F422569

General Info

Members Datasets Scaffolds Average Seq Length
362 270 724 349

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10004632|Ga0105251_100046325
Length 389
Sequence MMKMKAAVMTGVNAPLEILAVDLATPKANEVLVKIEATGVCHSDLNALEDSSTPTPTILGHEGAGIVTAVGLNVKTVKVGDKVALSWVPYCGTCEFCVTGSVHLCDSAFGPMFNGTLLDGTSRLSKDGELVFHNSLLSTFAEYAVVPEMSCIKLPDEMPMAQASLIGCGVATGYGAAVNAAKVTPGSTVAVFGIGGVGVNAIQGARIAGASKIIACDVKPANLELAKKFGATHTINVASEEASEALKALTGGHGVHFAIDCTGHTKATESAWEGTRKGGTVVVVGAFNPSMSINLPGGGFHRVGKVLKGSFYGDTQPFRDFPKIAQLYLDGKFMLDELILGRMQLDDINEAFQSFHDCNCVNVGRSVIEFPSIVSQASLENGDEFDIVS

Samples

Sample ID Description Type Environment
1 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
4 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
36 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
39 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
40 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
56 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
60 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
61 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
62 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
65 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
66 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
67 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
72 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
75 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
76 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
77 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
78 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
79 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
80 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
81 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
82 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
83 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
84 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
109 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
113 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
114 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
115 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
120 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
124 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
125 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
153 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
154 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
188 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
189 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
190 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
191 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
192 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
193 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
194 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
197 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
198 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 2508501039 Frankia saprophytica CN3 Isolate Nodule
201 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
202 2517572101 Frankia sp. DC12 Isolate Nodule
203 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
204 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
205 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
206 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
207 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
208 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
209 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
210 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
211 2643221647 Streptomyces sp. Root369 Isolate Unclassified
212 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
213 2671180195 Frankia sp. CcI49 Isolate Nodule
214 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
215 2687453737 Frankia sp. BMG5.36 Isolate Nodule
216 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
217 2773857922 Frankia sp. CcI49 Isolate Nodule
218 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
219 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
220 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
221 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
