F422639

General Info

Members Datasets Scaffolds Average Seq Length
362 193 724 63

Family's Representative Sequence

Representative Sequence 3300027424|Ga0209984_1070375|Ga0209984_10703751
Length 57
Sequence MSASHHPTDIHLRQHRAKKRRIAAAPATERAALEAKVQRTYSPFHSLMKENLPPAAV

Samples

Sample ID Description Type Environment
1 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
74 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
128 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
129 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
140 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
141 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
144 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
145 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
146 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
179 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.31
Nodule 0
Rhizoplane 1.66
Rhizosphere 94.2
Stem 0
Stem Tuber 0
Unclassified 32.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209984_1070375 3300027424 Unclassified 522
2 Ga0065712_10078140 3300005290 Bacteria 3388
3 Ga0065712_10726982 3300005290 Unclassified 533
4 Ga0065715_10168139 3300005293 Bacteria 1569
5 Ga0065715_11191103 3300005293 Unclassified 500
6 Ga0065707_10002731 3300005295 Bacteria 5616
7 Ga0065707_10167163 3300005295 Bacteria 1513
8 Ga0065707_10450699 3300005295 Unclassified 789
9 Ga0070690_100033858 3300005330 Bacteria 3200
10 Ga0070690_100169587 3300005330 Bacteria 1501
11 Ga0070670_100006499 3300005331 Bacteria 9896
12 Ga0070670_100020095 3300005331 Bacteria 5736
13 Ga0070670_100143349 3300005331 Unclassified 2066
14 Ga0070670_101568131 3300005331 Unclassified 605
15 Ga0070670_101711769 3300005331 Bacteria 579
16 Ga0070677_10041183 3300005333 Bacteria 1822
17 Ga0068869_100485068 3300005334 Bacteria 1030
18 Ga0070666_10084854 3300005335 Bacteria 2168
19 Ga0070666_11188965 3300005335 Unclassified 568
20 Ga0070689_100866346 3300005340 Unclassified 797
21 Ga0070687_100041671 3300005343 Bacteria 2321
22 Ga0070661_100148081 3300005344 Bacteria 1774
23 Ga0070661_101202485 3300005344 Bacteria 634
24 Ga0070669_100066009 3300005353 Bacteria 2666
25 Ga0070669_100080461 3300005353 Unclassified 2425
26 Ga0070669_100306449 3300005353 Bacteria 1279
27 Ga0070669_101447582 3300005353 Bacteria 597
28 Ga0070675_100000983 3300005354 Bacteria 20391
29 Ga0070675_100002099 3300005354 Bacteria 14757
30 Ga0070675_100017654 3300005354 Bacteria 5674
31 Ga0070675_100134330 3300005354 Bacteria 2111
32 Ga0070675_100181319 3300005354 Unclassified 1821
33 Ga0070675_100334390 3300005354 Bacteria 1340
34 Ga0070675_100439261 3300005354 Bacteria 1169
35 Ga0070675_100981081 3300005354 Unclassified 775
36 Ga0070671_101024078 3300005355 Unclassified 724
37 Ga0070674_100316997 3300005356 Bacteria 1249
38 Ga0070674_100540755 3300005356 Unclassified 976
39 Ga0070674_100630839 3300005356 Bacteria 909
40 Ga0070674_102097454 3300005356 Unclassified 516
41 Ga0070673_100006532 3300005364 Bacteria 7585
42 Ga0070673_100368211 3300005364 Bacteria 1279
43 Ga0070688_100776558 3300005365 Unclassified 747
44 Ga0070688_100794485 3300005365 Bacteria 740
45 Ga0070659_100177855 3300005366 Bacteria 1745
46 Ga0070659_100366500 3300005366 Unclassified 1211
47 Ga0070667_100117130 3300005367 Bacteria 2314
48 Ga0070667_102066822 3300005367 Bacteria 537
49 Ga0070703_10518974 3300005406 Unclassified 539
50 Ga0070701_10147917 3300005438 Bacteria 1350
51 Ga0070700_100449946 3300005441 Bacteria 980
52 Ga0068867_100223007 3300005459 Bacteria 1520
53 Ga0070685_10652359 3300005466 Unclassified 763
