F422482

General Info

Members Datasets Scaffolds Average Seq Length
362 241 362 194

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100203059|Ga0070680_1002030592
Length 231
Sequence LPDFWNAAHAGETYSHSWLNLNELKEALAHRNLSIDEMGKNRIEAFSDGVIAIIITIMVLELKVPHGEGIETLLPLIPVFLSYVLSFVYLGIYWNNHHHMLHTIQKVTGPMLWANLHLLFWLSLVPFATGWMGENHFAAAPSALYGVVLLMSAIAYVILQQLIIASQGPHSILKKAVRRDWKGKVSPVLYAAAIPLAFWKQWISMGLYVIVALLWLIPDRRIEHALRNAET

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
135 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
149 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
150 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
151 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
183 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
184 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
185 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
199 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
200 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
201 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
202 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
203 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
204 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
205 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
206 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
207 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
208 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
209 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
210 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
211 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
212 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
213 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
214 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
215 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
218 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
219 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
220 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
221 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
222 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
223 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
224 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
229 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
230 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
241 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 0.83
Rhizosphere 97.51
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10030720 3300003203 Bacteria 2018
2 rootH1_10261218 3300003323 Bacteria 5222
3 rootH1_10309619 3300003323 Bacteria 1341
4 JGI25405J52794_10008307 3300003911 Bacteria 1936
5 Ga0065712_10195419 3300005290 Bacteria 1130
6 Ga0065712_10258934 3300005290 Bacteria 939
7 Ga0065715_10108221 3300005293 Bacteria 2730
8 Ga0065715_10139976 3300005293 Bacteria 1869
9 Ga0065715_10206543 3300005293 Bacteria 1334
10 Ga0070676_10002433 3300005328 Bacteria 9543
11 Ga0070670_100495632 3300005331 Bacteria 1086
12 Ga0070677_10040101 3300005333 Bacteria 1841
13 Ga0068869_100014526 3300005334 Bacteria 5262
14 Ga0068869_100032233 3300005334 Bacteria 3692
15 Ga0070666_10012089 3300005335 Bacteria 5436
16 Ga0070680_100203059 3300005336 Bacteria 1672
17 Ga0068868_100002459 3300005338 Bacteria 12861
18 Ga0070689_100002177 3300005340 Bacteria 12691
19 Ga0070689_100314199 3300005340 Bacteria 1307