222 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
223 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
224 2808606448 Streptomyces sp. 193411 Isolate Unclassified
225 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
226 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
227 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
228 2842682962 Bacillus sp. R-72492 Isolate Unclassified
229 2849560528 Caulobacter zeae 410 Isolate Unclassified
230 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
231 2857581216 Bacillus sp. R-71922 Isolate Unclassified
232 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
233 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
234 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
235 2862574272 Streptomyces sp. AcE210 Isolate Nodule
236 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
237 2867428634 Streptomyces sp. RP5T Isolate Unclassified
238 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
239 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
240 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
241 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
242 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
243 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
244 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
245 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
246 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
247 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
248 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
249 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
250 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
251 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
252 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
253 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
254 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
255 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
256 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
257 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
258 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
259 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
260 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
261 8002775197 Frankia nepalensis CN7 Isolate Nodule
262 8002784119 Frankia sp. AgB1.9 Isolate Nodule
263 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
264 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
265 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
266 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
267 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
268 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
269 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
270 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.83
Metatranscriptomes 0.55
Isolates 19.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.08
Nodule 3.59
Rhizoplane 1.38
Rhizosphere 74.59
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105251_10004632 3300009011 Bacteria 9273
2 Ga0006562J51391_1056918 3300003578 Bacteria 2061
3 Ga0006562J51391_1156720 3300003578 Bacteria 2000
4 Ga0055532_1000030 3300003758 Bacteria 232738
5 Ga0055541_1005841 3300003841 Bacteria 2130
6 Ga0070709_10001550 3300005434 Bacteria 12410
7 Ga0070714_100038465 3300005435 Bacteria 4021
8 Ga0070713_100057560 3300005436 Bacteria 3238
9 Ga0070708_100028491 3300005445 Bacteria 4806
10 Ga0070708_100131246 3300005445 Bacteria 2319
11 Ga0070698_100106100 3300005471 Bacteria 2778
12 Ga0070697_100098954 3300005536 Bacteria 2421
13 Ga0068853_100225153 3300005539 Bacteria 1714
14 Ga0070665_100002131 3300005548 Bacteria 22096
15 Ga0068855_100415286 3300005563 Bacteria 1473
16 Ga0068856_100518068 3300005614 Bacteria 1214
17 Ga0068859_100004614 3300005617 Bacteria 14046
18 Ga0068864_100000568 3300005618 Bacteria 31384
19 Ga0068863_100000315 3300005841 Bacteria 49095
20 Ga0068858_100002762 3300005842 Bacteria 17640
21 Ga0068858_100021042 3300005842 Bacteria 6093
22 Ga0081455_10055650 3300005937 Bacteria 3364
23 Ga0081455_10166163 3300005937 Bacteria 1686
24 Ga0081539_10000044 3300005985 Bacteria 284021
25 Ga0075367_10005885 3300006178 Bacteria 6148
