bacteria 1861
63 Ga0068859_100387039 3300005617 Bacteria 1494
64 Ga0068866_10034427 3300005718 Unclassified 2467
65 Ga0068863_100002174 3300005841 Bacteria 19429
66 Ga0068863_100220540 3300005841 Unclassified 1827
67 Ga0068858_100399599 3300005842 Unclassified 1320
68 Ga0068860_100294732 3300005843 Unclassified 1588
69 Ga0068862_100002435 3300005844 Bacteria 16528
70 Ga0068862_100048961 3300005844 Bacteria 3609
71 Ga0081455_10092893 3300005937 Bacteria 2440
72 Ga0081540_1000492 3300005983 Bacteria 38821
73 Ga0081540_1000935 3300005983 Bacteria 26250
74 Ga0081540_1001544 3300005983 Bacteria 19733
75 Ga0081540_1002432 3300005983 Bacteria 15158
76 Ga0081540_1006035 3300005983 Bacteria 8913
77 Ga0070717_10018793 3300006028 Bacteria 5405
78 Ga0070717_10097817 3300006028 Bacteria 2487
79 Ga0070715_10117479 3300006163 Bacteria 1263
80 Ga0070716_100001090 3300006173 Bacteria 11907
81 Ga0070716_100016836 3300006173 Unclassified 3781
82 Ga0070716_100027085 3300006173 Bacteria 3075
83 Ga0070712_100017162 3300006175 Unclassified 4682
84 Ga0070712_100068786 3300006175 Bacteria 2524
85 Ga0097621_100061434 3300006237 Bacteria 3082
86 Ga0097621_100327399 3300006237 Unclassified 1358
87 Ga0075428_100041658 3300006844 Bacteria 5048
88 Ga0075428_100060737 3300006844 Bacteria 4139
89 Ga0075428_100188557 3300006844 Bacteria 2231
90 Ga0075428_100348499 3300006844 Bacteria 1589
91 Ga0075433_10038387 3300006852 Bacteria 4136
92 Ga0075433_10051372 3300006852 Bacteria 3589
93 Ga0075433_10098630 3300006852 Bacteria 2586
94 Ga0075433_10127533 3300006852 Bacteria 2260
95 Ga0075434_100056014 3300006871 Bacteria 3918
96 Ga0075434_100167249 3300006871 Bacteria 2219
97 Ga0075434_100179170 3300006871 Bacteria 2139
98 Ga0075434_100195657 3300006871 Unclassified 2042
99 Ga0075434_100517871 3300006871 Bacteria 1213
100 Ga0068865_100048430 3300006881 Bacteria 2924
101 Ga0075436_100004180 3300006914 Bacteria 9906
102 Ga0075436_100189890 3300006914 Unclassified 1453
103 Ga0097620_100250645 3300006931 Bacteria 1861
104 Ga0097620_100387015 3300006931 Bacteria 1494
105 Ga0075435_100144329 3300007076 Bacteria 1999
106 Ga0075435_100190548 3300007076 Bacteria 1736
107 Ga0075435_100413605 3300007076 Unclassified 1161
108 Ga0099794_10000036 3300007265 Bacteria 55505
109 Ga0099794_10001467 3300007265 Bacteria 8256
110 Ga0099794_10001785 3300007265 Bacteria 7674
111 Ga0099794_10004417 3300007265 Bacteria 5522
112 Ga0099794_10031301 3300007265 Bacteria 2490
113 Ga0099794_10055557 3300007265 Bacteria 1914
114 Ga0111539_10069765 3300009094 Bacteria 4149
115 Ga0111539_10076203 3300009094 Bacteria 3949
116 Ga0111539_10107037 3300009094 Bacteria 3281
117 Ga0111539_10162679 3300009094 Bacteria 2610
118 Ga0111539_10170787 3300009094 Bacteria 2540
119 Ga0105245_10119894 3300009098 Bacteria 2456
120 Ga0105245_10296773 3300009098 Bacteria 1584
121 Ga0105247_10163632 3300009101 Unclassified 1475
122 Ga0114129_10102432 3300009147 Bacteria 3959
123 Ga0114129_10108715 3300009147 Bacteria 3828
124 Ga0114129_10163695 3300009147 Bacteria 3037
125 Ga0114129_10247268 3300009147 Bacteria 2396
126 Ga0114129_10403600 3300009147 Bacteria 1801
127 Ga0114129_10452144 3300009147 Bacteria 1684
128 Ga0105241_10055365 3300009174 Bacteria 3039
129 Ga0105242_10344568 3300009176 Bacteria 1374