20 Ga0070668_100001962 3300005347 Bacteria 15016
21 Ga0070668_100322970 3300005347 Bacteria 1300
22 Ga0070669_100001502 3300005353 Bacteria 16863
23 Ga0070675_100216302 3300005354 Bacteria 1667
24 Ga0070671_100026070 3300005355 Bacteria 4802
25 Ga0070673_100001736 3300005364 Bacteria 12973
26 Ga0070667_100012621 3300005367 Bacteria 6988
27 Ga0070667_100027747 3300005367 Bacteria 4711
28 Ga0070709_10049677 3300005434 Bacteria 2624
29 Ga0070709_10070236 3300005434 Bacteria 2257
30 Ga0070714_100169646 3300005435 Bacteria 1980
31 Ga0070713_100092298 3300005436 Bacteria 2606
32 Ga0070710_10246639 3300005437 Bacteria 1146
33 Ga0070701_10727895 3300005438 Bacteria 670
34 Ga0070705_100627641 3300005440 Bacteria 835
35 Ga0070700_100397626 3300005441 Bacteria 1035
36 Ga0070694_100002674 3300005444 Bacteria 10560
37 Ga0070663_100351247 3300005455 Bacteria 1194
38 Ga0070678_100007775 3300005456 Bacteria 6377
39 Ga0070678_100018495 3300005456 Bacteria 4517
40 Ga0068867_100163003 3300005459 Bacteria 1759
41 Ga0068867_100776096 3300005459 Bacteria 852
42 Ga0070698_100620566 3300005471 Bacteria 1022
43 Ga0070699_100810892 3300005518 Bacteria 857
44 Ga0070697_100410164 3300005536 Bacteria 1176
45 Ga0070672_100005110 3300005543 Bacteria 8655
46 Ga0070665_100001099 3300005548 Bacteria 33389
47 Ga0070665_100027950 3300005548 Bacteria 5680
48 Ga0070665_100057459 3300005548 Bacteria 3900
49 Ga0070704_100672908 3300005549 Bacteria 915
50 Ga0068855_100128297 3300005563 Bacteria 2898
51 Ga0068855_101527286 3300005563 Bacteria 685
52 Ga0068856_100453051 3300005614 Bacteria 1304
53 Ga0070702_100001824 3300005615 Bacteria 8861
54 Ga0068859_100015823 3300005617 Bacteria 7579
55 Ga0068859_100017985 3300005617 Bacteria 7103
56 Ga0068859_100027311 3300005617 Bacteria 5725
57 Ga0068859_100031325 3300005617 Bacteria 5340
58 Ga0068859_100109753 3300005617 Bacteria 2820
59 Ga0068859_100155024 3300005617 Bacteria 2367
60 Ga0068859_100985196 3300005617 Bacteria 925
61 Ga0068864_100003842 3300005618 Bacteria 12376
62 Ga0068864_100011868 3300005618 Bacteria 7194
63 Ga0068866_10374711 3300005718 Bacteria 911
64 Ga0068861_100032037 3300005719 Bacteria 3867
65 Ga0068861_100671402 3300005719 Bacteria 960
66 Ga0068851_10107513 3300005834 Bacteria 1486
67 Ga0068870_10007867 3300005840 Bacteria 4767
68 Ga0068870_10123493 3300005840 Bacteria 1494
69 Ga0068870_10272887 3300005840 Bacteria 1057
70 Ga0068870_10409973 3300005840 Bacteria 884
71 Ga0068863_100024639 3300005841 Bacteria 5738
72 Ga0068863_100040046 3300005841 Bacteria 4456
73 Ga0068863_100125190 3300005841 Bacteria 2452
74 Ga0068863_100174480 3300005841 Bacteria 2063
75 Ga0068863_100205457 3300005841 Bacteria 1896
76 Ga0068863_100395217 3300005841 Bacteria 1351
77 Ga0068863_100957365 3300005841 Bacteria 858
78 Ga0068858_100026693 3300005842 Bacteria 5364
79 Ga0068858_100243481 3300005842 Bacteria 1707
80 Ga0068860_100019547 3300005843 Bacteria 6566
81 Ga0068860_100108761 3300005843 Bacteria 2650
82 Ga0068860_100373428 3300005843 Bacteria 1407
83 Ga0068862_100484191 3300005844 Bacteria 1172
84 Ga0068862_100709994 3300005844 Bacteria 975
85 Ga0081455_10000711 3300005937 Bacteria 43229
86 Ga0081455_10035076 3300005937 Bacteria 4488
87 Ga0081455_10069247 3300005937 Bacteria 2935
88 Ga0081539_10006384 3300005985 Bacteria 11342
89 Ga0070716_100223718 3300006173 Bacteria 1266
90 Ga0097621_100033108 3300006237 Bacteria 4113