26 Ga0075428_100174797 3300006844 Bacteria 2326
27 Ga0075430_100063708 3300006846 Bacteria 3096
28 Ga0075431_100244237 3300006847 Bacteria 1825
29 Ga0075433_10002409 3300006852 Bacteria 14226
30 Ga0075436_100112547 3300006914 Bacteria 1901
31 Ga0097620_100004614 3300006931 Bacteria 14046
32 Ga0099826_10051332 3300006948 Bacteria 2765
33 Ga0099794_10029948 3300007265 Bacteria 2538
34 Ga0105248_10023864 3300009177 Bacteria 6797
35 Ga0105246_10068173 3300011119 Bacteria 2494
36 Ga0163162_10049883 3300013306 Bacteria 4196
37 Ga0182008_10001517 3300014497 Bacteria 15502
38 Ga0157379_10300204 3300014968 Unclassified 1463
39 Ga0183367_1010 3300015688 Bacteria 416164
40 Ga0209566_101349 3300025225 Bacteria 7762
41 Ga0209147_100065 3300025229 Bacteria 232777
42 Ga0209758_1005153 3300025297 Bacteria 10293
43 Ga0207426_1014523 3300025302 Bacteria 2883
44 Ga0207697_10003827 3300025315 Bacteria 7347
45 Ga0207713_1009214 3300025735 Bacteria 5591
46 Ga0207647_10054158 3300025904 Bacteria 2469
47 Ga0207684_10013589 3300025910 Bacteria 7037
48 Ga0207711_10141231 3300025941 Bacteria 2167
49 Ga0207667_10185766 3300025949 Bacteria 2134
50 Ga0207712_10153866 3300025961 Bacteria 1779
51 Ga0207677_10058750 3300026023 Bacteria 2650
52 Ga0207703_10000530 3300026035 Bacteria 39281
53 Ga0207703_10340007 3300026035 Bacteria 1379
54 Ga0207639_10195555 3300026041 Bacteria 1731
55 Ga0207641_10003754 3300026088 Bacteria 13345
56 Ga0207676_10000141 3300026095 Bacteria 62869
57 Ga0268266_10003017 3300028379 Bacteria 17300
58 Ga0307517_10003570 3300028786 Bacteria 24142
59 Ga0307515_10001087 3300028794 Bacteria 62233
60 Ga0307511_10000282 3300030521 Bacteria 53455
61 Ga0307512_10001647 3300030522 Bacteria 30894
62 Ga0307513_10034746 3300031456 Bacteria 5651
63 Ga0307509_10003517 3300031507 Bacteria 23625
64 Ga0307509_10036192 3300031507 Bacteria 5409
65 Ga0307509_10109868 3300031507 Bacteria 2765
66 Ga0307508_10094387 3300031616 Bacteria 2582
67 Ga0307508_10106317 3300031616 Bacteria 2404
68 Ga0307514_10003731 3300031649 Bacteria 14372
69 Ga0307516_10000121 3300031730 Bacteria 91748
70 Ga0307516_10021330 3300031730 Bacteria 6670
71 Ga0307518_10032332 3300031838 Bacteria 3793
72 Ga0307518_10070426 3300031838 Bacteria 2533
73 Ga0307411_10148984 3300032005 Bacteria 1737
74 Ga0307507_10008521 3300033179 Bacteria 14130
75 Ga0307507_10019733 3300033179 Bacteria 7582
76 Ga0307510_10051799 3300033180 Bacteria 4337
77 Ga0307510_10052773 3300033180 Bacteria 4280
78 Ga0373934_0010837 3300035086 Bacteria 3425
79 Ga0373936_0003820 3300035113 Bacteria 5671
80 Ga0316574_0112838 3300035398 Bacteria 1743
81 Ga0373947_0016771 3300035725 Bacteria 4209
82 Ga0395898_0070307 3300037466 Bacteria 3384
83 Ga0436360_0360402 3300039438 Bacteria 1284
84 Ga0439436_0000159 3300041404 Bacteria 15810
85 Ga0439436_0016164 3300041404 Bacteria 2242
86 Ga0451853_0443629 3300041512 Bacteria 2375
87 Ga0439433_0000456 3300041999 Bacteria 7537
88 Ga0439442_004266 3300042002 Bacteria 2836
89 Ga0439448_0006502 3300042005 Bacteria 3365
90 Ga0439449_0004532 3300042007 Bacteria 5367
91 Ga0439457_002552 3300042014 Bacteria 5163
92 Ga0439457_028030 3300042014 Bacteria 1246
93 Ga0450894_001024 3300042131 Bacteria 4279
94 Ga0450898_003699 3300042134 Bacteria 2211
95 Ga0450899_004987 3300042135 Bacteria 1423
96 Ga0450903_000750 3300042138 Bacteria 6374
97 Ga0450906_001600 3300042145 Bacteria 4957
98 Ga0450908_022090 3300042184 Bacteria 1115
99 Ga0466969_0054601 3300044656 Bacteria 1956
100 Ga0466972_0000495 3300044658 Bacteria 19814
101 Ga0466972_0001897 3300044658 Bacteria 10264
102 Ga0466972_0008665 3300044658 Bacteria 5101
103 Ga0466972_0043965 3300044658 Bacteria 2168
104 Ga0466965_0021874 3300044683 Bacteria 3081
105 Ga0466966_0000145 3300044684 Bacteria 45112
106 Ga0466961_0000775 3300044693 Bacteria 20042
107 Ga0466963_0000450 3300044694 Bacteria 19035
108 Ga0466964_0012213 3300044706 Bacteria 3249
109 Ga0466971_0010760 3300044719 Bacteria 4002
110 Ga0466971_0045202 3300044719 Bacteria 1978
111 Ga0466970_0000074 3300044765 Bacteria 40311
112 Ga0466970_0010302 3300044765 Bacteria 4743
113 Ga0466957_0004868 3300044842 Bacteria 7517
114 Ga0466959_0002100 3300045049 Bacteria 12603
115 Ga0466958_0006909 3300045836 Bacteria 6207
