F422654

General Info

Members Datasets Scaffolds Average Seq Length
362 212 724 166

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10302326|Ga0307405_103023262
Length 179
Sequence MAASLVANSDTFSVSTPSDCEIELSRLFDAPRDLVFEAMTRPEHIREWWGRLGDGYSVPVCEVDLRVGGKWRFVNRTPKGEEAEFYGVYREIAPPDRLVFTEIFAPFPDAESVVTATYSDEGGRTRLRARCLYPSKEVRDMVLGTGMEGGAAKSYDRLEEVARGLAAQRSGRSQDHPAR

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
167 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 3.59
Rhizosphere 95.03
Stem 0
Stem Tuber 0
Unclassified 15.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10302326 3300031731 Bacteria 1214
2 MRS1b_contig_1858700 2162886011 Bacteria 2659
3 MBSR1b_contig_6041409 2162886012 Unclassified 1176
4 Ga0065704_10097370 3300005289 Unclassified 2398
5 Ga0065704_10444118 3300005289 Bacteria 711
6 Ga0065712_10000410 3300005290 Bacteria 12722
7 Ga0065712_10100538 3300005290 Bacteria 2058
8 Ga0065712_10148785 3300005290 Bacteria 1330
9 Ga0065715_10057341 3300005293 Bacteria 793
10 Ga0065715_10109348 3300005293 Bacteria 2672
11 Ga0065715_10305705 3300005293 Bacteria 1031
12 Ga0065715_10482482 3300005293 Bacteria 796
13 Ga0065715_10781100 3300005293 Unclassified 618
14 Ga0065707_10387657 3300005295 Bacteria 869
15 Ga0065707_10408495 3300005295 Bacteria 844
16 Ga0070676_10433845 3300005328 Bacteria 920
17 Ga0070683_100000260 3300005329 Bacteria 36410
18 Ga0070683_100292293 3300005329 Bacteria 1550
19 Ga0070690_100736544 3300005330 Bacteria 760
20 Ga0070670_100017730 3300005331 Bacteria 6108
21 Ga0070670_100122544 3300005331 Bacteria 2243
22 Ga0070670_100523786 3300005331 Unclassified 1056
23 Ga0068869_100075600 3300005334 Bacteria 2503
24 Ga0068869_100143611 3300005334 Bacteria 1845
25 Ga0070682_100347455 3300005337 Bacteria 1105
26 Ga0070682_100947078 3300005337 Unclassified 711
27 Ga0068868_100700050 3300005338 Bacteria 906
28 Ga0070660_100021100 3300005339 Bacteria 4798
29 Ga0070660_100291646 3300005339 Bacteria 1336
30 Ga0070660_100422379 3300005339 Bacteria 1104
31 Ga0070689_100009981 3300005340 Bacteria 6755
32 Ga0070687_100002884 3300005343 Bacteria 6575
33 Ga0070661_100001808 3300005344 Bacteria 14836
34 Ga0070661_100012307 3300005344 Bacteria 5983
35 Ga0070661_100013787 3300005344 Bacteria 5679
36 Ga0070661_100013817 3300005344 Bacteria 5674
37 Ga0070692_10025516 3300005345 Bacteria 2913
38 Ga0070668_100004750 3300005347 Bacteria 10079
39 Ga0070668_100296010 3300005347 Bacteria 1356
40 Ga0070668_100821145 3300005347 Unclassified 827
41 Ga0070669_100021247 3300005353 Bacteria 4638
42 Ga0070675_100025600 3300005354 Bacteria 4730
43 Ga0070675_100149997 3300005354 Bacteria 1998
44 Ga0070675_100416369 3300005354 Bacteria 1201
45 Ga0070675_100754078 3300005354 Unclassified 888
46 Ga0070671_100016315 3300005355 Bacteria 6007
47 Ga0070674_100116143 3300005356 Bacteria 1974
48 Ga0070673_100133423 3300005364 Bacteria 2087
49 Ga0070673_100740063 3300005364 Bacteria 905
50 Ga0070673_101154057 3300005364 Unclassified 725
51 Ga0070688_100263422 3300005365 Unclassified 1232
52 Ga0070659_100015745 3300005366 Bacteria 5666
53 Ga0070659_100057214 3300005366 Bacteria 3074
54 Ga0070667_100462920 3300005367 Bacteria 1159
55 Ga0070713_100956047 3300005436 Bacteria 825
56 Ga0070701_10299778 3300005438 Bacteria 988
57 Ga0070701_10363994 3300005438 Bacteria 907
58 Ga0070711_100274779 3300005439 Bacteria 1331
59 Ga0070705_100142361 3300005440 Bacteria 1580
60 Ga0070700_100010666 3300005441 Bacteria 5075
61 Ga0070700_100635760 3300005441 Bacteria 841