91 Ga0068871_100184692 3300006358 Bacteria 1793
92 Ga0068871_100363602 3300006358 Bacteria 1282
93 Ga0068871_100668281 3300006358 Bacteria 949
94 Ga0075428_100075896 3300006844 Bacteria 3670
95 Ga0075428_100313235 3300006844 Bacteria 1687
96 Ga0075430_100091841 3300006846 Bacteria 2539
97 Ga0075430_100245791 3300006846 Bacteria 1483
98 Ga0075431_100161506 3300006847 Bacteria 2304
99 Ga0075431_100254979 3300006847 Bacteria 1782
100 Ga0075431_100340837 3300006847 Bacteria 1508
101 Ga0075433_10045465 3300006852 Bacteria 3817
102 Ga0075429_100051971 3300006880 Bacteria 3565
103 Ga0075429_100126691 3300006880 Bacteria 2233
104 Ga0075429_100468678 3300006880 Bacteria 1103
105 Ga0068865_100254457 3300006881 Bacteria 1387
106 Ga0097620_100015824 3300006931 Bacteria 7579
107 Ga0097620_100017985 3300006931 Bacteria 7103
108 Ga0097620_100027311 3300006931 Bacteria 5725
109 Ga0097620_100031324 3300006931 Bacteria 5340
110 Ga0097620_100109755 3300006931 Bacteria 2820
111 Ga0097620_100155017 3300006931 Bacteria 2367
112 Ga0097620_100985261 3300006931 Bacteria 925
113 Ga0099795_10114471 3300007788 Bacteria 1072
114 Ga0105240_10083130 3300009093 Bacteria 3930
115 Ga0111539_10003686 3300009094 Bacteria 20157
116 Ga0111539_10091848 3300009094 Bacteria 3567
117 Ga0105245_10452242 3300009098 Bacteria 1293
118 Ga0105247_10054135 3300009101 Bacteria 2476
119 Ga0105247_10092721 3300009101 Bacteria 1919
120 Ga0114129_10165981 3300009147 Bacteria 3013
121 Ga0114129_10249420 3300009147 Bacteria 2384
122 Ga0114129_10273109 3300009147 Bacteria 2261
123 Ga0105243_10573812 3300009148 Bacteria 1082
124 Ga0105241_10221838 3300009174 Bacteria 1589
125 Ga0105241_10324743 3300009174 Bacteria 1328
126 Ga0105242_10439423 3300009176 Bacteria 1227
127 Ga0105248_10026829 3300009177 Bacteria 6408
128 Ga0105248_10030586 3300009177 Bacteria 6013
129 Ga0105248_10171167 3300009177 Bacteria 2447
130 Ga0105237_10053453 3300009545 Bacteria 4051
131 Ga0105237_10780123 3300009545 Bacteria 962
132 Ga0105249_10055292 3300009553 Bacteria 3630
133 Ga0105249_10433504 3300009553 Bacteria 1350
134 Ga0105249_10552061 3300009553 Bacteria 1203
135 Ga0105246_10232309 3300011119 Bacteria 1453
136 Ga0157374_10048149 3300013296 Bacteria 3955
137 Ga0157374_10064732 3300013296 Bacteria 3432
138 Ga0163162_10890692 3300013306 Bacteria 1003
139 Ga0157372_10004475 3300013307 Bacteria 14911
140 Ga0157375_10034789 3300013308 Bacteria 4802
141 Ga0157375_10193398 3300013308 Bacteria 2189
142 Ga0157375_10210526 3300013308 Bacteria 2101
143 Ga0163163_10005138 3300014325 Bacteria 11281
144 Ga0163163_10406891 3300014325 Bacteria 1419
145 Ga0163163_10471560 3300014325 Bacteria 1316
146 Ga0182008_10013984 3300014497 Bacteria 4208
147 Ga0157377_10500139 3300014745 Bacteria 849
148 Ga0157379_10192441 3300014968 Bacteria 1843
149 Ga0157379_10532022 3300014968 Bacteria 1092
150 Ga0157379_10888823 3300014968 Bacteria 845
151 Ga0182007_10008346 3300015262 Bacteria 4261
152 Ga0163161_10003576 3300017792 Bacteria 10886
153 Ga0207697_10018869 3300025315 Bacteria 2826
154 Ga0207682_10031974 3300025893 Bacteria 2114
155 Ga0207692_10047500 3300025898 Bacteria 2156
156 Ga0207642_10304049 3300025899 Bacteria 926
157 Ga0207710_10088068 3300025900 Bacteria 1449
158 Ga0207710_10157960 3300025900 Bacteria 1103
159 Ga0207680_10061581 3300025903 Bacteria 2289
160 Ga0207699_10005747 3300025906 Bacteria 5967
161 Ga0207645_10001646 3300025907 Bacteria 18199