54 Ga0070698_100976411 3300005471 Unclassified 794
55 Ga0070679_100646475 3300005530 Unclassified 1000
56 Ga0070684_100060262 3300005535 Unclassified 3319
57 Ga0070672_100251216 3300005543 Bacteria 1489
58 Ga0070672_100473722 3300005543 Bacteria 1081
59 Ga0070672_100659173 3300005543 Unclassified 914
60 Ga0070672_100812811 3300005543 Bacteria 823
61 Ga0070672_100840884 3300005543 Unclassified 809
62 Ga0070686_100051220 3300005544 Bacteria 2627
63 Ga0070686_100160556 3300005544 Bacteria 1582
64 Ga0070693_101096925 3300005547 Unclassified 607
65 Ga0068855_100420885 3300005563 Bacteria 1461
66 Ga0070664_100180400 3300005564 Bacteria 1876
67 Ga0070664_100181114 3300005564 Bacteria 1873
68 Ga0070664_100457123 3300005564 Bacteria 1173
69 Ga0068857_100387467 3300005577 Unclassified 1299
70 Ga0068857_101847146 3300005577 Unclassified 592
71 Ga0068854_100028274 3300005578 Bacteria 3873
72 Ga0070702_100889560 3300005615 Bacteria 696
73 Ga0068859_100033881 3300005617 Bacteria 5128
74 Ga0068859_100057603 3300005617 Bacteria 3914
75 Ga0068864_100020396 3300005618 Bacteria 5544
76 Ga0068864_100079124 3300005618 Bacteria 2878
77 Ga0068864_100878193 3300005618 Bacteria 885
78 Ga0068861_100280035 3300005719 Unclassified 1436
79 Ga0068861_100670815 3300005719 Bacteria 960
80 Ga0068861_101277181 3300005719 Bacteria 713
81 Ga0068870_10005002 3300005840 Bacteria 5755
82 Ga0068870_10255655 3300005840 Unclassified 1088
83 Ga0068863_100797862 3300005841 Bacteria 942
84 Ga0068858_100401861 3300005842 Bacteria 1316
85 Ga0068858_101145575 3300005842 Unclassified 764
86 Ga0068860_100129746 3300005843 Bacteria 2418
87 Ga0068860_102799922 3300005843 Unclassified 506
88 Ga0068862_100409736 3300005844 Bacteria 1270
89 Ga0068862_100711161 3300005844 Bacteria 974
90 Ga0068862_102406492 3300005844 Unclassified 538
91 Ga0068862_102567828 3300005844 Unclassified 521
92 Ga0075365_10143266 3300006038 Bacteria 1660
93 Ga0075364_10060343 3300006051 Bacteria 2487
94 Ga0075432_10265927 3300006058 Bacteria 701
95 Ga0075367_10039764 3300006178 Bacteria 2743
96 Ga0075367_10072331 3300006178 Bacteria 2076
97 Ga0075427_10090577 3300006194 Unclassified 561
98 Ga0075366_10048405 3300006195 Bacteria 2521
99 Ga0097621_100065914 3300006237 Bacteria 2982
100 Ga0097621_100387184 3300006237 Bacteria 1250
101 Ga0097621_100453208 3300006237 Unclassified 1156
102 Ga0075370_10021904 3300006353 Bacteria 3504
103 Ga0068871_102140881 3300006358 Bacteria 533
104 Ga0075428_100035002 3300006844 Bacteria 5536
105 Ga0075428_100125245 3300006844 Bacteria 2796
106 Ga0075428_100482654 3300006844 Bacteria 1326
107 Ga0075428_100778519 3300006844 Unclassified 1017
108 Ga0075430_100025556 3300006846 Bacteria 5025
109 Ga0075430_100178151 3300006846 Bacteria 1768
110 Ga0075430_100495315 3300006846 Unclassified 1008
111 Ga0075431_100004680 3300006847 Bacteria 13438
112 Ga0075431_100435653 3300006847 Unclassified 1308
113 Ga0075433_10045544 3300006852 Bacteria 3813
114 Ga0075434_100093924 3300006871 Bacteria 3003
115 Ga0075434_100205533 3300006871 Bacteria 1989
116 Ga0075434_100244635 3300006871 Unclassified 1814
117 Ga0075434_100339345 3300006871 Unclassified 1523
118 Ga0075434_100611704 3300006871 Bacteria 1109
119 Ga0075434_101063747 3300006871 Bacteria 823
120 Ga0075429_100019281 3300006880 Bacteria 5907
121 Ga0075429_100303171 3300006880 Bacteria 1399
122 Ga0075429_101313193 3300006880 Bacteria 631
123 Ga0068865_100324169 3300006881 Bacteria 1240
124 Ga0068865_101731603 3300006881 Bacteria 564
125 Ga0097620_100033881 3300006931 Bacteria 5128
126 Ga0097620_100057604 3300006931 Bacteria 3914
127 Ga0075435_100485136 3300007076 Bacteria 1068