62 Ga0070694_100061124 3300005444 Bacteria 2571
63 Ga0070708_100296001 3300005445 Unclassified 1524
64 Ga0070708_101038952 3300005445 Bacteria 768
65 Ga0070663_100021408 3300005455 Bacteria 4301
66 Ga0070663_100055975 3300005455 Bacteria 2825
67 Ga0070663_100686588 3300005455 Bacteria 869
68 Ga0070678_100079711 3300005456 Bacteria 2478
69 Ga0070678_100137720 3300005456 Bacteria 1949
70 Ga0070678_101065105 3300005456 Bacteria 745
71 Ga0070662_100012798 3300005457 Bacteria 5570
72 Ga0070662_100036786 3300005457 Bacteria 3466
73 Ga0070681_10001803 3300005458 Bacteria 19262
74 Ga0070685_10149821 3300005466 Bacteria 1477
75 Ga0070706_100422865 3300005467 Bacteria 1240
76 Ga0070707_100726613 3300005468 Bacteria 956
77 Ga0070699_100010459 3300005518 Bacteria 8029
78 Ga0070679_100004187 3300005530 Bacteria 13301
79 Ga0070684_100013761 3300005535 Bacteria 6531
80 Ga0070684_100135046 3300005535 Bacteria 2228
81 Ga0070684_100269108 3300005535 Bacteria 1559
82 Ga0068853_100618299 3300005539 Unclassified 1030
83 Ga0070672_100016296 3300005543 Bacteria 5319
84 Ga0070672_100027942 3300005543 Bacteria 4214
85 Ga0070672_100584281 3300005543 Unclassified 972
86 Ga0070686_100364504 3300005544 Bacteria 1089
87 Ga0070695_100000236 3300005545 Bacteria 27341
88 Ga0070695_100265060 3300005545 Bacteria 1256
89 Ga0070695_101126441 3300005545 Bacteria 643
90 Ga0070665_100654429 3300005548 Bacteria 1064
91 Ga0070704_100444527 3300005549 Unclassified 1115
92 Ga0068855_100139943 3300005563 Bacteria 2760
93 Ga0070664_100003232 3300005564 Bacteria 13170
94 Ga0070664_100007806 3300005564 Bacteria 8642
95 Ga0070664_100024624 3300005564 Bacteria 4981
96 Ga0070664_100062115 3300005564 Bacteria 3184
97 Ga0070664_100213935 3300005564 Bacteria 1723
98 Ga0068857_100005357 3300005577 Bacteria 10935
99 Ga0068857_100292003 3300005577 Bacteria 1501
100 Ga0068856_101616864 3300005614 Bacteria 661
101 Ga0070702_100023269 3300005615 Bacteria 3290
102 Ga0068852_100017010 3300005616 Bacteria 5693
103 Ga0068852_100028972 3300005616 Bacteria 4541
104 Ga0068859_100170761 3300005617 Bacteria 2255
105 Ga0068864_100036421 3300005618 Bacteria 4194
106 Ga0068864_100309249 3300005618 Unclassified 1481
107 Ga0068864_100539678 3300005618 Bacteria 1126
108 Ga0068864_100640077 3300005618 Bacteria 1035
109 Ga0068864_100670959 3300005618 Bacteria 1011
110 Ga0068861_100002243 3300005719 Bacteria 12547
111 Ga0068851_10007830 3300005834 Bacteria 4920
112 Ga0068851_10008879 3300005834 Bacteria 4661
113 Ga0068870_10060175 3300005840 Unclassified 2038
114 Ga0068863_100104664 3300005841 Bacteria 2692
115 Ga0068863_101140802 3300005841 Bacteria 785
116 Ga0068858_101004541 3300005842 Unclassified 818
117 Ga0068860_100020665 3300005843 Bacteria 6378
118 Ga0068862_101797997 3300005844 Unclassified 622
119 Ga0081540_1195509 3300005983 Bacteria 741
120 Ga0075363_100326564 3300006048 Bacteria 893
121 Ga0075367_10364201 3300006178 Bacteria 913
122 Ga0097621_100191393 3300006237 Unclassified 1772
123 Ga0097621_100664310 3300006237 Bacteria 957
124 Ga0075428_100006094 3300006844 Bacteria 13410
125 Ga0075428_100116903 3300006844 Bacteria 2904
126 Ga0075428_100268059 3300006844 Bacteria 1838
127 Ga0075428_100301157 3300006844 Unclassified 1724
128 Ga0075428_100564010 3300006844 Bacteria 1217
129 Ga0075430_100292674 3300006846 Bacteria 1347
130 Ga0075431_100101980 3300006847 Bacteria 2961
131 Ga0075431_100231197 3300006847 Bacteria 1884
132 Ga0075431_100583655 3300006847 Bacteria 1103
133 Ga0075433_10262822 3300006852 Bacteria 1530