162 Ga0207645_10274580 3300025907 Bacteria 1118
163 Ga0207643_10022341 3300025908 Bacteria 3482
164 Ga0207643_10338368 3300025908 Bacteria 943
165 Ga0207643_10511684 3300025908 Bacteria 768
166 Ga0207707_10646190 3300025912 Bacteria 892
167 Ga0207695_10133441 3300025913 Bacteria 2438
168 Ga0207693_10091123 3300025915 Bacteria 2390
169 Ga0207660_10412656 3300025917 Bacteria 1088
170 Ga0207662_10449811 3300025918 Bacteria 880
171 Ga0207681_10014671 3300025923 Bacteria 4877
172 Ga0207650_10167970 3300025925 Bacteria 1742
173 Ga0207650_10749022 3300025925 Bacteria 827
174 Ga0207650_11074373 3300025925 Bacteria 685
175 Ga0207659_10036792 3300025926 Bacteria 3394
176 Ga0207664_10082778 3300025929 Bacteria 2615
177 Ga0207664_10298792 3300025929 Bacteria 1416
178 Ga0207644_10009966 3300025931 Bacteria 6254
179 Ga0207670_10225562 3300025936 Bacteria 1436
180 Ga0207669_10100592 3300025937 Bacteria 1910
181 Ga0207704_10002734 3300025938 Bacteria 7952
182 Ga0207704_10345368 3300025938 Bacteria 1157
183 Ga0207665_10180032 3300025939 Bacteria 1530
184 Ga0207691_10006881 3300025940 Bacteria 10970
185 Ga0207711_10038498 3300025941 Bacteria 4067
186 Ga0207711_10058129 3300025941 Bacteria 3327
187 Ga0207711_10135038 3300025941 Bacteria 2215
188 Ga0207689_10002291 3300025942 Bacteria 17922
189 Ga0207689_10053332 3300025942 Bacteria 3332
190 Ga0207667_10893135 3300025949 Bacteria 881
191 Ga0207651_10003999 3300025960 Bacteria 7331
192 Ga0207712_10045048 3300025961 Bacteria 3053
193 Ga0207668_10001330 3300025972 Bacteria 14669
194 Ga0207658_10286620 3300025986 Bacteria 1414
195 Ga0207658_10655842 3300025986 Bacteria 946
196 Ga0207677_10024441 3300026023 Bacteria 3754
197 Ga0207677_10278407 3300026023 Bacteria 1372
198 Ga0207703_10021845 3300026035 Bacteria 5010
199 Ga0207641_10008990 3300026088 Bacteria 8252
200 Ga0207641_10059225 3300026088 Bacteria 3261
201 Ga0207641_10127030 3300026088 Bacteria 2284
202 Ga0207648_10001556 3300026089 Bacteria 25265
203 Ga0207648_10021591 3300026089 Bacteria 5786
204 Ga0207648_10126893 3300026089 Bacteria 2245
205 Ga0207648_10377394 3300026089 Bacteria 1282
206 Ga0207676_10006669 3300026095 Bacteria 8163
207 Ga0207676_10053784 3300026095 Bacteria 3152
208 Ga0207676_10200072 3300026095 Bacteria 1764
209 Ga0207674_10475978 3300026116 Bacteria 1207
210 Ga0207675_100301578 3300026118 Bacteria 1560
211 Ga0207675_100312485 3300026118 Bacteria 1533
212 Ga0207683_10000250 3300026121 Bacteria 48026
213 Ga0268266_10000304 3300028379 Bacteria 78271
214 Ga0268266_10090258 3300028379 Bacteria 2685
215 Ga0268264_10009183 3300028381 Bacteria 8192
216 Ga0268264_10099791 3300028381 Bacteria 2520
217 Ga0268264_10102010 3300028381 Bacteria 2496
218 Ga0268264_10341395 3300028381 Bacteria 1423
219 Ga0268264_10786197 3300028381 Bacteria 950
220 Ga0265338_10001273 3300028800 Bacteria 41462
221 Ga0307516_10000050 3300031730 Bacteria 129848
222 Ga0307413_10088793 3300031824 Bacteria 2006
223 Ga0307410_10018917 3300031852 Bacteria 4176
224 Ga0307406_10082616 3300031901 Bacteria 2140
225 Ga0307412_10000331 3300031911 Bacteria 30068
226 Ga0307416_101580034 3300032002 Bacteria 761
227 Ga0307411_10005650 3300032005 Bacteria 6170
228 Ga0373944_0062768 3300035089 Bacteria 1195
229 Ga0373923_0064804 3300035111 Bacteria 1559
230 Ga0373953_0019890 3300035117 Bacteria 2503
231 Ga0373954_0028397 3300035118 Bacteria 2572