128 Ga0075435_100755965 3300007076 Bacteria 846
129 Ga0075435_101328538 3300007076 Unclassified 630
130 Ga0105240_10257812 3300009093 Bacteria 2013
131 Ga0111539_10019783 3300009094 Bacteria 8302
132 Ga0111539_10093560 3300009094 Unclassified 3531
133 Ga0111539_10099152 3300009094 Bacteria 3422
134 Ga0111539_10171842 3300009094 Unclassified 2532
135 Ga0111539_10220704 3300009094 Bacteria 2208
136 Ga0105245_12744768 3300009098 Unclassified 545
137 Ga0105247_10881672 3300009101 Unclassified 689
138 Ga0114129_10020454 3300009147 Bacteria 9413
139 Ga0114129_10331330 3300009147 Bacteria 2021
140 Ga0114129_10427497 3300009147 Unclassified 1741
141 Ga0114129_10697744 3300009147 Unclassified 1305
142 Ga0114129_10715318 3300009147 Unclassified 1286
143 Ga0105241_10015762 3300009174 Bacteria 5538
144 Ga0105241_11829769 3300009174 Unclassified 593
145 Ga0105242_10669836 3300009176 Bacteria 1011
146 Ga0105242_11891460 3300009176 Bacteria 637
147 Ga0105248_10548885 3300009177 Bacteria 1303
148 Ga0105248_10966012 3300009177 Unclassified 962
149 Ga0105248_11345990 3300009177 Unclassified 808
150 Ga0105248_12548086 3300009177 Unclassified 583
151 Ga0105249_10504185 3300009553 Bacteria 1256
152 Ga0105249_10807119 3300009553 Bacteria 1002
153 Ga0105249_11199719 3300009553 Unclassified 830
154 Ga0105249_11301361 3300009553 Bacteria 798
155 Ga0105249_13542241 3300009553 Unclassified 503
156 Ga0105246_10745057 3300011119 Unclassified 863
157 Ga0157329_1035555 3300012491 Unclassified 537
158 Ga0157327_1053633 3300012512 Unclassified 581
159 Ga0157374_10443210 3300013296 Bacteria 1299
160 Ga0163162_10729519 3300013306 Bacteria 1111
161 Ga0163162_11547450 3300013306 Bacteria 756
162 Ga0163162_12878133 3300013306 Unclassified 554
163 Ga0157375_10406317 3300013308 Bacteria 1528
164 Ga0163163_10016474 3300014325 Bacteria 6872
165 Ga0163163_10020414 3300014325 Bacteria 6237
166 Ga0163163_10406709 3300014325 Bacteria 1419
167 Ga0157380_10039478 3300014326 Unclassified 3671
168 Ga0157380_10045976 3300014326 Bacteria 3427
169 Ga0157380_10453359 3300014326 Bacteria 1232
170 Ga0157377_10098236 3300014745 Bacteria 1740
171 Ga0157377_10658080 3300014745 Bacteria 755
172 Ga0157379_10918263 3300014968 Unclassified 831
173 Ga0157376_12332230 3300014969 Bacteria 574
174 Ga0207653_10019787 3300025885 Bacteria 2124
175 Ga0207682_10259267 3300025893 Bacteria 810
176 Ga0207680_10268166 3300025903 Bacteria 1183
177 Ga0207680_11221428 3300025903 Unclassified 536
178 Ga0207643_10180453 3300025908 Unclassified 1277
179 Ga0207643_10518140 3300025908 Unclassified 763
180 Ga0207654_10039220 3300025911 Bacteria 2662
181 Ga0207662_10013167 3300025918 Bacteria 4621
182 Ga0207662_10465571 3300025918 Bacteria 866
183 Ga0207649_11593228 3300025920 Unclassified 517
184 Ga0207681_10122310 3300025923 Unclassified 1910
185 Ga0207681_10282954 3300025923 Bacteria 1306
186 Ga0207681_10337339 3300025923 Bacteria 1203
187 Ga0207681_10961129 3300025923 Unclassified 716
188 Ga0207681_11068621 3300025923 Bacteria 678
189 Ga0207681_11245830 3300025923 Unclassified 625
190 Ga0207650_10027464 3300025925 Bacteria 4075
191 Ga0207650_10228315 3300025925 Unclassified 1501
192 Ga0207650_10603515 3300025925 Unclassified 923
193 Ga0207650_11289853 3300025925 Unclassified 622
194 Ga0207659_10008260 3300025926 Bacteria 6452
195 Ga0207659_10019068 3300025926 Unclassified 4507
196 Ga0207659_10030785 3300025926 Bacteria 3669
197 Ga0207659_10167843 3300025926 Unclassified 1729
198 Ga0207659_10199442 3300025926 Bacteria 1597
199 Ga0207659_10398185 3300025926 Bacteria 1151
200 Ga0207659_10729034 3300025926 Unclassified 850