134 Ga0075434_100006685 3300006871 Bacteria 10589
135 Ga0075434_100039871 3300006871 Bacteria 4651
136 Ga0075434_100258298 3300006871 Bacteria 1761
137 Ga0075434_100504876 3300006871 Bacteria 1230
138 Ga0075434_101110460 3300006871 Bacteria 804
139 Ga0075429_100086641 3300006880 Bacteria 2730
140 Ga0075429_100536850 3300006880 Unclassified 1025
141 Ga0075429_101256370 3300006880 Unclassified 646
142 Ga0075429_101326350 3300006880 Bacteria 627
143 Ga0068865_100964414 3300006881 Bacteria 745
144 Ga0068865_101006087 3300006881 Bacteria 730
145 Ga0068865_101124030 3300006881 Bacteria 693
146 Ga0068865_101342822 3300006881 Unclassified 637
147 Ga0068865_101662604 3300006881 Unclassified 575
148 Ga0097620_100170765 3300006931 Bacteria 2255
149 Ga0075435_100336571 3300007076 Bacteria 1293
150 Ga0075435_100567690 3300007076 Bacteria 983
151 Ga0075435_101153039 3300007076 Bacteria 678
152 Ga0111539_10000177 3300009094 Bacteria 74071
153 Ga0111539_10027923 3300009094 Bacteria 6891
154 Ga0111539_10042235 3300009094 Bacteria 5478
155 Ga0111539_10190198 3300009094 Bacteria 2395
156 Ga0111539_10894792 3300009094 Bacteria 1032
157 Ga0105245_10095495 3300009098 Bacteria 2742
158 Ga0114129_10001454 3300009147 Bacteria 31988
159 Ga0114129_10005381 3300009147 Bacteria 18070
160 Ga0114129_10008209 3300009147 Bacteria 14885
161 Ga0114129_10052800 3300009147 Bacteria 5704
162 Ga0114129_10123516 3300009147 Bacteria 3560
163 Ga0114129_10135373 3300009147 Bacteria 3381
164 Ga0114129_10471962 3300009147 Bacteria 1643
165 Ga0114129_11589577 3300009147 Bacteria 801
166 Ga0105243_10390380 3300009148 Bacteria 1290
167 Ga0105243_10453015 3300009148 Bacteria 1204
168 Ga0105243_10594002 3300009148 Bacteria 1065
169 Ga0105241_10733236 3300009174 Unclassified 905
170 Ga0105242_10114492 3300009176 Bacteria 2304
171 Ga0105248_10040872 3300009177 Bacteria 5199
172 Ga0105248_10666754 3300009177 Bacteria 1173
173 Ga0105237_11148036 3300009545 Bacteria 783
174 Ga0105249_10000959 3300009553 Bacteria 25526
175 Ga0105249_10027622 3300009553 Bacteria 5120
176 Ga0105239_10055176 3300010375 Bacteria 4358
177 Ga0105246_10790897 3300011119 Unclassified 841
178 Ga0157371_10016387 3300013102 Bacteria 5532
179 Ga0157374_10144044 3300013296 Bacteria 2314
180 Ga0157378_10282575 3300013297 Bacteria 1600
181 Ga0157378_10439738 3300013297 Unclassified 1292
182 Ga0163162_10520091 3300013306 Bacteria 1319
183 Ga0157372_10739839 3300013307 Unclassified 1144
184 Ga0157375_10631029 3300013308 Bacteria 1229
185 Ga0163163_10013821 3300014325 Bacteria 7405
186 Ga0163163_11047301 3300014325 Bacteria 879
187 Ga0157380_10028736 3300014326 Bacteria 4243
188 Ga0157380_10394975 3300014326 Bacteria 1310
189 Ga0157377_10069513 3300014745 Bacteria 2032
190 Ga0157379_10044277 3300014968 Bacteria 3973
191 Ga0157376_10849628 3300014969 Bacteria 928
192 Ga0157376_11603510 3300014969 Unclassified 685
193 Ga0207697_10013293 3300025315 Bacteria 3435
194 Ga0207697_10015048 3300025315 Bacteria 3201
195 Ga0207656_10032174 3300025321 Bacteria 2177
196 Ga0207656_10077277 3300025321 Bacteria 1490
197 Ga0207642_10142990 3300025899 Bacteria 1264
198 Ga0207688_10018587 3300025901 Bacteria 3781
199 Ga0207688_10537483 3300025901 Bacteria 734
200 Ga0207647_10421978 3300025904 Unclassified 750
201 Ga0207645_10001970 3300025907 Bacteria 16506
202 Ga0207643_10164094 3300025908 Bacteria 1338
203 Ga0207643_10190798 3300025908 Unclassified 1244
204 Ga0207684_10404975 3300025910 Bacteria 1173
205 Ga0207654_10391215 3300025911 Unclassified 965