232 Ga0373957_0112814 3300035120 Bacteria 1096
233 Ga0373946_0298035 3300035171 Bacteria 797
234 Ga0373955_0074997 3300035172 Bacteria 1900
235 Ga0373924_0103261 3300035410 Bacteria 1227
236 Ga0373935_0106176 3300035692 Bacteria 1858
237 Ga0373933_0017064 3300035724 Bacteria 4070
238 Ga0373947_0052057 3300035725 Bacteria 2466
239 Ga0373937_0001598 3300036401 Bacteria 19047
240 Ga0373937_0005101 3300036401 Bacteria 11189
241 Ga0373925_0111697 3300037068 Bacteria 2112
242 Ga0395905_0805295 3300037471 Bacteria 842
243 Ga0439455_0099629 3300042012 Bacteria 802
244 Ga0450890_000706 3300042127 Bacteria 4884
245 Ga0450890_007635 3300042127 Bacteria 1383
246 Ga0439464_0026637 3300042439 Bacteria 1605
247 Ga0450893_0000417 3300042532 Bacteria 5984
248 Ga0450893_0055951 3300042532 Bacteria 746
249 Ga0451577_0100388 3300042876 Bacteria 2585
250 Ga0466969_0007334 3300044656 Bacteria 5861
251 Ga0466966_0448508 3300044684 Bacteria 775
252 Ga0466963_0118241 3300044694 Bacteria 1823
253 Ga0466959_0009729 3300045049 Bacteria 6847
254 Ga0495592_0240210 3300046454 Bacteria 1202
255 Ga0495651_0038050 3300046462 Bacteria 3747
256 Ga0495664_0006885 3300046477 Bacteria 6292
257 Ga0495594_0017136 3300046499 Bacteria 3824
258 Ga0495608_0029668 3300046511 Bacteria 3708
259 Ga0495608_0452236 3300046511 Bacteria 781
260 Ga0495628_0257128 3300046516 Bacteria 1302
261 Ga0495644_0009796 3300046523 Bacteria 3689
262 Ga0495652_0436926 3300046529 Bacteria 919
263 Ga0495621_0003171 3300046539 Bacteria 4504
264 Ga0495645_0036964 3300046543 Bacteria 3558
265 Ga0495633_0035652 3300046558 Bacteria 2388
266 Ga0495667_0046225 3300046559 Bacteria 2879
267 Ga0495667_0051644 3300046559 Bacteria 2711
268 Ga0495634_0217415 3300046642 Bacteria 1181
269 Ga0495599_0062522 3300046678 Bacteria 2326
270 Ga0495600_0373674 3300046809 Bacteria 890
271 Ga0495604_0836811 3300047317 Bacteria 578
272 Ga0495674_0359969 3300047319 Bacteria 1180
273 Ga0495680_0236237 3300047322 Bacteria 1300
274 Ga0495680_0253998 3300047322 Bacteria 1245
275 Ga0495680_0318422 3300047322 Bacteria 1089
276 Ga0495681_0022399 3300047470 Bacteria 3381
277 Ga0495684_0011448 3300047471 Bacteria 6852
278 Ga0495602_0004604 3300048088 Bacteria 14388
279 Ga0496109_1220111 3300048912 Bacteria 689
280 Ga0496113_0132888 3300048916 Bacteria 1954
281 Ga0496114_0522905 3300048917 Bacteria 1049
282 Ga0496126_0001692 3300048929 Bacteria 32860
283 Ga0501291_014639 3300049514 Bacteria 1176
284 Ga0501296_000639 3300049519 Bacteria 3445
285 Ga0501298_007328 3300049521 Bacteria 1827
286 Ga0501298_047080 3300049521 Bacteria 886
287 Ga0501300_033466 3300049523 Bacteria 762
288 Ga0501033_0037912 3300049570 Bacteria 3607
289 Ga0501034_0006523 3300049571 Bacteria 12543
290 Ga0501037_0008757 3300049573 Bacteria 7417
291 Ga0501038_0068690 3300049574 Bacteria 3012
292 Ga0501038_0177452 3300049574 Bacteria 1721
293 Ga0501041_0220920 3300049577 Bacteria 1189
294 Ga0501042_0851895 3300049578 Bacteria 664
295 Ga0501047_0005359 3300049581 Bacteria 12054
296 Ga0501047_0005973 3300049581 Bacteria 11442
297 Ga0501069_0143184 3300049585 Bacteria 1372
298 Ga0501072_0234526 3300049588 Bacteria 1462
299 Ga0501073_0002003 3300049589 Bacteria 15199
300 Ga0501075_0127741 3300049591 Bacteria 1936
301 Ga0501077_0145267 3300049593 Bacteria 1505
302 Ga0501198_002986 3300049649 Bacteria 2306
303 Ga0501198_034909 3300049649 Bacteria 852
304 Ga0501202_005438 3300049652 Bacteria 2256