116 Ga0466967_0002290 3300045976 Bacteria 11819
117 Ga0466967_0024278 3300045976 Bacteria 4982
118 Ga0466967_0141094 3300045976 Bacteria 2244
119 Ga0495592_0180841 3300046454 Bacteria 1436
120 Ga0495603_0000249 3300046455 Bacteria 28144
121 Ga0495603_0001110 3300046455 Bacteria 15639
122 Ga0495603_0020680 3300046455 Bacteria 3986
123 Ga0495603_0066339 3300046455 Bacteria 2125
124 Ga0495629_0000979 3300046459 Bacteria 22914
125 Ga0495629_0001794 3300046459 Bacteria 16817
126 Ga0495629_0005290 3300046459 Bacteria 9647
127 Ga0495629_0017967 3300046459 Bacteria 5069
128 Ga0495629_0033668 3300046459 Bacteria 3623
129 Ga0495629_0180202 3300046459 Bacteria 1464
130 Ga0495629_0341889 3300046459 Bacteria 1021
131 Ga0495651_0013414 3300046462 Bacteria 6336
132 Ga0495651_0022199 3300046462 Bacteria 4934
133 Ga0495650_0000007 3300046471 Bacteria 718072
134 Ga0495580_0094032 3300046472 Bacteria 2086
135 Ga0495605_0080068 3300046474 Bacteria 1529
136 Ga0495662_0008571 3300046476 Bacteria 5024
137 Ga0495662_0022890 3300046476 Bacteria 3015
138 Ga0495664_0000499 3300046477 Bacteria 19552
139 Ga0495594_0000261 3300046499 Bacteria 25780
140 Ga0495594_0021472 3300046499 Bacteria 3446
141 Ga0495596_0065878 3300046500 Bacteria 1409
142 Ga0495583_0000209 3300046506 Bacteria 98671
143 Ga0495583_0009067 3300046506 Bacteria 5992
144 Ga0495583_0100949 3300046506 Bacteria 1231
145 Ga0495606_0046376 3300046507 Bacteria 2873
146 Ga0495608_0093326 3300046511 Bacteria 1944
147 Ga0495610_0000195 3300046512 Bacteria 67472
148 Ga0495616_0006587 3300046513 Bacteria 7016
149 Ga0495616_0029123 3300046513 Bacteria 2918
150 Ga0495618_0218953 3300046514 Bacteria 1201
151 Ga0495620_0065547 3300046515 Bacteria 1498
152 Ga0495628_0197811 3300046516 Bacteria 1515
153 Ga0495630_0189240 3300046517 Bacteria 1570
154 Ga0495631_0001091 3300046518 Bacteria 16857
155 Ga0495631_0058783 3300046518 Bacteria 1671
156 Ga0495632_0140678 3300046519 Bacteria 1120
157 Ga0495637_0004564 3300046520 Bacteria 7158
158 Ga0495637_0126042 3300046520 Bacteria 981
159 Ga0495643_0007600 3300046522 Bacteria 6968
160 Ga0495643_0009512 3300046522 Bacteria 6039
161 Ga0495648_0036377 3300046524 Bacteria 3178
162 Ga0495663_0019871 3300046525 Bacteria 1925
163 Ga0495666_0019816 3300046526 Bacteria 3335
164 Ga0495642_0070096 3300046528 Bacteria 1465
165 Ga0495652_0006546 3300046529 Bacteria 10825
166 Ga0495652_0088814 3300046529 Bacteria 2532
167 Ga0495654_0000262 3300046530 Bacteria 47780
168 Ga0495654_0037541 3300046530 Bacteria 2428
169 Ga0495640_0010307 3300046533 Bacteria 7227
170 Ga0495587_0004464 3300046536 Bacteria 9213
171 Ga0495609_0072297 3300046538 Bacteria 1514
172 Ga0495633_0038560 3300046558 Bacteria 2281
173 Ga0495668_0006740 3300046616 Bacteria 7473
174 Ga0495668_0039807 3300046616 Bacteria 2623
175 Ga0495634_0001328 3300046642 Bacteria 22523
176 Ga0495625_0005004 3300046660 Bacteria 12297
177 Ga0495625_0007893 3300046660 Bacteria 9162
178 Ga0495625_0222631 3300046660 Bacteria 1236
179 Ga0495635_0002215 3300046663 Bacteria 13224
180 Ga0495588_0024399 3300046674 Bacteria 3004
181 Ga0495588_0112590 3300046674 Bacteria 1433
182 Ga0495657_0000341 3300046675 Bacteria 43007
183 Ga0495657_0002025 3300046675 Bacteria 17266
184 Ga0495657_0024300 3300046675 Bacteria 4319
185 Ga0495613_0000842 3300046689 Bacteria 23673
186 Ga0495613_0003979 3300046689 Bacteria 11060
187 Ga0495613_0007008 3300046689 Bacteria 8396
188 Ga0495613_0025548 3300046689 Bacteria 4400
189 Ga0495613_0045354 3300046689 Bacteria 3251
190 Ga0495613_0166627 3300046689 Bacteria 1565
191 Ga0495613_0254921 3300046689 Bacteria 1223
192 Ga0495671_0011658 3300046692 Bacteria 4824
193 Ga0495671_0018717 3300046692 Bacteria 3671
194 Ga0495649_0081875 3300046694 Bacteria 1725
195 Ga0495649_0137454 3300046694 Bacteria 1287
196 Ga0495589_0043735 3300046794 Bacteria 2228
197 Ga0495600_0033756 3300046809 Bacteria 3321
198 Ga0495660_0038244 3300046810 Bacteria 2668
199 Ga0495660_0055636 3300046810 Bacteria 2141
200 Ga0495604_0001874 3300047317 Bacteria 17091
201 Ga0495604_0030988 3300047317 Bacteria 4243
202 Ga0495636_0001918 3300047318 Bacteria 7958
203 Ga0495636_0007368 3300047318 Bacteria 4329
204 Ga0495636_0041937 3300047318 Bacteria 1900