206 Ga0207707_10035678 3300025912 Bacteria 4348
207 Ga0207693_10137073 3300025915 Bacteria 1924
208 Ga0207660_10263232 3300025917 Bacteria 1364
209 Ga0207662_10002728 3300025918 Bacteria 8910
210 Ga0207657_10150993 3300025919 Bacteria 1892
211 Ga0207649_10596851 3300025920 Bacteria 849
212 Ga0207652_10061513 3300025921 Bacteria 3242
213 Ga0207646_10133821 3300025922 Bacteria 2232
214 Ga0207681_10232479 3300025923 Bacteria 1431
215 Ga0207650_10106902 3300025925 Bacteria 2161
216 Ga0207650_10267087 3300025925 Bacteria 1389
217 Ga0207650_10277567 3300025925 Bacteria 1364
218 Ga0207650_10497477 3300025925 Unclassified 1018
219 Ga0207650_11035649 3300025925 Unclassified 698
220 Ga0207659_10113684 3300025926 Unclassified 2062
221 Ga0207659_10295099 3300025926 Bacteria 1329
222 Ga0207700_11198465 3300025928 Bacteria 678
223 Ga0207644_10772710 3300025931 Bacteria 803
224 Ga0207706_10003961 3300025933 Bacteria 14029
225 Ga0207686_10100679 3300025934 Bacteria 1928
226 Ga0207686_10690592 3300025934 Bacteria 810
227 Ga0207670_11163705 3300025936 Bacteria 652
228 Ga0207669_10071631 3300025937 Bacteria 2179
229 Ga0207669_10294305 3300025937 Bacteria 1231
230 Ga0207669_10921820 3300025937 Bacteria 731
231 Ga0207704_11086929 3300025938 Bacteria 679
232 Ga0207691_10002006 3300025940 Bacteria 19922
233 Ga0207691_10313987 3300025940 Unclassified 1344
234 Ga0207711_10023592 3300025941 Bacteria 5150
235 Ga0207711_10743732 3300025941 Unclassified 914
236 Ga0207689_10094692 3300025942 Bacteria 2453
237 Ga0207689_10130735 3300025942 Bacteria 2066
238 Ga0207689_10727862 3300025942 Bacteria 837
239 Ga0207661_10016555 3300025944 Bacteria 5441
240 Ga0207661_10348098 3300025944 Bacteria 1336
241 Ga0207679_10023052 3300025945 Bacteria 4250
242 Ga0207679_10047233 3300025945 Bacteria 3126
243 Ga0207679_10231914 3300025945 Bacteria 1559
244 Ga0207679_10371510 3300025945 Bacteria 1252
245 Ga0207679_10732959 3300025945 Bacteria 898
246 Ga0207667_10059289 3300025949 Unclassified 4009
247 Ga0207651_10135868 3300025960 Bacteria 1891
248 Ga0207712_11296278 3300025961 Bacteria 651
249 Ga0207712_11634085 3300025961 Bacteria 577
250 Ga0207668_10365674 3300025972 Unclassified 1210
251 Ga0207668_10900082 3300025972 Unclassified 787
252 Ga0207658_10049336 3300025986 Bacteria 3093
253 Ga0207677_10273938 3300026023 Bacteria 1382
254 Ga0207703_10795658 3300026035 Bacteria 902
255 Ga0207639_10026838 3300026041 Bacteria 4188
256 Ga0207678_10162895 3300026067 Bacteria 1905
257 Ga0207678_10246860 3300026067 Unclassified 1529
258 Ga0207678_10466001 3300026067 Bacteria 1099
259 Ga0207708_10110062 3300026075 Bacteria 2137
260 Ga0207641_10364886 3300026088 Bacteria 1380
261 Ga0207641_10562483 3300026088 Bacteria 1113
262 Ga0207648_10180179 3300026089 Bacteria 1870
263 Ga0207676_10115493 3300026095 Bacteria 2254
264 Ga0207676_10179002 3300026095 Bacteria 1855
265 Ga0207676_10562976 3300026095 Bacteria 1090
266 Ga0207674_10004309 3300026116 Bacteria 17158
267 Ga0207674_10004450 3300026116 Bacteria 16842
268 Ga0207675_100004080 3300026118 Bacteria 14138
269 Ga0207683_10029376 3300026121 Bacteria 4759
270 Ga0207683_11368504 3300026121 Unclassified 655
271 Ga0207698_10036322 3300026142 Bacteria 3616
272 Ga0207428_10020140 3300027907 Bacteria 5674
273 Ga0207428_10064221 3300027907 Unclassified 2899
274 Ga0207428_10093550 3300027907 Bacteria 2331
275 Ga0268266_10296321 3300028379 Bacteria 1508
276 Ga0268266_10598577 3300028379 Bacteria 1059
277 Ga0268265_10029275 3300028380 Bacteria 3951