201 Ga0207664_10082919 3300025929 Unclassified 2612
202 Ga0207686_10023943 3300025934 Bacteria 3531
203 Ga0207670_10696808 3300025936 Unclassified 840
204 Ga0207669_10096479 3300025937 Bacteria 1941
205 Ga0207669_10906530 3300025937 Unclassified 737
206 Ga0207704_10626237 3300025938 Bacteria 884
207 Ga0207691_10245511 3300025940 Bacteria 1547
208 Ga0207691_10259064 3300025940 Bacteria 1499
209 Ga0207691_10708516 3300025940 Bacteria 849
210 Ga0207711_10307360 3300025941 Unclassified 1463
211 Ga0207711_10466436 3300025941 Bacteria 1176
212 Ga0207711_11852298 3300025941 Unclassified 546
213 Ga0207679_10116717 3300025945 Bacteria 2117
214 Ga0207679_10169234 3300025945 Bacteria 1797
215 Ga0207651_10014210 3300025960 Bacteria 4589
216 Ga0207651_11031615 3300025960 Bacteria 736
217 Ga0207651_11099278 3300025960 Bacteria 712
218 Ga0207651_11611629 3300025960 Bacteria 585
219 Ga0207712_10148458 3300025961 Bacteria 1808
220 Ga0207668_11652160 3300025972 Unclassified 578
221 Ga0207640_10020041 3300025981 Bacteria 3964
222 Ga0207658_10136137 3300025986 Bacteria 1981
223 Ga0207658_11981475 3300025986 Bacteria 530
224 Ga0207677_11121388 3300026023 Bacteria 718
225 Ga0207703_10180624 3300026035 Bacteria 1862
226 Ga0207678_10027119 3300026067 Bacteria 4995
227 Ga0207708_10229529 3300026075 Bacteria 1490
228 Ga0207641_10697685 3300026088 Bacteria 999
229 Ga0207648_10146245 3300026089 Bacteria 2084
230 Ga0207648_11273540 3300026089 Bacteria 691
231 Ga0207648_11367138 3300026089 Unclassified 666
232 Ga0207676_10006254 3300026095 Bacteria 8405
233 Ga0207676_10410805 3300026095 Bacteria 1267
234 Ga0207676_10412237 3300026095 Bacteria 1265
235 Ga0207674_10265330 3300026116 Bacteria 1664
236 Ga0207674_11798550 3300026116 Unclassified 580
237 Ga0207675_100095950 3300026118 Bacteria 2791
238 Ga0207675_101497964 3300026118 Bacteria 695
239 Ga0207675_102164343 3300026118 Unclassified 572
240 Ga0207675_102399674 3300026118 Unclassified 540
241 Ga0207683_10230075 3300026121 Bacteria 1690
242 Ga0209968_1109619 3300027526 Unclassified 505
243 Ga0209982_1077535 3300027552 Unclassified 547
244 Ga0207428_10003967 3300027907 Bacteria 14197
245 Ga0207428_10110650 3300027907 Bacteria 2115
246 Ga0207428_10282238 3300027907 Unclassified 1232
247 Ga0268264_10122240 3300028381 Bacteria 2296
248 Ga0268264_10878791 3300028381 Bacteria 899
249 Ga0268264_10928246 3300028381 Unclassified 875
250 Ga0307405_10029207 3300031731 Bacteria 3221
251 Ga0307413_11229834 3300031824 Unclassified 652
252 Ga0307410_10454662 3300031852 Unclassified 1045
253 Ga0307412_11945363 3300031911 Unclassified 543
254 Ga0307416_100246332 3300032002 Unclassified 1736
255 Ga0307416_101629680 3300032002 Bacteria 750
256 Ga0307411_10330248 3300032005 Unclassified 1235
257 Ga0307415_100217997 3300032126 Unclassified 1528
258 Ga0373959_0156911 3300034820 Unclassified 579
259 Ga0373952_0290908 3300035092 Unclassified 506
260 Ga0373939_0119183 3300035114 Bacteria 929
261 Ga0373957_0166384 3300035120 Bacteria 910
262 Ga0373955_0675298 3300035172 Bacteria 634
263 Ga0373955_0940607 3300035172 Unclassified 532
264 Ga0373924_0352504 3300035410 Bacteria 656
265 Ga0373931_0047254 3300035691 Bacteria 2278
266 Ga0373935_0249031 3300035692 Bacteria 1243
267 Ga0373935_0934265 3300035692 Unclassified 643
268 Ga0373933_0620478 3300035724 Bacteria 710
269 Ga0373937_0001467 3300036401 Bacteria 19736
270 Ga0373937_0077800 3300036401 Bacteria 3065
271 Ga0373937_1483001 3300036401 Bacteria 626
272 Ga0373925_1107762 3300037068 Unclassified 651
273 Ga0395905_0307003 3300037471 Unclassified 1475
274 Ga0451800_1006017 3300041459 Unclassified 809