205 Ga0495674_0084940 3300047319 Bacteria 2712
206 Ga0495672_0001773 3300047320 Bacteria 20748
207 Ga0495676_0001578 3300047321 Bacteria 19776
208 Ga0495676_0019906 3300047321 Bacteria 5897
209 Ga0495676_0056565 3300047321 Bacteria 3100
210 Ga0495676_0135266 3300047321 Bacteria 1773
211 Ga0495676_0189267 3300047321 Bacteria 1436
212 Ga0495680_0017017 3300047322 Bacteria 6224
213 Ga0495687_002083 3300047443 Bacteria 16813
214 Ga0495687_005840 3300047443 Bacteria 7708
215 Ga0495687_009475 3300047443 Bacteria 5436
216 Ga0495687_033582 3300047443 Bacteria 2325
217 Ga0495675_0001288 3300047444 Bacteria 15182
218 Ga0495675_0088717 3300047444 Bacteria 1942
219 Ga0495677_0067352 3300047445 Bacteria 1332
220 Ga0495685_000608 3300047447 Bacteria 10988
221 Ga0495685_003530 3300047447 Bacteria 4997
222 Ga0495685_011284 3300047447 Bacteria 3010
223 Ga0495685_028615 3300047447 Bacteria 1916
224 Ga0495685_046383 3300047447 Bacteria 1478
225 Ga0495673_0005747 3300047469 Bacteria 7436
226 Ga0495681_0000305 3300047470 Bacteria 39318
227 Ga0495681_0016541 3300047470 Bacteria 4129
228 Ga0495681_0027790 3300047470 Bacteria 2921
229 Ga0495681_0101589 3300047470 Bacteria 1256
230 Ga0495684_0023527 3300047471 Bacteria 4737
231 Ga0495684_0192932 3300047471 Bacteria 1505
232 Ga0495686_0000725 3300047472 Bacteria 44136
233 Ga0495686_0199423 3300047472 Bacteria 1149
234 Ga0495593_0000288 3300047673 Bacteria 27330
235 Ga0495593_0019676 3300047673 Bacteria 3784
236 Ga0495593_0046853 3300047673 Bacteria 2302
237 Ga0495602_0198865 3300048088 Bacteria 1531
238 Ga0495614_0000263 3300048089 Bacteria 20482
239 Ga0495614_0012232 3300048089 Bacteria 3769
240 Ga0495614_0077396 3300048089 Bacteria 1438
241 Ga0495626_0074225 3300048091 Bacteria 1522
242 Ga0496101_0062626 3300048904 Bacteria 2705
243 Ga0496102_0079778 3300048905 Bacteria 3014
244 Ga0496108_0076843 3300048911 Bacteria 2823
245 Ga0496113_0112382 3300048916 Bacteria 2122
246 Ga0496115_0145675 3300048918 Unclassified 1955
247 Ga0496116_0000155 3300048919 Bacteria 140837
248 Ga0496118_0004370 3300048921 Bacteria 16810
249 Ga0496118_0118540 3300048921 Bacteria 1733
250 Ga0496119_0001103 3300048922 Bacteria 34006
251 Ga0496120_0052167 3300048923 Bacteria 2331
252 Ga0496126_0002550 3300048929 Bacteria 24386
253 Ga0501031_0079702 3300049568 Bacteria 2134
254 Ga0501032_0120654 3300049569 Bacteria 1733
255 Ga0501033_0131697 3300049570 Bacteria 1811
256 Ga0501034_0272610 3300049571 Bacteria 1633
257 Ga0501034_0297120 3300049571 Bacteria 1552
258 Ga0501037_0156111 3300049573 Bacteria 1628
259 Ga0501038_0015332 3300049574 Bacteria 6967
260 Ga0501038_0197904 3300049574 Bacteria 1614
261 Ga0501043_0091875 3300049579 Bacteria 2386
262 Ga0501043_0432308 3300049579 Bacteria 991
263 Ga0501047_0023325 3300049581 Bacteria 5942
264 Ga0501047_0036892 3300049581 Bacteria 4724
265 Ga0501047_0051764 3300049581 Bacteria 3968
266 Ga0501047_0112276 3300049581 Bacteria 2608
267 Ga0501048_0127380 3300049582 Bacteria 1800
268 Ga0501073_0209443 3300049589 Bacteria 1347
269 Ga0501035_0017176 3300049822 Bacteria 6669
270 Ga0501044_0001242 3300049823 Bacteria 30258
271 Ga0501044_0007075 3300049823 Bacteria 12349
272 Ga0501044_0022966 3300049823 Bacteria 6639
273 Ga0501044_0032202 3300049823 Bacteria 5512
274 Ga0501044_0032758 3300049823 Bacteria 5462
275 nmdc:mga03n38_192123_c1 3300050490 Bacteria 1052
276 nmdc:mga06z11_10715_c1 3300050494 Bacteria 3919
277 nmdc:mga0qj67_18384_c2 3300050509 Bacteria 3662
278 Ga0500643_000977 3300053087 Bacteria 17684
279 Ga0500640_009432 3300053095 Bacteria 3901
280 Ga0500560_033805 3300053107 Bacteria 1564
281 Ga0500562_000732 3300053108 Bacteria 7960
282 Ga0500594_0001051 3300053118 Bacteria 5913
283 Ga0500618_000145 3300053125 Bacteria 58724
284 Ga0500564_000081 3300053138 Bacteria 24756
285 Ga0500600_0087918 3300053149 Bacteria 1665
286 Ga0500616_0011059 3300053153 Bacteria 5364
287 Ga0500616_0100628 3300053153 Bacteria 1413
288 Ga0500622_0000137 3300053156 Bacteria 77988
289 Ga0500627_0000127 3300053158 Bacteria 23450
290 Ga0500645_003085 3300053730 Bacteria 6981
291 Ga0466962_0009186 3300061719 Bacteria 4735
292 2508676208 2508501039 Bacteria 9978592
293 2511181033 2510917027 Bacteria 5287437