305 Ga0501202_039121 3300049652 Bacteria 1018
306 Ga0501207_024436 3300049654 Bacteria 986
307 Ga0501209_072972 3300049656 Bacteria 979
308 Ga0501216_002916 3300049660 Bacteria 2463
309 Ga0501217_023070 3300049661 Bacteria 1480
310 Ga0501224_017859 3300049664 Bacteria 1056
311 Ga0501224_038795 3300049664 Bacteria 718
312 Ga0501227_002123 3300049665 Bacteria 4387
313 Ga0501227_016940 3300049665 Bacteria 1641
314 Ga0501230_036069 3300049667 Bacteria 941
315 Ga0501233_009659 3300049668 Bacteria 1885
316 Ga0501235_024964 3300049669 Bacteria 1336
317 Ga0501235_065558 3300049669 Bacteria 854
318 Ga0501239_004684 3300049672 Bacteria 1353
319 Ga0501247_012886 3300049677 Bacteria 1022
320 Ga0501249_013701 3300049679 Bacteria 1724
321 Ga0501249_022760 3300049679 Bacteria 1373
322 Ga0501251_027567 3300049681 Bacteria 792
323 Ga0501256_019880 3300049685 Bacteria 698
324 Ga0501259_063183 3300049688 Bacteria 778
325 Ga0501261_008279 3300049690 Bacteria 1342
326 Ga0501225_0179139 3300049705 Bacteria 661
327 Ga0501229_007897 3300049706 Bacteria 1327
328 Ga0501234_003638 3300049707 Bacteria 2424
329 Ga0501234_006620 3300049707 Bacteria 1812
330 Ga0501263_010261 3300049760 Bacteria 1147
331 Ga0501268_043571 3300049765 Bacteria 851
332 Ga0501271_018161 3300049768 Bacteria 801
333 Ga0501273_010025 3300049770 Bacteria 1159
334 Ga0501276_014527 3300049773 Bacteria 700
335 Ga0501283_007907 3300049779 Bacteria 1523
336 Ga0501035_0055944 3300049822 Bacteria 3522
337 Ga0501044_0000455 3300049823 Bacteria 49850
338 Ga0501044_0008343 3300049823 Bacteria 11355
339 Ga0501045_0333039 3300049824 Bacteria 1130
340 Ga0501204_004594 3300049850 Bacteria 1492
341 Ga0501212_003240 3300049851 Bacteria 2027
342 Ga0501212_007350 3300049851 Bacteria 1507
343 Ga0501226_004208 3300049853 Bacteria 1674
344 nmdc:mga05p37_143080_c1 3300050507 Bacteria 2929
345 nmdc:mga05p37_204159_c1 3300050507 Bacteria 2392
346 nmdc:mga05p37_30404_c1 3300050507 Bacteria 6590
347 nmdc:mga05p37_738725_c1 3300050507 Bacteria 1087
348 nmdc:mga09592_10246_c1 3300050508 Bacteria 7629
349 nmdc:mga09592_109913_c1 3300050508 Bacteria 2365
350 nmdc:mga09592_86988_c1 3300050508 Unclassified 2667
351 nmdc:mga0qj67_476548_c1 3300050509 Bacteria 1004
352 nmdc:mga06r32_383743_c1 3300050510 Bacteria 1388
353 nmdc:mga06r32_82373_c1 3300050510 Bacteria 3134
354 nmdc:mga08y16_5870_c1 3300050511 Bacteria 12864
355 nmdc:mga0a205_16883_c1 3300050515 Bacteria 6833
356 nmdc:mga0a205_245853_c1 3300050515 Bacteria 1669
357 nmdc:mga0a205_47557_c1 3300050515 Bacteria 4140
358 Ga0495601_0018330 3300053077 Bacteria 4258
359 Ga0495612_0006670 3300053078 Bacteria 4736
360 Ga0495619_0051132 3300053085 Bacteria 2730
361 Ga0500617_069191 3300053124 Bacteria 1549
362 Ga0500642_0169314 3300053130 Bacteria 1023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035171 Ga0373946_0298035 Ga0373946_0298035_20_502 154
2 3300046511 Ga0495608_0029668 Ga0495608_0029668_2515_2997 154
3 3300046809 Ga0495600_0373674 Ga0495600_0373674_20_502 154
4 3300047317 Ga0495604_0836811 Ga0495604_0836811_20_502 154
5 3300047322 Ga0495680_0318422 Ga0495680_0318422_588_1070 154
6 3300005563 Ga0068855_100128297 Ga0068855_1001282974 172
7 3300031911 Ga0307412_10000331 Ga0307412_100003319 182
8 3300042127 Ga0450890_000706 Ga0450890_000706_758_1333 182
9 3300042127 Ga0450890_007635 Ga0450890_007635_77_652 182
10 3300005440 Ga0070705_100627641 Ga0070705_1006276411 184