278 Ga0307408_100019425 3300031548 Bacteria 4576
279 Ga0307408_100149840 3300031548 Bacteria 1840
280 Ga0307408_100397289 3300031548 Bacteria 1183
281 Ga0307413_10653336 3300031824 Bacteria 868
282 Ga0307413_11179838 3300031824 Unclassified 665
283 Ga0307406_10177156 3300031901 Bacteria 1549
284 Ga0307406_10224535 3300031901 Bacteria 1398
285 Ga0307407_10136665 3300031903 Bacteria 1576
286 Ga0307409_100838264 3300031995 Bacteria 929
287 Ga0307409_101791567 3300031995 Unclassified 643
288 Ga0307416_100041674 3300032002 Bacteria 3578
289 Ga0307416_100141654 3300032002 Bacteria 2187
290 Ga0307411_10126237 3300032005 Bacteria 1861
291 Ga0307411_10853980 3300032005 Bacteria 805
292 Ga0307411_11341792 3300032005 Unclassified 653
293 Ga0307415_100182403 3300032126 Bacteria 1648
294 Ga0373943_0627406 3300035170 Unclassified 634
295 Ga0373961_0365569 3300035241 Unclassified 547
296 Ga0436364_1397950 3300037853 Bacteria 2431
297 Ga0395901_1105746 3300038443 Bacteria 763
298 Ga0451800_1683859 3300041459 Unclassified 736
299 Ga0439431_0052566 3300041997 Archaea 1059
300 Ga0439448_0285533 3300042005 Bacteria 585
301 Ga0450895_009024 3300042132 Unclassified 841
302 Ga0439434_0243573 3300042435 Unclassified 614
303 Ga0450893_0110045 3300042532 Bacteria 568
304 Ga0451577_0216652 3300042876 Unclassified 1730
305 Ga0451576_0101628 3300045051 Bacteria 2990
306 Ga0495665_0302533 3300046531 Bacteria 819
307 Ga0495656_0117571 3300046615 Bacteria 1251
308 Ga0495658_0099481 3300046683 Bacteria 1734
309 Ga0495669_0000817 3300046684 Bacteria 13248
310 Ga0496101_1056121 3300048904 Bacteria 638
311 Ga0496104_0002024 3300048907 Bacteria 17607
312 Ga0496105_0025743 3300048908 Bacteria 4793
313 Ga0496106_0156185 3300048909 Bacteria 1802
314 Ga0496108_0131035 3300048911 Bacteria 2155
315 Ga0496108_0771574 3300048911 Bacteria 831
316 Ga0496109_0019085 3300048912 Bacteria 6038
317 Ga0496110_0013759 3300048913 Bacteria 6703
318 Ga0496111_0006579 3300048914 Bacteria 7559
319 Ga0496112_0000729 3300048915 Bacteria 22860
320 Ga0496113_0021744 3300048916 Bacteria 4529
321 Ga0496114_0494486 3300048917 Bacteria 1082
322 Ga0501034_0587319 3300049571 Bacteria 1020
323 Ga0501039_0131534 3300049575 Bacteria 1964
324 Ga0501040_0402984 3300049576 Bacteria 982
325 Ga0501042_1097660 3300049578 Bacteria 580
326 Ga0501048_0057596 3300049582 Bacteria 2756
327 Ga0501073_0047692 3300049589 Unclassified 3010
328 Ga0501074_0445648 3300049590 Bacteria 918
329 Ga0501076_0841165 3300049592 Bacteria 757
330 Ga0501079_0227836 3300049741 Unclassified 1456
331 Ga0501080_0805170 3300049742 Bacteria 824
332 Ga0501081_0016090 3300049743 Bacteria 4940
333 Ga0501045_0039845 3300049824 Bacteria 3419
334 nmdc:mga03n38_270875_c1 3300050490 Bacteria 903
335 nmdc:mga0k408_113233_c1 3300050493 Bacteria 1604
336 nmdc:mga05p37_11732_c1 3300050507 Bacteria 10446
337 nmdc:mga05p37_121979_c1 3300050507 Bacteria 3201
338 nmdc:mga05p37_126462_c1 3300050507 Bacteria 3139
339 nmdc:mga05p37_28023_c1 3300050507 Bacteria 6863
340 nmdc:mga05p37_581749_c1 3300050507 Bacteria 1268
341 nmdc:mga05p37_873170_c1 3300050507 Bacteria 974
342 nmdc:mga05p37_90375_c1 3300050507 Bacteria 3774
343 nmdc:mga09592_1160584_c1 3300050508 Bacteria 640
344 nmdc:mga09592_134659_c1 3300050508 Bacteria 2128
345 nmdc:mga09592_454843_c1 3300050508 Unclassified 1104
346 nmdc:mga0qj67_69899_c1 3300050509 Bacteria 2800
347 nmdc:mga06r32_116587_c1 3300050510 Unclassified 2631
348 nmdc:mga06r32_212819_c1 3300050510 Bacteria 1921