294 2517763476 2517572101 Bacteria 6884336
295 2523383812 2523231044 Bacteria 6434991
296 2547406749 2547132111 Bacteria 8013147
297 2554259339 2554235005 Bacteria 6457341
298 2585154899 2582581280 Bacteria 5994497
299 2585303823 2582581313 Bacteria 10042643
300 2585315500 2582581314 Bacteria 11452267
301 2616695888 2616644814 Bacteria 11555299
302 2616900557 2616644941 Bacteria 8510691
303 2644268292 2643221647 Bacteria 10741251
304 2644438455 2643221678 Bacteria 9540101
305 2671832650 2671180195 Bacteria 9757215
306 2676198658 2675902999 Bacteria 9438463
307 2689961531 2687453737 Bacteria 11203906
308 2774843236 2773857921 Bacteria 9435764
309 2774850806 2773857922 Bacteria 9757215
310 2784586955 2784132148 Bacteria 8627943
311 2785345480 2784746763 Bacteria 9783172
312 2785367401 2784746768 Bacteria 10036182
313 2786668447 2786546132 Bacteria 10419719
314 2808847905 2808606359 Bacteria 9866990
315 2808918656 2808606375 Bacteria 9466072
316 2809230519 2808606448 Bacteria 8656184
317 2812360083 2811994879 Bacteria 9313447
318 2812482147 2811994917 Bacteria 7761064
319 2819696633 2818991463 Bacteria 7948711
320 2842686963 2842682962 Bacteria 5589973
321 2849563878 2849560528 Bacteria 5393480
322 2852637940 2852635781 Bacteria 8251373
323 2857585090 2857581216 Bacteria 5522813
324 2862289388 2862281513 Bacteria 9621493
325 2862391747 2862382967 Bacteria 10317375
326 2862514184 2862507626 Bacteria 9425308
327 2862583448 2862574272 Bacteria 10567477
328 2863406744 2863404153 Bacteria 9672205
329 2867430227 2867428634 Bacteria 9590268
330 2877683151 2877676314 Bacteria 9512378
331 2891558641 2891554331 Bacteria 8812224
332 2904759578 2904755435 Bacteria 7986759
333 2912722161 2912715099 Bacteria 9460473
334 2912725883 2912723979 Bacteria 8557534
335 2919429522 2919425241 Bacteria 8055701
336 2919473662 2919468124 Bacteria 9133025
337 2946065805 2946064051 Bacteria 8957905
338 2947231591 2947224130 Bacteria 9938529
339 2954388367 2954380949 Bacteria 10050426
340 2954674723 2954673503 Bacteria 9685905
341 2954689410 2954682443 Bacteria 9862841
342 2954699182 2954691527 Bacteria 10720516
343 2954703036 2954701450 Bacteria 10834262
344 2954718134 2954711539 Bacteria 10867210
345 2954728102 2954721474 Bacteria 10456478
346 2954733704 2954731030 Bacteria 10243860
347 2954746999 2954740390 Bacteria 10229294
348 2954752588 2954749733 Bacteria 10366972
349 2954766112 2954759201 Bacteria 9358192
350 2966604172 2966598605 Bacteria 7676064
351 2990062679 2990059506 Bacteria 9321252
352 3006495263 3006493962 Bacteria 8825450
353 8002778856 8002775197 Bacteria 10728764
354 8002786270 8002784119 Bacteria 9788632
355 8008561566 8008558824 Bacteria 10610750
356 8008580525 8008574985 Bacteria 7815457
357 8022897199 8022893055 Bacteria 5300455
358 8022920220 8022914991 Bacteria 5584517
359 8023631602 8023623736 Bacteria 8593882
360 8048412086 8048406513 Bacteria 8936924
361 8056213323 8056207758 Bacteria 8639239
362 8056835468 8056829672 Bacteria 9045328
363 Ga0105251_10004632
364 Ga0006562J51391_1056918
365 Ga0006562J51391_1156720
366 Ga0055532_1000030
367 Ga0055541_1005841
368 Ga0070709_10001550
369 Ga0070714_100038465
370 Ga0070713_100057560
371 Ga0070708_100028491
372 Ga0070708_100131246
373 Ga0070698_100106100
374 Ga0070697_100098954
375 Ga0068853_100225153
376 Ga0070665_100002131
377 Ga0068855_100415286
378 Ga0068856_100518068
379 Ga0068859_100004614
380 Ga0068864_100000568
381 Ga0068863_100000315
382 Ga0068858_100002762
383 Ga0068858_100021042
384 Ga0081455_10055650
385 Ga0081455_10166163
386 Ga0081539_10000044
387 Ga0075367_10005885
388 Ga0075428_100174797
389 Ga0075430_100063708
390 Ga0075431_100244237
391 Ga0075433_10002409
392 Ga0075436_100112547
393 Ga0097620_100004614
394 Ga0099826_10051332
395 Ga0099794_10029948
396 Ga0105248_10023864
397 Ga0105246_10068173
398 Ga0163162_10049883
399 Ga0182008_10001517
400 Ga0157379_10300204
401 Ga0183367_1010
402 Ga0209566_101349
403 Ga0209147_100065
404 Ga0209758_1005153
405 Ga0207426_1014523
406 Ga0207697_10003827
407 Ga0207713_1009214
408 Ga0207647_10054158
409 Ga0207684_10013589
410 Ga0207711_10141231
411 Ga0207667_10185766
412 Ga0207712_10153866
413 Ga0207677_10058750
414 Ga0207703_10000530
415 Ga0207703_10340007