275 Ga0451839_1404596 3300041496 Bacteria 824
276 Ga0451851_0151491 3300041507 Unclassified 572
277 Ga0451853_0283683 3300041512 Bacteria 1762
278 Ga0439441_038324 3300042001 Unclassified 953
279 Ga0439455_0024199 3300042012 Bacteria 1468
280 Ga0439457_155682 3300042014 Unclassified 551
281 Ga0439462_0091018 3300042015 Bacteria 837
282 Ga0451576_0052983 3300045051 Unclassified 4251
283 Ga0451576_0084410 3300045051 Bacteria 3303
284 Ga0451576_0451062 3300045051 Bacteria 1350
285 Ga0451576_1173153 3300045051 Bacteria 802
286 Ga0495603_0030874 3300046455 Bacteria 3227
287 Ga0495582_0352979 3300046473 Bacteria 847
288 Ga0495639_0242988 3300046475 Bacteria 889
289 Ga0495607_0519987 3300046501 Unclassified 526
290 Ga0495608_0022963 3300046511 Bacteria 4277
291 Ga0495608_0298901 3300046511 Bacteria 997
292 Ga0495630_0373967 3300046517 Bacteria 1091
293 Ga0495665_0084978 3300046531 Bacteria 1663
294 Ga0495598_0187361 3300046537 Bacteria 741
295 Ga0495598_0334203 3300046537 Unclassified 580
296 Ga0495645_0208286 3300046543 Bacteria 1322
297 Ga0495656_0641274 3300046615 Unclassified 570
298 Ga0495634_0154134 3300046642 Bacteria 1451
299 Ga0495635_0435966 3300046663 Bacteria 867
300 Ga0495659_0007763 3300046664 Bacteria 3402
301 Ga0495659_0017227 3300046664 Unclassified 2391
302 Ga0495588_0023120 3300046674 Bacteria 3075
303 Ga0495588_0700432 3300046674 Bacteria 530
304 Ga0495658_0123167 3300046683 Bacteria 1570
305 Ga0495658_0344491 3300046683 Bacteria 947
306 Ga0495613_0169922 3300046689 Bacteria 1548
307 Ga0495670_0204373 3300046691 Bacteria 1047
308 Ga0495670_0616729 3300046691 Unclassified 591
309 Ga0495600_0214014 3300046809 Bacteria 1234
310 Ga0495581_0394102 3300047315 Bacteria 808
311 Ga0495604_0820585 3300047317 Bacteria 585
312 Ga0495674_0044103 3300047319 Bacteria 3966
313 Ga0495674_0509019 3300047319 Unclassified 962
314 Ga0495674_0751213 3300047319 Bacteria 762
315 Ga0495680_0088172 3300047322 Bacteria 2332
316 Ga0495677_0277649 3300047445 Bacteria 657
317 Ga0495684_0266902 3300047471 Bacteria 1240
318 Ga0495593_0210224 3300047673 Bacteria 977
319 Ga0496100_0115755 3300048903 Bacteria 1870
320 Ga0496102_0199224 3300048905 Bacteria 1887
321 Ga0496105_0405339 3300048908 Unclassified 1082
322 Ga0496106_0071290 3300048909 Bacteria 2656
323 Ga0496112_0026103 3300048915 Bacteria 5617
324 Ga0501283_078540 3300049779 Unclassified 618
325 nmdc:mga03n38_940005_c1 3300050490 Bacteria 510
326 nmdc:mga00v17_59596_c1 3300050491 Bacteria 2343
327 nmdc:mga0k408_128970_c1 3300050493 Bacteria 1501
328 nmdc:mga0k408_675023_c1 3300050493 Unclassified 606
329 nmdc:mga06z11_37084_c1 3300050494 Bacteria 2412
330 nmdc:mga07m45_9976_c1 3300050496 Bacteria 4944
331 nmdc:mga05p37_17516_c1 3300050507 Bacteria 8648
332 nmdc:mga05p37_288354_c2 3300050507 Unclassified 1656
333 nmdc:mga05p37_362268_c1 3300050507 Bacteria 1704
334 nmdc:mga05p37_393558_c1 3300050507 Bacteria 1620
335 nmdc:mga05p37_408111_c1 3300050507 Bacteria 1584
336 nmdc:mga05p37_629688_c1 3300050507 Bacteria 1206
337 nmdc:mga09592_1684939_c1 3300050508 Bacteria 512
338 nmdc:mga09592_23498_c2 3300050508 Bacteria 3346
339 nmdc:mga09592_277851_c1 3300050508 Bacteria 1452
340 nmdc:mga09592_333149_c1 3300050508 Bacteria 1314
341 nmdc:mga0qj67_3359_c1 3300050509 Bacteria 11541
342 nmdc:mga0qj67_353542_c1 3300050509 Bacteria 1188
343 nmdc:mga0qj67_417648_c1 3300050509 Bacteria 1082
344 nmdc:mga0qj67_748257_c1 3300050509 Unclassified 776
345 nmdc:mga06r32_4584_c1 3300050510 Bacteria 12393
346 nmdc:mga08y16_101033_c1 3300050511 Bacteria 3003
347 nmdc:mga08y16_105_c1 3300050511 Bacteria 70187