11 3300042532 Ga0450893_0055951 Ga0450893_0055951_147_722 184
12 3300005434 Ga0070709_10070236 Ga0070709_100702362 185
13 3300005435 Ga0070714_100169646 Ga0070714_1001696462 185
14 3300005436 Ga0070713_100092298 Ga0070713_1000922983 185
15 3300005437 Ga0070710_10246639 Ga0070710_102466391 185
16 3300025898 Ga0207692_10047500 Ga0207692_100475003 185
17 3300025915 Ga0207693_10091123 Ga0207693_100911233 185
18 3300025929 Ga0207664_10082778 Ga0207664_100827782 185
19 3300025929 Ga0207664_10298792 Ga0207664_102987922 185
20 3300035089 Ga0373944_0062768 Ga0373944_0062768_421_999 185
21 3300035111 Ga0373923_0064804 Ga0373923_0064804_43_621 185
22 3300035117 Ga0373953_0019890 Ga0373953_0019890_684_1262 185
23 3300035118 Ga0373954_0028397 Ga0373954_0028397_907_1485 185
24 3300035120 Ga0373957_0112814 Ga0373957_0112814_365_943 185
25 3300035172 Ga0373955_0074997 Ga0373955_0074997_1298_1876 185
26 3300035410 Ga0373924_0103261 Ga0373924_0103261_56_634 185
27 3300035692 Ga0373935_0106176 Ga0373935_0106176_843_1421 185
28 3300035724 Ga0373933_0017064 Ga0373933_0017064_1830_2408 185
29 3300035725 Ga0373947_0052057 Ga0373947_0052057_264_842 185
30 3300036401 Ga0373937_0001598 Ga0373937_0001598_10096_10674 185
31 3300036401 Ga0373937_0005101 Ga0373937_0005101_6027_6605 185
32 3300037068 Ga0373925_0111697 Ga0373925_0111697_827_1405 185
33 3300044694 Ga0466963_0118241 Ga0466963_0118241_985_1563 185
34 3300046454 Ga0495592_0240210 Ga0495592_0240210_371_949 185
35 3300046462 Ga0495651_0038050 Ga0495651_0038050_2808_3386 185
36 3300046477 Ga0495664_0006885 Ga0495664_0006885_1095_1673 185
37 3300046511 Ga0495608_0452236 Ga0495608_0452236_35_613 185
38 3300046516 Ga0495628_0257128 Ga0495628_0257128_208_786 185
39 3300046529 Ga0495652_0436926 Ga0495652_0436926_296_874 185
40 3300046543 Ga0495645_0036964 Ga0495645_0036964_2146_2724 185
41 3300046559 Ga0495667_0046225 Ga0495667_0046225_128_706 185
42 3300046559 Ga0495667_0051644 Ga0495667_0051644_1261_1839 185
43 3300046642 Ga0495634_0217415 Ga0495634_0217415_284_862 185
44 3300046678 Ga0495599_0062522 Ga0495599_0062522_1336_1914 185
45 3300047319 Ga0495674_0359969 Ga0495674_0359969_577_1155 185
46 3300047322 Ga0495680_0236237 Ga0495680_0236237_650_1228 185
47 3300047471 Ga0495684_0011448 Ga0495684_0011448_1159_1737 185
48 3300048088 Ga0495602_0004604 Ga0495602_0004604_11870_12448 185
49 3300053077 Ga0495601_0018330 Ga0495601_0018330_2956_3534 185
50 3300053078 Ga0495612_0006670 Ga0495612_0006670_1875_2453 185
51 3300053085 Ga0495619_0051132 Ga0495619_0051132_80_658 185
52 3300049585 Ga0501069_0143184 Ga0501069_0143184_516_1079 186
53 3300049589 Ga0501073_0002003 Ga0501073_0002003_2698_3261 186
54 3300037471 Ga0395905_0805295 Ga0395905_0805295_109_699 187
55 3300046523 Ga0495644_0009796 Ga0495644_0009796_553_1119 187
56 3300046539 Ga0495621_0003171 Ga0495621_0003171_648_1214 187
57 3300046558 Ga0495633_0035652 Ga0495633_0035652_290_856 187
58 3300047470 Ga0495681_0022399 Ga0495681_0022399_51_617 187
59 3300005434 Ga0070709_10049677 Ga0070709_100496773 188
60 3300025906 Ga0207699_10005747 Ga0207699_100057473 188
61 3300026116 Ga0207674_10475978 Ga0207674_104759782 188
62 3300046499 Ga0495594_0017136 Ga0495594_0017136_1286_1855 188
63 3300025900 Ga0207710_10088068 Ga0207710_100880681 189
64 3300005518 Ga0070699_100810892 Ga0070699_1008108921 190
65 3300005367 Ga0070667_100027747 Ga0070667_1000277474 192