349 nmdc:mga06r32_349772_c1 3300050510 Bacteria 1462
350 nmdc:mga08y16_10640_c1 3300050511 Bacteria 9654
351 nmdc:mga08y16_108912_c1 3300050511 Bacteria 2884
352 nmdc:mga08y16_1115169_c1 3300050511 Unclassified 763
353 nmdc:mga08y16_175627_c1 3300050511 Bacteria 2224
354 nmdc:mga08y16_233206_c1 3300050511 Bacteria 1903
355 nmdc:mga08y16_30128_c1 3300050511 Bacteria 5712
356 nmdc:mga0n895_152067_c1 3300050512 Bacteria 2345
357 nmdc:mga0n895_2831_c1 3300050512 Bacteria 13738
358 nmdc:mga0n895_666812_c1 3300050512 Bacteria 1038
359 nmdc:mga0rr50_373362_c1 3300050513 Bacteria 1202
360 nmdc:mga0a205_256292_c1 3300050515 Bacteria 1628
361 Ga0501084_1596918 3300054114 Unclassified 545
362 Ga0530510_0000971 3300061734 Bacteria 18945
363 Ga0307405_10302326
364 MRS1b_contig_1858700
365 MBSR1b_contig_6041409
366 Ga0065704_10097370
367 Ga0065704_10444118
368 Ga0065712_10000410
369 Ga0065712_10100538
370 Ga0065712_10148785
371 Ga0065715_10057341
372 Ga0065715_10109348
373 Ga0065715_10305705
374 Ga0065715_10482482
375 Ga0065715_10781100
376 Ga0065707_10387657
377 Ga0065707_10408495
378 Ga0070676_10433845
379 Ga0070683_100000260
380 Ga0070683_100292293
381 Ga0070690_100736544
382 Ga0070670_100017730
383 Ga0070670_100122544
384 Ga0070670_100523786
385 Ga0068869_100075600
386 Ga0068869_100143611
387 Ga0070682_100347455
388 Ga0070682_100947078
389 Ga0068868_100700050
390 Ga0070660_100021100
391 Ga0070660_100291646
392 Ga0070660_100422379
393 Ga0070689_100009981
394 Ga0070687_100002884
395 Ga0070661_100001808
396 Ga0070661_100012307
397 Ga0070661_100013787
398 Ga0070661_100013817
399 Ga0070692_10025516
400 Ga0070668_100004750
401 Ga0070668_100296010
402 Ga0070668_100821145
403 Ga0070669_100021247
404 Ga0070675_100025600
405 Ga0070675_100149997
406 Ga0070675_100416369
407 Ga0070675_100754078
408 Ga0070671_100016315
409 Ga0070674_100116143
410 Ga0070673_100133423
411 Ga0070673_100740063
412 Ga0070673_101154057
413 Ga0070688_100263422
414 Ga0070659_100015745
415 Ga0070659_100057214
416 Ga0070667_100462920
417 Ga0070713_100956047
418 Ga0070701_10299778
419 Ga0070701_10363994
420 Ga0070711_100274779
421 Ga0070705_100142361
422 Ga0070700_100010666
423 Ga0070700_100635760
424 Ga0070694_100061124
425 Ga0070708_100296001
426 Ga0070708_101038952
427 Ga0070663_100021408
428 Ga0070663_100055975
429 Ga0070663_100686588
430 Ga0070678_100079711
431 Ga0070678_100137720
432 Ga0070678_101065105
433 Ga0070662_100012798
434 Ga0070662_100036786
435 Ga0070681_10001803
436 Ga0070685_10149821
437 Ga0070706_100422865
438 Ga0070707_100726613
439 Ga0070699_100010459
440 Ga0070679_100004187
441 Ga0070684_100013761
442 Ga0070684_100135046
443 Ga0070684_100269108
444 Ga0068853_100618299
445 Ga0070672_100016296
446 Ga0070672_100027942
447 Ga0070672_100584281
448 Ga0070686_100364504
449 Ga0070695_100000236
450 Ga0070695_100265060
451 Ga0070695_101126441
452 Ga0070665_100654429
453 Ga0070704_100444527
454 Ga0068855_100139943
455 Ga0070664_100003232
456 Ga0070664_100007806
457 Ga0070664_100024624
458 Ga0070664_100062115
459 Ga0070664_100213935
460 Ga0068857_100005357
461 Ga0068857_100292003
462 Ga0068856_101616864
463 Ga0070702_100023269
464 Ga0068852_100017010
465 Ga0068852_100028972
466 Ga0068859_100170761
467 Ga0068864_100036421
468 Ga0068864_100309249
469 Ga0068864_100539678
470 Ga0068864_100640077
471 Ga0068864_100670959
472 Ga0068861_100002243
473 Ga0068851_10007830
474 Ga0068851_10008879
475 Ga0068870_10060175
476 Ga0068863_100104664
477 Ga0068863_101140802
478 Ga0068858_101004541
479 Ga0068860_100020665