348 nmdc:mga08y16_289438_c1 3300050511 Bacteria 1689
349 nmdc:mga08y16_308818_c1 3300050511 Bacteria 1629
350 nmdc:mga08y16_413195_c1 3300050511 Unclassified 1380
351 nmdc:mga0n895_1131239_c1 3300050512 Bacteria 759
352 nmdc:mga0n895_148741_c1 3300050512 Bacteria 2371
353 nmdc:mga0n895_16299_c1 3300050512 Bacteria 6815
354 nmdc:mga0n895_348050_c1 3300050512 Bacteria 1501
355 nmdc:mga0n895_468546_c1 3300050512 Unclassified 1271
356 nmdc:mga0n895_681815_c1 3300050512 Bacteria 1025
357 nmdc:mga0rr50_197689_c1 3300050513 Unclassified 1651
358 nmdc:mga0rr50_494445_c1 3300050513 Bacteria 1040
359 nmdc:mga0a205_405925_c1 3300050515 Bacteria 1226
360 nmdc:mga0a205_50702_c1 3300050515 Bacteria 4007
361 Ga0495595_0386542 3300053084 Bacteria 708
362 Ga0495619_0028640 3300053085 Bacteria 3594
363 Ga0209984_1070375
364 Ga0065712_10078140
365 Ga0065712_10726982
366 Ga0065715_10168139
367 Ga0065715_11191103
368 Ga0065707_10002731
369 Ga0065707_10167163
370 Ga0065707_10450699
371 Ga0070690_100033858
372 Ga0070690_100169587
373 Ga0070670_100006499
374 Ga0070670_100020095
375 Ga0070670_100143349
376 Ga0070670_101568131
377 Ga0070670_101711769
378 Ga0070677_10041183
379 Ga0068869_100485068
380 Ga0070666_10084854
381 Ga0070666_11188965
382 Ga0070689_100866346
383 Ga0070687_100041671
384 Ga0070661_100148081
385 Ga0070661_101202485
386 Ga0070669_100066009
387 Ga0070669_100080461
388 Ga0070669_100306449
389 Ga0070669_101447582
390 Ga0070675_100000983
391 Ga0070675_100002099
392 Ga0070675_100017654
393 Ga0070675_100134330
394 Ga0070675_100181319
395 Ga0070675_100334390
396 Ga0070675_100439261
397 Ga0070675_100981081
398 Ga0070671_101024078
399 Ga0070674_100316997
400 Ga0070674_100540755
401 Ga0070674_100630839
402 Ga0070674_102097454
403 Ga0070673_100006532
404 Ga0070673_100368211
405 Ga0070688_100776558
406 Ga0070688_100794485
407 Ga0070659_100177855
408 Ga0070659_100366500
409 Ga0070667_100117130
410 Ga0070667_102066822
411 Ga0070703_10518974
412 Ga0070701_10147917
413 Ga0070700_100449946
414 Ga0068867_100223007
415 Ga0070685_10652359
416 Ga0070698_100976411
417 Ga0070679_100646475
418 Ga0070684_100060262
419 Ga0070672_100251216
420 Ga0070672_100473722
421 Ga0070672_100659173
422 Ga0070672_100812811
423 Ga0070672_100840884
424 Ga0070686_100051220
425 Ga0070686_100160556
426 Ga0070693_101096925
427 Ga0068855_100420885
428 Ga0070664_100180400
429 Ga0070664_100181114
430 Ga0070664_100457123
431 Ga0068857_100387467
432 Ga0068857_101847146
433 Ga0068854_100028274
434 Ga0070702_100889560
435 Ga0068859_100033881
436 Ga0068859_100057603
437 Ga0068864_100020396
438 Ga0068864_100079124
439 Ga0068864_100878193
440 Ga0068861_100280035
441 Ga0068861_100670815
442 Ga0068861_101277181
443 Ga0068870_10005002
444 Ga0068870_10255655
445 Ga0068863_100797862
446 Ga0068858_100401861
447 Ga0068858_101145575
448 Ga0068860_100129746
449 Ga0068860_102799922
450 Ga0068862_100409736
451 Ga0068862_100711161
452 Ga0068862_102406492
453 Ga0068862_102567828
454 Ga0075365_10143266
455 Ga0075364_10060343
456 Ga0075432_10265927
457 Ga0075367_10039764
458 Ga0075367_10072331
459 Ga0075427_10090577
460 Ga0075366_10048405
461 Ga0097621_100065914
462 Ga0097621_100387184
463 Ga0097621_100453208
464 Ga0075370_10021904
465 Ga0068871_102140881
466 Ga0075428_100035002
467 Ga0075428_100125245
468 Ga0075428_100482654
469 Ga0075428_100778519
470 Ga0075430_100025556
471 Ga0075430_100178151
472 Ga0075430_100495315
473 Ga0075431_100004680
474 Ga0075431_100435653
475 Ga0075433_10045544
476 Ga0075434_100093924
477 Ga0075434_100205533
478 Ga0075434_100244635
479 Ga0075434_100339345
480 Ga0075434_100611704
481 Ga0075434_101063747