130 Ga0105242_10485158 3300009176 Bacteria 1172
131 Ga0105248_10002269 3300009177 Bacteria 21276
132 Ga0105248_10023699 3300009177 Bacteria 6821
133 Ga0105248_10028936 3300009177 Bacteria 6177
134 Ga0105237_10228234 3300009545 Bacteria 1862
135 Ga0105237_10296742 3300009545 Bacteria 1619
136 Ga0105238_10209130 3300009551 Bacteria 1927
137 Ga0105249_10091122 3300009553 Bacteria 2852
138 Ga0099796_10019141 3300010159 Unclassified 2070
139 Ga0105239_10008552 3300010375 Bacteria 11619
140 Ga0105239_10104167 3300010375 Bacteria 3141
141 Ga0157369_10178924 3300013105 Unclassified 2232
142 Ga0157369_10207735 3300013105 Bacteria 2053
143 Ga0157374_10070368 3300013296 Bacteria 3297
144 Ga0157378_10002078 3300013297 Bacteria 17913
145 Ga0163162_10055706 3300013306 Bacteria 3982
146 Ga0163162_10129574 3300013306 Bacteria 2631
147 Ga0163162_10229906 3300013306 Unclassified 1985
148 Ga0163162_10348352 3300013306 Unclassified 1614
149 Ga0157372_10320193 3300013307 Unclassified 1806
150 Ga0157375_10050969 3300013308 Bacteria 4062
151 Ga0157375_10229945 3300013308 Bacteria 2013
152 Ga0157375_10462880 3300013308 Bacteria 1433
153 Ga0163163_10024180 3300014325 Bacteria 5780
154 Ga0163163_10037448 3300014325 Bacteria 4719
155 Ga0163163_10177869 3300014325 Bacteria 2174
156 Ga0157379_10019695 3300014968 Bacteria 5961
157 Ga0157379_10170754 3300014968 Bacteria 1963
158 Ga0157376_10076354 3300014969 Bacteria 2862
159 Ga0157376_10116186 3300014969 Unclassified 2363
160 Ga0157376_10141439 3300014969 Bacteria 2159
161 Ga0157376_10214284 3300014969 Unclassified 1780
162 Ga0163161_10045953 3300017792 Bacteria 3150
163 Ga0213872_10014253 3300021361 Bacteria 3712
164 Ga0213875_10003724 3300021388 Bacteria 8584
165 Ga0228598_1000110 3300024227 Bacteria 13697
166 Ga0207692_10132894 3300025898 Bacteria 1407
167 Ga0207642_10056994 3300025899 Unclassified 1795
168 Ga0207680_10211729 3300025903 Bacteria 1325
169 Ga0207647_10033128 3300025904 Unclassified 3312
170 Ga0207647_10064900 3300025904 Bacteria 2217
171 Ga0207684_10002334 3300025910 Bacteria 19227
172 Ga0207684_10005155 3300025910 Bacteria 12165
173 Ga0207684_10087595 3300025910 Bacteria 2653
174 Ga0207707_10017514 3300025912 Bacteria 6246
175 Ga0207671_10179995 3300025914 Unclassified 1645
176 Ga0207693_10025829 3300025915 Bacteria 4653
177 Ga0207693_10032652 3300025915 Bacteria 4107
178 Ga0207693_10051833 3300025915 Unclassified 3218
179 Ga0207693_10108291 3300025915 Bacteria 2180
180 Ga0207663_10125300 3300025916 Bacteria 1766
181 Ga0207663_10283950 3300025916 Bacteria 1230
182 Ga0207660_10020800 3300025917 Bacteria 4409
183 Ga0207662_10031415 3300025918 Bacteria 3085
184 Ga0207649_10001957 3300025920 Bacteria 11748
185 Ga0207646_10001993 3300025922 Bacteria 24540
186 Ga0207646_10249358 3300025922 Bacteria 1604
187 Ga0207681_10003147 3300025923 Bacteria 10371
188 Ga0207694_10285618 3300025924 Unclassified 1356
189 Ga0207700_10003655 3300025928 Bacteria 8968
190 Ga0207700_10306330 3300025928 Bacteria 1373
191 Ga0207644_10020390 3300025931 Bacteria 4507
192 Ga0207665_10009691 3300025939 Bacteria 6324
193 Ga0207665_10034723 3300025939 Bacteria 3346
194 Ga0207665_10054302 3300025939 Bacteria 2701
195 Ga0207665_10179793 3300025939 Unclassified 1531
196 Ga0207691_10049498 3300025940 Bacteria 3850