480 Ga0068862_101797997
481 Ga0081540_1195509
482 Ga0075363_100326564
483 Ga0075367_10364201
484 Ga0097621_100191393
485 Ga0097621_100664310
486 Ga0075428_100006094
487 Ga0075428_100116903
488 Ga0075428_100268059
489 Ga0075428_100301157
490 Ga0075428_100564010
491 Ga0075430_100292674
492 Ga0075431_100101980
493 Ga0075431_100231197
494 Ga0075431_100583655
495 Ga0075433_10262822
496 Ga0075434_100006685
497 Ga0075434_100039871
498 Ga0075434_100258298
499 Ga0075434_100504876
500 Ga0075434_101110460
501 Ga0075429_100086641
502 Ga0075429_100536850
503 Ga0075429_101256370
504 Ga0075429_101326350
505 Ga0068865_100964414
506 Ga0068865_101006087
507 Ga0068865_101124030
508 Ga0068865_101342822
509 Ga0068865_101662604
510 Ga0097620_100170765
511 Ga0075435_100336571
512 Ga0075435_100567690
513 Ga0075435_101153039
514 Ga0111539_10000177
515 Ga0111539_10027923
516 Ga0111539_10042235
517 Ga0111539_10190198
518 Ga0111539_10894792
519 Ga0105245_10095495
520 Ga0114129_10001454
521 Ga0114129_10005381
522 Ga0114129_10008209
523 Ga0114129_10052800
524 Ga0114129_10123516
525 Ga0114129_10135373
526 Ga0114129_10471962
527 Ga0114129_11589577
528 Ga0105243_10390380
529 Ga0105243_10453015
530 Ga0105243_10594002
531 Ga0105241_10733236
532 Ga0105242_10114492
533 Ga0105248_10040872
534 Ga0105248_10666754
535 Ga0105237_11148036
536 Ga0105249_10000959
537 Ga0105249_10027622
538 Ga0105239_10055176
539 Ga0105246_10790897
540 Ga0157371_10016387
541 Ga0157374_10144044
542 Ga0157378_10282575
543 Ga0157378_10439738
544 Ga0163162_10520091
545 Ga0157372_10739839
546 Ga0157375_10631029
547 Ga0163163_10013821
548 Ga0163163_11047301
549 Ga0157380_10028736
550 Ga0157380_10394975
551 Ga0157377_10069513
552 Ga0157379_10044277
553 Ga0157376_10849628
554 Ga0157376_11603510
555 Ga0207697_10013293
556 Ga0207697_10015048
557 Ga0207656_10032174
558 Ga0207656_10077277
559 Ga0207642_10142990
560 Ga0207688_10018587
561 Ga0207688_10537483
562 Ga0207647_10421978
563 Ga0207645_10001970
564 Ga0207643_10164094
565 Ga0207643_10190798
566 Ga0207684_10404975
567 Ga0207654_10391215
568 Ga0207707_10035678
569 Ga0207693_10137073
570 Ga0207660_10263232
571 Ga0207662_10002728
572 Ga0207657_10150993
573 Ga0207649_10596851
574 Ga0207652_10061513
575 Ga0207646_10133821
576 Ga0207681_10232479
577 Ga0207650_10106902
578 Ga0207650_10267087
579 Ga0207650_10277567
580 Ga0207650_10497477
581 Ga0207650_11035649
582 Ga0207659_10113684
583 Ga0207659_10295099
584 Ga0207700_11198465
585 Ga0207644_10772710
586 Ga0207706_10003961
587 Ga0207686_10100679
588 Ga0207686_10690592
589 Ga0207670_11163705
590 Ga0207669_10071631
591 Ga0207669_10294305
592 Ga0207669_10921820
593 Ga0207704_11086929
594 Ga0207691_10002006
595 Ga0207691_10313987
596 Ga0207711_10023592
597 Ga0207711_10743732
598 Ga0207689_10094692
599 Ga0207689_10130735
600 Ga0207689_10727862
601 Ga0207661_10016555
602 Ga0207661_10348098
603 Ga0207679_10023052
604 Ga0207679_10047233
605 Ga0207679_10231914
606 Ga0207679_10371510
607 Ga0207679_10732959
608 Ga0207667_10059289
609 Ga0207651_10135868
610 Ga0207712_11296278
611 Ga0207712_11634085
612 Ga0207668_10365674
613 Ga0207668_10900082
614 Ga0207658_10049336
615 Ga0207677_10273938
616 Ga0207703_10795658
617 Ga0207639_10026838
618 Ga0207678_10162895
619 Ga0207678_10246860
620 Ga0207678_10466001
621 Ga0207708_10110062
622 Ga0207641_10364886
623 Ga0207641_10562483
624 Ga0207648_10180179
625 Ga0207676_10115493
626 Ga0207676_10179002
627 Ga0207676_10562976
628 Ga0207674_10004309
629 Ga0207674_10004450
630 Ga0207675_100004080