416 Ga0207639_10195555
417 Ga0207641_10003754
418 Ga0207676_10000141
419 Ga0268266_10003017
420 Ga0307517_10003570
421 Ga0307515_10001087
422 Ga0307511_10000282
423 Ga0307512_10001647
424 Ga0307513_10034746
425 Ga0307509_10003517
426 Ga0307509_10036192
427 Ga0307509_10109868
428 Ga0307508_10094387
429 Ga0307508_10106317
430 Ga0307514_10003731
431 Ga0307516_10000121
432 Ga0307516_10021330
433 Ga0307518_10032332
434 Ga0307518_10070426
435 Ga0307411_10148984
436 Ga0307507_10008521
437 Ga0307507_10019733
438 Ga0307510_10051799
439 Ga0307510_10052773
440 Ga0373934_0010837
441 Ga0373936_0003820
442 Ga0316574_0112838
443 Ga0373947_0016771
444 Ga0395898_0070307
445 Ga0436360_0360402
446 Ga0439436_0000159
447 Ga0439436_0016164
448 Ga0451853_0443629
449 Ga0439433_0000456
450 Ga0439442_004266
451 Ga0439448_0006502
452 Ga0439449_0004532
453 Ga0439457_002552
454 Ga0439457_028030
455 Ga0450894_001024
456 Ga0450898_003699
457 Ga0450899_004987
458 Ga0450903_000750
459 Ga0450906_001600
460 Ga0450908_022090
461 Ga0466969_0054601
462 Ga0466972_0000495
463 Ga0466972_0001897
464 Ga0466972_0008665
465 Ga0466972_0043965
466 Ga0466965_0021874
467 Ga0466966_0000145
468 Ga0466961_0000775
469 Ga0466963_0000450
470 Ga0466964_0012213
471 Ga0466971_0010760
472 Ga0466971_0045202
473 Ga0466970_0000074
474 Ga0466970_0010302
475 Ga0466957_0004868
476 Ga0466959_0002100
477 Ga0466958_0006909
478 Ga0466967_0002290
479 Ga0466967_0024278
480 Ga0466967_0141094
481 Ga0495592_0180841
482 Ga0495603_0000249
483 Ga0495603_0001110
484 Ga0495603_0020680
485 Ga0495603_0066339
486 Ga0495629_0000979
487 Ga0495629_0001794
488 Ga0495629_0005290
489 Ga0495629_0017967
490 Ga0495629_0033668
491 Ga0495629_0180202
492 Ga0495629_0341889
493 Ga0495651_0013414
494 Ga0495651_0022199
495 Ga0495650_0000007
496 Ga0495580_0094032
497 Ga0495605_0080068
498 Ga0495662_0008571
499 Ga0495662_0022890
500 Ga0495664_0000499
501 Ga0495594_0000261
502 Ga0495594_0021472
503 Ga0495596_0065878
504 Ga0495583_0000209
505 Ga0495583_0009067
506 Ga0495583_0100949
507 Ga0495606_0046376
508 Ga0495608_0093326
509 Ga0495610_0000195
510 Ga0495616_0006587
511 Ga0495616_0029123
512 Ga0495618_0218953
513 Ga0495620_0065547
514 Ga0495628_0197811
515 Ga0495630_0189240
516 Ga0495631_0001091
517 Ga0495631_0058783
518 Ga0495632_0140678
519 Ga0495637_0004564
520 Ga0495637_0126042
521 Ga0495643_0007600
522 Ga0495643_0009512
523 Ga0495648_0036377
524 Ga0495663_0019871
525 Ga0495666_0019816
526 Ga0495642_0070096
527 Ga0495652_0006546
528 Ga0495652_0088814
529 Ga0495654_0000262
530 Ga0495654_0037541
531 Ga0495640_0010307
532 Ga0495587_0004464
533 Ga0495609_0072297
534 Ga0495633_0038560
535 Ga0495668_0006740
536 Ga0495668_0039807
537 Ga0495634_0001328
538 Ga0495625_0005004
539 Ga0495625_0007893
540 Ga0495625_0222631
541 Ga0495635_0002215
542 Ga0495588_0024399
543 Ga0495588_0112590
544 Ga0495657_0000341
545 Ga0495657_0002025
546 Ga0495657_0024300
547 Ga0495613_0000842
548 Ga0495613_0003979
549 Ga0495613_0007008
550 Ga0495613_0025548
551 Ga0495613_0045354
552 Ga0495613_0166627
553 Ga0495613_0254921
554 Ga0495671_0011658
555 Ga0495671_0018717
556 Ga0495649_0081875
557 Ga0495649_0137454
558 Ga0495589_0043735
559 Ga0495600_0033756
560 Ga0495660_0038244
561 Ga0495660_0055636
562 Ga0495604_0001874
563 Ga0495604_0030988
564 Ga0495636_0001918
565 Ga0495636_0007368
566 Ga0495636_0041937
567 Ga0495674_0084940
568 Ga0495672_0001773
569 Ga0495676_0001578
570 Ga0495676_0019906
571 Ga0495676_0056565
572 Ga0495676_0135266
573 Ga0495676_0189267
574 Ga0495680_0017017
575 Ga0495687_002083
576 Ga0495687_005840
577 Ga0495687_009475
578 Ga0495687_033582
579 Ga0495675_0001288
580 Ga0495675_0088717
581 Ga0495677_0067352
582 Ga0495685_000608
583 Ga0495685_003530
584 Ga0495685_011284
585 Ga0495685_028615
586 Ga0495685_046383
587 Ga0495673_0005747
588 Ga0495681_0000305
589 Ga0495681_0016541
590 Ga0495681_0027790
591 Ga0495681_0101589
592 Ga0495684_0023527
593 Ga0495684_0192932
594 Ga0495686_0000725
595 Ga0495686_0199423
596 Ga0495593_0000288
597 Ga0495593_0019676
598 Ga0495593_0046853
599 Ga0495602_0198865
600 Ga0495614_0000263
601 Ga0495614_0012232
602 Ga0495614_0077396
603 Ga0495626_0074225
604 Ga0496101_0062626
605 Ga0496102_0079778
606 Ga0496108_0076843