197 Ga0207711_10012026 3300025941 Bacteria 7193
198 Ga0207711_10014092 3300025941 Bacteria 6643
199 Ga0207711_10046970 3300025941 Bacteria 3690
200 Ga0207661_10046444 3300025944 Bacteria 3444
201 Ga0207661_10068202 3300025944 Bacteria 2896
202 Ga0207679_10000793 3300025945 Bacteria 20657
203 Ga0207658_10013231 3300025986 Bacteria 5634
204 Ga0207703_10330832 3300026035 Bacteria 1397
205 Ga0207641_10001341 3300026088 Bacteria 24380
206 Ga0207641_10121009 3300026088 Bacteria 2336
207 Ga0207641_10229198 3300026088 Bacteria 1726
208 Ga0207648_10187930 3300026089 Bacteria 1830
209 Ga0207674_10003911 3300026116 Bacteria 18125
210 Ga0207675_100257738 3300026118 Bacteria 1689
211 Ga0207675_100281243 3300026118 Bacteria 1617
212 Ga0209588_1000020 3300027671 Bacteria 93596
213 Ga0209588_1000063 3300027671 Bacteria 37897
214 Ga0209588_1007363 3300027671 Bacteria 3232
215 Ga0209588_1022405 3300027671 Bacteria 1987
216 Ga0209588_1061910 3300027671 Unclassified 1210
217 Ga0207428_10046491 3300027907 Bacteria 3491
218 Ga0207428_10089812 3300027907 Bacteria 2387
219 Ga0265356_1005803 3300028017 Bacteria 1461
220 Ga0268266_10110542 3300028379 Bacteria 2435
221 Ga0268266_10167045 3300028379 Bacteria 1994
222 Ga0268265_10030923 3300028380 Bacteria 3862
223 Ga0268265_10069078 3300028380 Bacteria 2742
224 Ga0268265_10170644 3300028380 Bacteria 1859
225 Ga0268264_10167681 3300028381 Unclassified 1983
226 Ga0268264_10248984 3300028381 Bacteria 1650
227 Ga0268264_10303172 3300028381 Unclassified 1505
228 Ga0265338_10001894 3300028800 Bacteria 32749
229 Ga0265338_10015667 3300028800 Bacteria 8307
230 Ga0265762_1000755 3300030760 Bacteria 5776
231 Ga0265762_1007996 3300030760 Bacteria 1883
232 Ga0265760_10002138 3300031090 Bacteria 5783
233 Ga0265760_10005185 3300031090 Bacteria 3731
234 Ga0265760_10024435 3300031090 Unclassified 1760
235 Ga0265325_10017024 3300031241 Bacteria 4047
236 Ga0265325_10021302 3300031241 Bacteria 3562
237 Ga0265327_10071329 3300031251 Bacteria 1738
238 Ga0307508_10311208 3300031616 Bacteria 1167
239 Ga0373934_0000610 3300035086 Bacteria 12603
240 Ga0373954_0000189 3300035118 Bacteria 22316
241 Ga0373954_0046291 3300035118 Bacteria 2033
242 Ga0373954_0185243 3300035118 Bacteria 1021
243 Ga0373956_0002639 3300035119 Bacteria 7266
244 Ga0373957_0001439 3300035120 Bacteria 6443
245 Ga0373943_0110726 3300035170 Bacteria 1448
246 Ga0373955_0000259 3300035172 Bacteria 22026
247 Ga0373955_0032475 3300035172 Bacteria 2740
248 Ga0373955_0176248 3300035172 Bacteria 1267
249 Ga0373935_0070635 3300035692 Bacteria 2251
250 Ga0373927_0027609 3300035695 Bacteria 3706
251 Ga0373933_0001363 3300035724 Bacteria 14392
252 Ga0373933_0195551 3300035724 Bacteria 1293
253 Ga0373947_0000657 3300035725 Bacteria 20479
254 Ga0373937_0000123 3300036401 Bacteria 74156
255 Ga0373937_0016676 3300036401 Bacteria 6527
256 Ga0373925_0000345 3300037068 Bacteria 48292
257 Ga0395905_0279081 3300037471 Unclassified 1557
258 Ga0395905_0335616 3300037471 Bacteria 1402
259 Ga0436364_0552901 3300037853 Bacteria 34158
260 Ga0436360_0058848 3300039438 Bacteria 3238
261 Ga0436360_0915102 3300039438 Bacteria 8525
262 Ga0436361_0088895 3300039447 Bacteria 17361
263 Ga0436361_0737283 3300039447 Bacteria 1786
264 Ga0436363_0505588 3300039450 Bacteria 1815
265 Ga0436362_1102556 3300039453 Unclassified 979