482 Ga0075429_100019281
483 Ga0075429_100303171
484 Ga0075429_101313193
485 Ga0068865_100324169
486 Ga0068865_101731603
487 Ga0097620_100033881
488 Ga0097620_100057604
489 Ga0075435_100485136
490 Ga0075435_100755965
491 Ga0075435_101328538
492 Ga0105240_10257812
493 Ga0111539_10019783
494 Ga0111539_10093560
495 Ga0111539_10099152
496 Ga0111539_10171842
497 Ga0111539_10220704
498 Ga0105245_12744768
499 Ga0105247_10881672
500 Ga0114129_10020454
501 Ga0114129_10331330
502 Ga0114129_10427497
503 Ga0114129_10697744
504 Ga0114129_10715318
505 Ga0105241_10015762
506 Ga0105241_11829769
507 Ga0105242_10669836
508 Ga0105242_11891460
509 Ga0105248_10548885
510 Ga0105248_10966012
511 Ga0105248_11345990
512 Ga0105248_12548086
513 Ga0105249_10504185
514 Ga0105249_10807119
515 Ga0105249_11199719
516 Ga0105249_11301361
517 Ga0105249_13542241
518 Ga0105246_10745057
519 Ga0157329_1035555
520 Ga0157327_1053633
521 Ga0157374_10443210
522 Ga0163162_10729519
523 Ga0163162_11547450
524 Ga0163162_12878133
525 Ga0157375_10406317
526 Ga0163163_10016474
527 Ga0163163_10020414
528 Ga0163163_10406709
529 Ga0157380_10039478
530 Ga0157380_10045976
531 Ga0157380_10453359
532 Ga0157377_10098236
533 Ga0157377_10658080
534 Ga0157379_10918263
535 Ga0157376_12332230
536 Ga0207653_10019787
537 Ga0207682_10259267
538 Ga0207680_10268166
539 Ga0207680_11221428
540 Ga0207643_10180453
541 Ga0207643_10518140
542 Ga0207654_10039220
543 Ga0207662_10013167
544 Ga0207662_10465571
545 Ga0207649_11593228
546 Ga0207681_10122310
547 Ga0207681_10282954
548 Ga0207681_10337339
549 Ga0207681_10961129
550 Ga0207681_11068621
551 Ga0207681_11245830
552 Ga0207650_10027464
553 Ga0207650_10228315
554 Ga0207650_10603515
555 Ga0207650_11289853
556 Ga0207659_10008260
557 Ga0207659_10019068
558 Ga0207659_10030785
559 Ga0207659_10167843
560 Ga0207659_10199442
561 Ga0207659_10398185
562 Ga0207659_10729034
563 Ga0207664_10082919
564 Ga0207686_10023943
565 Ga0207670_10696808
566 Ga0207669_10096479
567 Ga0207669_10906530
568 Ga0207704_10626237
569 Ga0207691_10245511
570 Ga0207691_10259064
571 Ga0207691_10708516
572 Ga0207711_10307360
573 Ga0207711_10466436
574 Ga0207711_11852298
575 Ga0207679_10116717
576 Ga0207679_10169234
577 Ga0207651_10014210
578 Ga0207651_11031615
579 Ga0207651_11099278
580 Ga0207651_11611629
581 Ga0207712_10148458
582 Ga0207668_11652160
583 Ga0207640_10020041
584 Ga0207658_10136137
585 Ga0207658_11981475
586 Ga0207677_11121388
587 Ga0207703_10180624
588 Ga0207678_10027119
589 Ga0207708_10229529
590 Ga0207641_10697685
591 Ga0207648_10146245
592 Ga0207648_11273540
593 Ga0207648_11367138
594 Ga0207676_10006254
595 Ga0207676_10410805
596 Ga0207676_10412237
597 Ga0207674_10265330
598 Ga0207674_11798550
599 Ga0207675_100095950
600 Ga0207675_101497964
601 Ga0207675_102164343
602 Ga0207675_102399674
603 Ga0207683_10230075
604 Ga0209968_1109619
605 Ga0209982_1077535
606 Ga0207428_10003967
607 Ga0207428_10110650
608 Ga0207428_10282238
609 Ga0268264_10122240
610 Ga0268264_10878791
611 Ga0268264_10928246
612 Ga0307405_10029207
613 Ga0307413_11229834
614 Ga0307410_10454662
615 Ga0307412_11945363
616 Ga0307416_100246332
617 Ga0307416_101629680
618 Ga0307411_10330248
619 Ga0307415_100217997
620 Ga0373959_0156911
621 Ga0373952_0290908
622 Ga0373939_0119183
623 Ga0373957_0166384
624 Ga0373955_0675298
625 Ga0373955_0940607
626 Ga0373924_0352504
627 Ga0373931_0047254
628 Ga0373935_0249031
629 Ga0373935_0934265
630 Ga0373933_0620478
631 Ga0373937_0001467
632 Ga0373937_0077800
633 Ga0373937_1483001
634 Ga0373925_1107762
635 Ga0395905_0307003
636 Ga0451800_1006017
637 Ga0451839_1404596
638 Ga0451851_0151491