607 Ga0496113_0112382
608 Ga0496115_0145675
609 Ga0496116_0000155
610 Ga0496118_0004370
611 Ga0496118_0118540
612 Ga0496119_0001103
613 Ga0496120_0052167
614 Ga0496126_0002550
615 Ga0501031_0079702
616 Ga0501032_0120654
617 Ga0501033_0131697
618 Ga0501034_0272610
619 Ga0501034_0297120
620 Ga0501037_0156111
621 Ga0501038_0015332
622 Ga0501038_0197904
623 Ga0501043_0091875
624 Ga0501043_0432308
625 Ga0501047_0023325
626 Ga0501047_0036892
627 Ga0501047_0051764
628 Ga0501047_0112276
629 Ga0501048_0127380
630 Ga0501073_0209443
631 Ga0501035_0017176
632 Ga0501044_0001242
633 Ga0501044_0007075
634 Ga0501044_0022966
635 Ga0501044_0032202
636 Ga0501044_0032758
637 nmdc:mga03n38_192123_c1
638 nmdc:mga06z11_10715_c1
639 nmdc:mga0qj67_18384_c2
640 Ga0500643_000977
641 Ga0500640_009432
642 Ga0500560_033805
643 Ga0500562_000732
644 Ga0500594_0001051
645 Ga0500618_000145
646 Ga0500564_000081
647 Ga0500600_0087918
648 Ga0500616_0011059
649 Ga0500616_0100628
650 Ga0500622_0000137
651 Ga0500627_0000127
652 Ga0500645_003085
653 Ga0466962_0009186
654 2508676208
655 2511181033
656 2517763476
657 2523383812
658 2547406749
659 2554259339
660 2585154899
661 2585303823
662 2585315500
663 2616695888
664 2616900557
665 2644268292
666 2644438455
667 2671832650
668 2676198658
669 2689961531
670 2774843236
671 2774850806
672 2784586955
673 2785345480
674 2785367401
675 2786668447
676 2808847905
677 2808918656
678 2809230519
679 2812360083
680 2812482147
681 2819696633
682 2842686963
683 2849563878
684 2852637940
685 2857585090
686 2862289388
687 2862391747
688 2862514184
689 2862583448
690 2863406744
691 2867430227
692 2877683151
693 2891558641
694 2904759578
695 2912722161
696 2912725883
697 2919429522
698 2919473662
699 2946065805
700 2947231591
701 2954388367
702 2954674723
703 2954689410
704 2954699182
705 2954703036
706 2954718134
707 2954728102
708 2954733704
709 2954746999
710 2954752588
711 2954766112
712 2966604172
713 2990062679
714 3006495263
715 8002778856
716 8002786270
717 8008561566
718 8008580525
719 8022897199
720 8022920220
721 8023631602
722 8048412086
723 8056213323
724 8056835468

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

196

330

0.93

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

27

156

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1p0f-assembly1.cif.gz_B crystal structure of the binary complex: nadp(h)-dependent vertebrate alcohol dehydrogenase (adh8) with the cofactor nadp 0.9016 1 324
1p0f-assembly1.cif.gz_B crystal structure of the binary complex: nadp(h)-dependent vertebrate alcohol dehydrogenase (adh8) with the cofactor nadp 0.8989 1 324
1axg-assembly2.cif.gz_D crystal structure of the val203->ala mutant of liver alcohol dehydrogenase complexed with cofactor nad and inhibitor trifluoroethanol solved to 2.5 angstrom resolution 0.8982 1 324
1axg-assembly2.cif.gz_D crystal structure of the val203->ala mutant of liver alcohol dehydrogenase complexed with cofactor nad and inhibitor trifluoroethanol solved to 2.5 angstrom resolution 0.8955 1 324
2fzw-assembly1.cif.gz_B structure of the binary complex of the e67l mutant of human glutathione-dependent formaldehyde dehydrogenase with nad(h) 0.894 1 324
ID Description Score Start End Superfamily
af_B4G1G0_229_356_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9638 138 263 3.40.50.720
af_O53533_167_304_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9598 141 267 3.90.180.10
5tnxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9509 141 267 3.40.50.720
af_B4G1G0_229_356_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9418 138 263 3.40.50.720
af_K7MH10_157_229_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9383 141 196 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A850AE59-F1-model_v4 Zinc-binding dehydrogenase 0.9683 146 324
AF-A0A6B3HDC4-F1-model_v4 Zinc-binding dehydrogenase 0.9673 144 297
AF-A0A6A0AW59-F1-model_v4 Zn-dependent alcohol dehydrogenase 0.9621 3 324 GO:0005829
GO:0008270
GO:0046294
GO:0051903
AF-A0A1B1M6T2-F1-model_v4 Alcohol dehydrogenase 0.961 3 324 GO:0005829
GO:0008270
GO:0046294
GO:0051903
AF-A0A3N6CHP5-F1-model_v4 S-(Hydroxymethyl)mycothiol dehydrogenase (EC 1.1.1.306) 0.9604 3 324 GO:0008270
GO:0050607

Map