266 Ga0439458_0007787 3300042157 Bacteria 2386
267 Ga0451576_0015410 3300045051 Bacteria 8468
268 Ga0495651_0021687 3300046462 Bacteria 4993
269 Ga0495651_0056452 3300046462 Bacteria 3016
270 Ga0495653_0104030 3300046463 Bacteria 2052
271 Ga0495580_0010398 3300046472 Bacteria 7252
272 Ga0495580_0063367 3300046472 Bacteria 2593
273 Ga0495594_0055217 3300046499 Bacteria 2190
274 Ga0495608_0029683 3300046511 Bacteria 3707
275 Ga0495608_0062730 3300046511 Bacteria 2441
276 Ga0495630_0142918 3300046517 Bacteria 1819
277 Ga0495587_0000303 3300046536 Bacteria 35065
278 Ga0495587_0021153 3300046536 Bacteria 4012
279 Ga0495587_0053219 3300046536 Bacteria 2387
280 Ga0495645_0001288 3300046543 Bacteria 17094
281 Ga0495667_0013274 3300046559 Bacteria 5576
282 Ga0495667_0024125 3300046559 Bacteria 4097
283 Ga0495656_0087435 3300046615 Bacteria 1419
284 Ga0495657_0186778 3300046675 Bacteria 1268
285 Ga0495599_0025989 3300046678 Bacteria 3668
286 Ga0495599_0034339 3300046678 Bacteria 3186
287 Ga0495623_0026980 3300046679 Bacteria 3695
288 Ga0495669_0150341 3300046684 Bacteria 1102
289 Ga0495613_0110422 3300046689 Bacteria 1982
290 Ga0495624_0037688 3300046690 Bacteria 3109
291 Ga0495600_0082715 3300046809 Bacteria 2095
292 Ga0495604_0000176 3300047317 Bacteria 56911
293 Ga0495674_0000563 3300047319 Bacteria 34541
294 Ga0495674_0001054 3300047319 Bacteria 26513
295 Ga0495674_0025027 3300047319 Bacteria 5478
296 Ga0495675_0004094 3300047444 Bacteria 8835
297 Ga0495675_0010985 3300047444 Bacteria 5676
298 Ga0495684_0000750 3300047471 Bacteria 26139
299 Ga0495684_0002278 3300047471 Bacteria 15368
300 Ga0495684_0017766 3300047471 Bacteria 5478
301 Ga0495684_0043127 3300047471 Bacteria 3453
302 Ga0495686_0114639 3300047472 Bacteria 1613
303 Ga0495602_0000362 3300048088 Bacteria 42468
304 Ga0495602_0089865 3300048088 Bacteria 2553
305 Ga0495602_0094051 3300048088 Bacteria 2478
306 Ga0495614_0104462 3300048089 Unclassified 1241
307 Ga0496101_0101162 3300048904 Unclassified 2157
308 Ga0496102_0007099 3300048905 Bacteria 9563
309 Ga0496102_0016122 3300048905 Bacteria 6525
310 Ga0496103_0169241 3300048906 Unclassified 1402
311 Ga0496104_0216448 3300048907 Bacteria 1827
312 Ga0496106_0044625 3300048909 Bacteria 3328
313 Ga0496108_0378927 3300048911 Bacteria 1235
314 Ga0496110_0395436 3300048913 Bacteria 1260
315 Ga0496112_0213978 3300048915 Bacteria 1884
316 Ga0496112_0299464 3300048915 Unclassified 1554
317 Ga0496113_0037679 3300048916 Bacteria 3551
318 Ga0496114_0306189 3300048917 Unclassified 1403
319 Ga0496115_0017218 3300048918 Bacteria 5518
320 Ga0496115_0055243 3300048918 Unclassified 3190
321 Ga0496115_0105658 3300048918 Bacteria 2311
322 Ga0496126_0000014 3300048929 Bacteria 686881
323 Ga0496126_0005798 3300048929 Bacteria 13965
324 Ga0501080_0006701 3300049742 Bacteria 10371
325 nmdc:mga05p37_13178_c1 3300050507 Bacteria 9897
326 nmdc:mga05p37_171227_c1 3300050507 Bacteria 2648
327 nmdc:mga05p37_216104_c1 3300050507 Bacteria 2316
328 nmdc:mga05p37_329451_c1 3300050507 Bacteria 1804
329 nmdc:mga05p37_35735_c1 3300050507 Bacteria 6094
330 nmdc:mga05p37_4285_c1 3300050507 Bacteria 16662
331 nmdc:mga05p37_50348_c1 3300050507 Bacteria 5123
332 nmdc:mga05p37_523930_c1 3300050507 Bacteria 1355
333 nmdc:mga05p37_69984_c1 3300050507 Bacteria 4316