631 Ga0207683_10029376
632 Ga0207683_11368504
633 Ga0207698_10036322
634 Ga0207428_10020140
635 Ga0207428_10064221
636 Ga0207428_10093550
637 Ga0268266_10296321
638 Ga0268266_10598577
639 Ga0268265_10029275
640 Ga0307408_100019425
641 Ga0307408_100149840
642 Ga0307408_100397289
643 Ga0307413_10653336
644 Ga0307413_11179838
645 Ga0307406_10177156
646 Ga0307406_10224535
647 Ga0307407_10136665
648 Ga0307409_100838264
649 Ga0307409_101791567
650 Ga0307416_100041674
651 Ga0307416_100141654
652 Ga0307411_10126237
653 Ga0307411_10853980
654 Ga0307411_11341792
655 Ga0307415_100182403
656 Ga0373943_0627406
657 Ga0373961_0365569
658 Ga0436364_1397950
659 Ga0395901_1105746
660 Ga0451800_1683859
661 Ga0439431_0052566
662 Ga0439448_0285533
663 Ga0450895_009024
664 Ga0439434_0243573
665 Ga0450893_0110045
666 Ga0451577_0216652
667 Ga0451576_0101628
668 Ga0495665_0302533
669 Ga0495656_0117571
670 Ga0495658_0099481
671 Ga0495669_0000817
672 Ga0496101_1056121
673 Ga0496104_0002024
674 Ga0496105_0025743
675 Ga0496106_0156185
676 Ga0496108_0131035
677 Ga0496108_0771574
678 Ga0496109_0019085
679 Ga0496110_0013759
680 Ga0496111_0006579
681 Ga0496112_0000729
682 Ga0496113_0021744
683 Ga0496114_0494486
684 Ga0501034_0587319
685 Ga0501039_0131534
686 Ga0501040_0402984
687 Ga0501042_1097660
688 Ga0501048_0057596
689 Ga0501073_0047692
690 Ga0501074_0445648
691 Ga0501076_0841165
692 Ga0501079_0227836
693 Ga0501080_0805170
694 Ga0501081_0016090
695 Ga0501045_0039845
696 nmdc:mga03n38_270875_c1
697 nmdc:mga0k408_113233_c1
698 nmdc:mga05p37_11732_c1
699 nmdc:mga05p37_121979_c1
700 nmdc:mga05p37_126462_c1
701 nmdc:mga05p37_28023_c1
702 nmdc:mga05p37_581749_c1
703 nmdc:mga05p37_873170_c1
704 nmdc:mga05p37_90375_c1
705 nmdc:mga09592_1160584_c1
706 nmdc:mga09592_134659_c1
707 nmdc:mga09592_454843_c1
708 nmdc:mga0qj67_69899_c1
709 nmdc:mga06r32_116587_c1
710 nmdc:mga06r32_212819_c1
711 nmdc:mga06r32_349772_c1
712 nmdc:mga08y16_10640_c1
713 nmdc:mga08y16_108912_c1
714 nmdc:mga08y16_1115169_c1
715 nmdc:mga08y16_175627_c1
716 nmdc:mga08y16_233206_c1
717 nmdc:mga08y16_30128_c1
718 nmdc:mga0n895_152067_c1
719 nmdc:mga0n895_2831_c1
720 nmdc:mga0n895_666812_c1
721 nmdc:mga0rr50_373362_c1
722 nmdc:mga0a205_256292_c1
723 Ga0501084_1596918
724 Ga0530510_0000971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

29

163

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pu2-assembly8.cif.gz_H crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9242 12 164
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.9212 12 166
3pu2-assembly7.cif.gz_G crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9205 13 164
3pu2-assembly2.cif.gz_B crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9109 11 163
3pu2-assembly5.cif.gz_E crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9072 12 164
ID Description Score Start End Superfamily
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8937 12 166 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8716 13 161 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8618 12 166 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8613 12 160 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.857 13 164 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7V8XQN9-F1-model_v4 SRPBCC family protein 0.9593 1 167
AF-A0A535RST0-F1-model_v4 ATPase 0.9583 13 166
AF-A0A7V8XQN9-F1-model_v4 SRPBCC family protein 0.9537 1 167
AF-A0A7K1JPV7-F1-model_v4 SRPBCC family protein 0.9529 6 164
AF-A0A545TXL1-F1-model_v4 ATPase 0.9508 11 164

Map