639 Ga0451853_0283683
640 Ga0439441_038324
641 Ga0439455_0024199
642 Ga0439457_155682
643 Ga0439462_0091018
644 Ga0451576_0052983
645 Ga0451576_0084410
646 Ga0451576_0451062
647 Ga0451576_1173153
648 Ga0495603_0030874
649 Ga0495582_0352979
650 Ga0495639_0242988
651 Ga0495607_0519987
652 Ga0495608_0022963
653 Ga0495608_0298901
654 Ga0495630_0373967
655 Ga0495665_0084978
656 Ga0495598_0187361
657 Ga0495598_0334203
658 Ga0495645_0208286
659 Ga0495656_0641274
660 Ga0495634_0154134
661 Ga0495635_0435966
662 Ga0495659_0007763
663 Ga0495659_0017227
664 Ga0495588_0023120
665 Ga0495588_0700432
666 Ga0495658_0123167
667 Ga0495658_0344491
668 Ga0495613_0169922
669 Ga0495670_0204373
670 Ga0495670_0616729
671 Ga0495600_0214014
672 Ga0495581_0394102
673 Ga0495604_0820585
674 Ga0495674_0044103
675 Ga0495674_0509019
676 Ga0495674_0751213
677 Ga0495680_0088172
678 Ga0495677_0277649
679 Ga0495684_0266902
680 Ga0495593_0210224
681 Ga0496100_0115755
682 Ga0496102_0199224
683 Ga0496105_0405339
684 Ga0496106_0071290
685 Ga0496112_0026103
686 Ga0501283_078540
687 nmdc:mga03n38_940005_c1
688 nmdc:mga00v17_59596_c1
689 nmdc:mga0k408_128970_c1
690 nmdc:mga0k408_675023_c1
691 nmdc:mga06z11_37084_c1
692 nmdc:mga07m45_9976_c1
693 nmdc:mga05p37_17516_c1
694 nmdc:mga05p37_288354_c2
695 nmdc:mga05p37_362268_c1
696 nmdc:mga05p37_393558_c1
697 nmdc:mga05p37_408111_c1
698 nmdc:mga05p37_629688_c1
699 nmdc:mga09592_1684939_c1
700 nmdc:mga09592_23498_c2
701 nmdc:mga09592_277851_c1
702 nmdc:mga09592_333149_c1
703 nmdc:mga0qj67_3359_c1
704 nmdc:mga0qj67_353542_c1
705 nmdc:mga0qj67_417648_c1
706 nmdc:mga0qj67_748257_c1
707 nmdc:mga06r32_4584_c1
708 nmdc:mga08y16_101033_c1
709 nmdc:mga08y16_105_c1
710 nmdc:mga08y16_289438_c1
711 nmdc:mga08y16_308818_c1
712 nmdc:mga08y16_413195_c1
713 nmdc:mga0n895_1131239_c1
714 nmdc:mga0n895_148741_c1
715 nmdc:mga0n895_16299_c1
716 nmdc:mga0n895_348050_c1
717 nmdc:mga0n895_468546_c1
718 nmdc:mga0n895_681815_c1
719 nmdc:mga0rr50_197689_c1
720 nmdc:mga0rr50_494445_c1
721 nmdc:mga0a205_405925_c1
722 nmdc:mga0a205_50702_c1
723 Ga0495595_0386542
724 Ga0495619_0028640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kzt-assembly1.cif.gz_B crystal structure of protein of unknown function (np_812423.1) from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution 0.7355 9 44
5f7t-assembly4.cif.gz_L trim5 b-box2 and coiled-coil chimera 0.7305 10 43
3nyn-assembly1.cif.gz_A crystal structure of g protein-coupled receptor kinase 6 in complex with sangivamycin 0.6728 10 61
7q4o-assembly1.cif.gz_C substrate-bound a-like u2 snrnp 0.6526 8 42
3nyn-assembly1.cif.gz_A crystal structure of g protein-coupled receptor kinase 6 in complex with sangivamycin 0.5594 10 61
ID Description Score Start End Superfamily
af_Q4CVD2_1_111_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.9364 10 42 1.20.58.400
af_Q9Y125_433_513_1.10.225.10 Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like 0.9012 16 43 1.10.225.10
af_A0A0R0JJD6_1_101_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.8726 17 43 3.40.1110.10
af_Q9LI83_570_699_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.872 17 43 3.40.1110.10
af_Q54PT7_27_112_1.10.225.10 Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like 0.8655 16 43 1.10.225.10
ID Description Score Start End GO Terms
AF-A0A4P9XUS5-F1-model_v4 Uncharacterized protein 0.8401 13 46
AF-A0A536ZME5-F1-model_v4 Uncharacterized protein 0.8348 16 50 GO:0016020
AF-A0A4Q6GGV6-F1-model_v4 DUF4124 domain-containing protein 0.8103 1 46
AF-A0A349L5Y0-F1-model_v4 UrcA family protein 0.809 1 46
AF-A0A402D503-F1-model_v4 Uncharacterized protein 0.7899 1 46

Map