334 nmdc:mga05p37_762963_c1 3300050507 Unclassified 1064
335 nmdc:mga06r32_5415_c1 3300050510 Bacteria 11485
336 nmdc:mga08y16_102679_c1 3300050511 Bacteria 2977
337 nmdc:mga08y16_133318_c1 3300050511 Bacteria 2582
338 nmdc:mga08y16_204362_c1 3300050511 Bacteria 2047
339 nmdc:mga08y16_285721_c1 3300050511 Bacteria 1701
340 nmdc:mga08y16_429684_c1 3300050511 Unclassified 1349
341 nmdc:mga0n895_163168_c1 3300050512 Bacteria 2260
342 nmdc:mga0n895_446605_c1 3300050512 Bacteria 1306
343 nmdc:mga0n895_57749_c1 3300050512 Bacteria 3826
344 nmdc:mga0n895_58393_c1 3300050512 Bacteria 3804
345 nmdc:mga0rr50_179175_c1 3300050513 Bacteria 1731
346 nmdc:mga0rr50_228582_c1 3300050513 Bacteria 1538
347 nmdc:mga0rr50_361595_c1 3300050513 Bacteria 1222
348 nmdc:mga08x19_62996_c1 3300050514 Bacteria 2405
349 nmdc:mga08x19_8031_c1 3300050514 Bacteria 6272
350 nmdc:mga0a205_12643_c1 3300050515 Bacteria 7817
351 nmdc:mga0a205_131107_c1 3300050515 Bacteria 2407
352 nmdc:mga0a205_140624_c1 3300050515 Unclassified 2314
353 nmdc:mga0a205_150237_c1 3300050515 Bacteria 2229
354 nmdc:mga0a205_189759_c1 3300050515 Bacteria 1948
355 nmdc:mga0a205_273747_c1 3300050515 Bacteria 1565
356 nmdc:mga0a205_33834_c1 3300050515 Bacteria 4901
357 nmdc:mga0a205_43237_c1 3300050515 Bacteria 4345
358 nmdc:mga0a205_524404_c1 3300050515 Bacteria 1041
359 nmdc:mga0a205_73274_c1 3300050515 Bacteria 3309
360 Ga0500555_000334 3300053103 Bacteria 20195
361 Ga0373934_0008755
362 LJNas_1000024
363 JGI25404J52841_10007526
364 Ga0065712_10077080
365 Ga0065707_10089183
366 Ga0070683_100101966
367 Ga0070680_100054120
368 Ga0068868_100054783
369 Ga0070661_100002827
370 Ga0070671_100009751
371 Ga0070667_100018006
372 Ga0070709_10382300
373 Ga0070714_100000693
374 Ga0070713_100034997
375 Ga0070713_100100497
376 Ga0070713_100331354
377 Ga0070710_10012544
378 Ga0070711_100023075
379 Ga0070711_100154307
380 Ga0070711_100343840
381 Ga0070705_100162489
382 Ga0070705_100206125
383 Ga0070694_100012791
384 Ga0070694_100108471
385 Ga0070694_100361949
386 Ga0070708_100004232
387 Ga0070708_100004675
388 Ga0070708_100060788
389 Ga0070708_100326551
390 Ga0070678_100033852
391 Ga0070685_10035193
392 Ga0070706_100002354
393 Ga0070706_100160094
394 Ga0070707_100002383
395 Ga0070707_100130636
396 Ga0070698_100021810
397 Ga0070698_100078126
398 Ga0070698_100098626
399 Ga0070699_100000881
400 Ga0070699_100157096
401 Ga0070684_100130841
402 Ga0070684_100165663
403 Ga0070684_100210706
404 Ga0070684_100341698
405 Ga0070697_100000668
406 Ga0070697_100012065
407 Ga0070697_100014271
408 Ga0070697_100076179
409 Ga0070697_100190217
410 Ga0070697_100271757
411 Ga0070697_100350582
412 Ga0070686_100092910
413 Ga0070695_100022487
414 Ga0070695_100033386
415 Ga0070695_100052200
416 Ga0070696_100047511
417 Ga0070665_100136962
418 Ga0070704_100021155
419 Ga0070664_100001333
420 Ga0068857_100190712
421 Ga0070702_100075471
422 Ga0068859_100250633
423 Ga0068859_100387039
424 Ga0068866_10034427
425 Ga0068863_100002174
426 Ga0068863_100220540
427 Ga0068858_100399599
428 Ga0068860_100294732
429 Ga0068862_100002435
430 Ga0068862_100048961
431 Ga0081455_10092893
432 Ga0081540_1000492
433 Ga0081540_1000935
434 Ga0081540_1001544
435 Ga0081540_1002432
436 Ga0081540_1006035
437 Ga0070717_10018793
438 Ga0070717_10097817
439 Ga0070715_10117479
440 Ga0070716_100001090
441 Ga0070716_100016836
442 Ga0070716_100027085
443 Ga0070712_100017162
444 Ga0070712_100068786
445 Ga0097621_100061434
446 Ga0097621_100327399
447 Ga0075428_100041658
448 Ga0075428_100060737
449 Ga0075428_100188557
450 Ga0075428_100348499
451 Ga0075433_10038387
452 Ga0075433_10051372
453 Ga0075433_10098630
454 Ga0075433_10127533
455 Ga0075434_100056014
456 Ga0075434_100167249
457 Ga0075434_100179170
458 Ga0075434_100195657
459 Ga0075434_100517871
460 Ga0068865_100048430
461 Ga0075436_100004180
462 Ga0075436_100189890
463 Ga0097620_100250645
464 Ga0097620_100387015
465 Ga0075435_100144329
466 Ga0075435_100190548
467 Ga0075435_100413605
468 Ga0099794_10000036
469 Ga0099794_10001467
470 Ga0099794_10001785
471 Ga0099794_10004417
472 Ga0099794_10031301
473 Ga0099794_10055557
474 Ga0111539_10069765
475 Ga0111539_10076203
476 Ga0111539_10107037
477 Ga0111539_10162679
478 Ga0111539_10170787
479 Ga0105245_10119894
480 Ga0105245_10296773
481 Ga0105247_10163632
482 Ga0114129_10102432
483 Ga0114129_10108715
484 Ga0114129_10163695
485 Ga0114129_10247268
486 Ga0114129_10403600
487 Ga0114129_10452144
488 Ga0105241_10055365
489 Ga0105242_10344568
490 Ga0105242_10485158
491 Ga0105248_10002269
492 Ga0105248_10023699
493 Ga0105248_10028936
494 Ga0105237_10228234
495 Ga0105237_10296742
496 Ga0105238_10209130
497 Ga0105249_10091122
498 Ga0099796_10019141
499 Ga0105239_10008552
500 Ga0105239_10104167
501 Ga0157369_10178924
502 Ga0157369_10207735
503 Ga0157374_10070368
504 Ga0157378_10002078
505 Ga0163162_10055706
506 Ga0163162_10129574
507 Ga0163162_10229906
508 Ga0163162_10348352
509 Ga0157372_10320193
510 Ga0157375_10050969
511 Ga0157375_10229945
512 Ga0157375_10462880
513 Ga0163163_10024180
514 Ga0163163_10037448
515 Ga0163163_10177869
516 Ga0157379_10019695
517 Ga0157379_10170754
518 Ga0157376_10076354
519 Ga0157376_10116186
520 Ga0157376_10141439
521 Ga0157376_10214284
522 Ga0163161_10045953
523 Ga0213872_10014253
524 Ga0213875_10003724
525 Ga0228598_1000110
526 Ga0207692_10132894
527 Ga0207642_10056994
528 Ga0207680_10211729
529 Ga0207647_10033128
530 Ga0207647_10064900
531 Ga0207684_10002334
532 Ga0207684_10005155
533 Ga0207684_10087595
534 Ga0207707_10017514
535 Ga0207671_10179995
536 Ga0207693_10025829
537 Ga0207693_10032652
538 Ga0207693_10051833
539 Ga0207693_10108291
540 Ga0207663_10125300
541 Ga0207663_10283950
542 Ga0207660_10020800
543 Ga0207662_10031415
544 Ga0207649_10001957
545 Ga0207646_10001993
546 Ga0207646_10249358
547 Ga0207681_10003147
548 Ga0207694_10285618
549 Ga0207700_10003655
550 Ga0207700_10306330
551 Ga0207644_10020390
552 Ga0207665_10009691
553 Ga0207665_10034723
554 Ga0207665_10054302
555 Ga0207665_10179793
556 Ga0207691_10049498
557 Ga0207711_10012026
558 Ga0207711_10014092
559 Ga0207711_10046970
560 Ga0207661_10046444
561 Ga0207661_10068202
562 Ga0207679_10000793
563 Ga0207658_10013231
564 Ga0207703_10330832
565 Ga0207641_10001341
566 Ga0207641_10121009
567 Ga0207641_10229198
568 Ga0207648_10187930
569 Ga0207674_10003911
570 Ga0207675_100257738
571 Ga0207675_100281243
572 Ga0209588_1000020
573 Ga0209588_1000063
574 Ga0209588_1007363
575 Ga0209588_1022405
576 Ga0209588_1061910
577 Ga0207428_10046491
578 Ga0207428_10089812
579 Ga0265356_1005803
580 Ga0268266_10110542
581 Ga0268266_10167045
582 Ga0268265_10030923
583 Ga0268265_10069078
584 Ga0268265_10170644
585 Ga0268264_10167681
586 Ga0268264_10248984
587 Ga0268264_10303172
588 Ga0265338_10001894
589 Ga0265338_10015667
590 Ga0265762_1000755
591 Ga0265762_1007996
592 Ga0265760_10002138
593 Ga0265760_10005185
594 Ga0265760_10024435
595 Ga0265325_10017024
596 Ga0265325_10021302
597 Ga0265327_10071329
598 Ga0307508_10311208
599 Ga0373934_0000610
600 Ga0373954_0000189
601 Ga0373954_0046291
602 Ga0373954_0185243
603 Ga0373956_0002639
604 Ga0373957_0001439
605 Ga0373943_0110726
606 Ga0373955_0000259
607 Ga0373955_0032475
608 Ga0373955_0176248
609 Ga0373935_0070635
610 Ga0373927_0027609
611 Ga0373933_0001363
612 Ga0373933_0195551
613 Ga0373947_0000657
614 Ga0373937_0000123
615 Ga0373937_0016676
616 Ga0373925_0000345
617 Ga0395905_0279081
618 Ga0395905_0335616
619 Ga0436364_0552901
620 Ga0436360_0058848
621 Ga0436360_0915102
622 Ga0436361_0088895
623 Ga0436361_0737283
624 Ga0436363_0505588
625 Ga0436362_1102556
626 Ga0439458_0007787
627 Ga0451576_0015410
628 Ga0495651_0021687
629 Ga0495651_0056452
630 Ga0495653_0104030
631 Ga0495580_0010398
632 Ga0495580_0063367
633 Ga0495594_0055217
634 Ga0495608_0029683
635 Ga0495608_0062730
636 Ga0495630_0142918
637 Ga0495587_0000303
638 Ga0495587_0021153
639 Ga0495587_0053219
640 Ga0495645_0001288
641 Ga0495667_0013274
642 Ga0495667_0024125
643 Ga0495656_0087435
644 Ga0495657_0186778
645 Ga0495599_0025989
646 Ga0495599_0034339
647 Ga0495623_0026980
648 Ga0495669_0150341
649 Ga0495613_0110422
650 Ga0495624_0037688
651 Ga0495600_0082715
652 Ga0495604_0000176
653 Ga0495674_0000563
654 Ga0495674_0001054
655 Ga0495674_0025027
656 Ga0495675_0004094
657 Ga0495675_0010985
658 Ga0495684_0000750
659 Ga0495684_0002278
660 Ga0495684_0017766
661 Ga0495684_0043127
662 Ga0495686_0114639
663 Ga0495602_0000362
664 Ga0495602_0089865
665 Ga0495602_0094051
666 Ga0495614_0104462
667 Ga0496101_0101162
668 Ga0496102_0007099
669 Ga0496102_0016122
670 Ga0496103_0169241
671 Ga0496104_0216448
672 Ga0496106_0044625
673 Ga0496108_0378927
674 Ga0496110_0395436
675 Ga0496112_0213978
676 Ga0496112_0299464
677 Ga0496113_0037679
678 Ga0496114_0306189
679 Ga0496115_0017218
680 Ga0496115_0055243
681 Ga0496115_0105658
682 Ga0496126_0000014
683 Ga0496126_0005798
684 Ga0501080_0006701
685 nmdc:mga05p37_13178_c1
686 nmdc:mga05p37_171227_c1
687 nmdc:mga05p37_216104_c1
688 nmdc:mga05p37_329451_c1
689 nmdc:mga05p37_35735_c1
690 nmdc:mga05p37_4285_c1
691 nmdc:mga05p37_50348_c1
692 nmdc:mga05p37_523930_c1
693 nmdc:mga05p37_69984_c1
694 nmdc:mga05p37_762963_c1
695 nmdc:mga06r32_5415_c1
696 nmdc:mga08y16_102679_c1
697 nmdc:mga08y16_133318_c1
698 nmdc:mga08y16_204362_c1
699 nmdc:mga08y16_285721_c1
700 nmdc:mga08y16_429684_c1
701 nmdc:mga0n895_163168_c1
702 nmdc:mga0n895_446605_c1
703 nmdc:mga0n895_57749_c1
704 nmdc:mga0n895_58393_c1
705 nmdc:mga0rr50_179175_c1
706 nmdc:mga0rr50_228582_c1
707 nmdc:mga0rr50_361595_c1
708 nmdc:mga08x19_62996_c1
709 nmdc:mga08x19_8031_c1
710 nmdc:mga0a205_12643_c1
711 nmdc:mga0a205_131107_c1
712 nmdc:mga0a205_140624_c1
713 nmdc:mga0a205_150237_c1
714 nmdc:mga0a205_189759_c1
715 nmdc:mga0a205_273747_c1
716 nmdc:mga0a205_33834_c1
717 nmdc:mga0a205_43237_c1
718 nmdc:mga0a205_524404_c1
719 nmdc:mga0a205_73274_c1
720 Ga0500555_000334

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

280

369

0.92

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

189

259

0.91

PF02790

COX2_TM

Cytochrome C oxidase subunit II, transmembrane domain

57

142

0.78

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

278

365

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bqs-assembly1.cif.gz_Db cryo-em structure of the i-ii-iii2-iv2 respiratory supercomplex from tetrahymena thermophila 0.8933 159 248
7w5z-assembly1.cif.gz_c2 cryo-em structure of tetrahymena thermophila mitochondrial complex iv, composite dimer model 0.892 159 250
1cyx-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa) 0.8619 133 257
1cyw-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii) (cyoa) 0.8373 133 261
4txv-assembly2.cif.gz_D crystal structure of the mixed disulfide intermediate between thioredoxin-like tlpas(c110s) and subunit ii of cytochrome c oxidase coxbpd (c233s) 0.8358 127 248
ID Description Score Start End Superfamily
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9215 159 245 2.60.40.420
af_Q8I6V2_60_165_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9167 159 244 2.60.40.420
5wehH02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.868 129 248 2.60.40.420
af_A0A2P2CLF0_113_253_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8669 131 249 2.60.40.420
af_Q2FZJ9_108_266_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8438 125 263 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A1F8JDM8-F1-model_v4 deleted 0.9297 134 248
AF-A0A7T1X593-F1-model_v4 cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome c oxidase polypeptide II) 0.9205 159 252 GO:0004129
GO:0005507
GO:0005739
GO:0016020
GO:0042773
AF-A0A536VDZ6-F1-model_v4 Ubiquinol oxidase subunit II 0.9193 141 248 GO:0004129
GO:0005507
GO:0005886
GO:0009486
GO:0042773
AF-A0A812JAQ8-F1-model_v4 Cytochrome c oxidase polypeptide II 0.9171 159 249 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A9XH95-F1-model_v4 cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome c oxidase polypeptide II) 0.915 159 245 GO:0004129
GO:0005507
GO:0031966
GO:0042773

Map