66 3300005549 Ga0070704_100672908 Ga0070704_1006729081 192
67 3300005563 Ga0068855_101527286 Ga0068855_1015272861 192
68 3300005617 Ga0068859_100027311 Ga0068859_1000273113 192
69 3300005840 Ga0068870_10409973 Ga0068870_104099732 192
70 3300005841 Ga0068863_100040046 Ga0068863_1000400465 192
71 3300006173 Ga0070716_100223718 Ga0070716_1002237182 192
72 3300006844 Ga0075428_100075896 Ga0075428_1000758965 192
73 3300006931 Ga0097620_100027311 Ga0097620_1000273113 192
74 3300009093 Ga0105240_10083130 Ga0105240_100831301 192
75 3300009094 Ga0111539_10091848 Ga0111539_100918482 192
76 3300009098 Ga0105245_10452242 Ga0105245_104522422 192
77 3300009147 Ga0114129_10273109 Ga0114129_102731092 192
78 3300009148 Ga0105243_10573812 Ga0105243_105738122 192
79 3300009174 Ga0105241_10324743 Ga0105241_103247432 192
80 3300009177 Ga0105248_10026829 Ga0105248_100268299 192
81 3300009553 Ga0105249_10552061 Ga0105249_105520612 192
82 3300013307 Ga0157372_10004475 Ga0157372_100044755 192
83 3300025908 Ga0207643_10511684 Ga0207643_105116841 192
84 3300025913 Ga0207695_10133441 Ga0207695_101334411 192
85 3300025925 Ga0207650_10749022 Ga0207650_107490222 192
86 3300025939 Ga0207665_10180032 Ga0207665_101800322 192
87 3300025941 Ga0207711_10058129 Ga0207711_100581295 192
88 3300025949 Ga0207667_10893135 Ga0207667_108931352 192
89 3300025986 Ga0207658_10286620 Ga0207658_102866202 192
90 3300026088 Ga0207641_10127030 Ga0207641_101270305 192
91 3300026095 Ga0207676_10053784 Ga0207676_100537842 192
92 3300028381 Ga0268264_10099791 Ga0268264_100997912 192
93 3300028800 Ga0265338_10001273 Ga0265338_100012737 192
94 3300032002 Ga0307416_101580034 Ga0307416_1015800341 192
95 3300047322 Ga0495680_0253998 Ga0495680_0253998_594_1175 192
96 3300049514 Ga0501291_014639 Ga0501291_014639_148_729 192
97 3300049521 Ga0501298_047080 Ga0501298_047080_214_795 192
98 3300049523 Ga0501300_033466 Ga0501300_033466_140_721 192
99 3300049570 Ga0501033_0037912 Ga0501033_0037912_1649_2230 192
100 3300049571 Ga0501034_0006523 Ga0501034_0006523_10201_10782 192
101 3300049573 Ga0501037_0008757 Ga0501037_0008757_5872_6453 192
102 3300049574 Ga0501038_0068690 Ga0501038_0068690_2330_2911 192
103 3300049581 Ga0501047_0005359 Ga0501047_0005359_1619_2200 192
104 3300049649 Ga0501198_034909 Ga0501198_034909_150_731 192
105 3300049652 Ga0501202_005438 Ga0501202_005438_797_1378 192
106 3300049660 Ga0501216_002916 Ga0501216_002916_548_1129 192
107 3300049661 Ga0501217_023070 Ga0501217_023070_301_882 192
108 3300049664 Ga0501224_038795 Ga0501224_038795_53_634 192
109 3300049665 Ga0501227_016940 Ga0501227_016940_300_881 192
110 3300049667 Ga0501230_036069 Ga0501230_036069_33_614 192
111 3300049668 Ga0501233_009659 Ga0501233_009659_517_1098 192
112 3300049669 Ga0501235_065558 Ga0501235_065558_235_816 192
113 3300049672 Ga0501239_004684 Ga0501239_004684_453_1034 192
114 3300049679 Ga0501249_013701 Ga0501249_013701_400_981 192
115 3300049681 Ga0501251_027567 Ga0501251_027567_170_751 192
116 3300049685 Ga0501256_019880 Ga0501256_019880_55_636 192
117 3300049705 Ga0501225_0179139 Ga0501225_0179139_49_630 192
118 3300049706 Ga0501229_007897 Ga0501229_007897_11_592 192
119 3300049707 Ga0501234_003638 Ga0501234_003638_176_757 192
120 3300049760 Ga0501263_010261 Ga0501263_010261_508_1089 192
121 3300049768 Ga0501271_018161 Ga0501271_018161_190_771 192
122 3300049770 Ga0501273_010025 Ga0501273_010025_214_795 192
123 3300049822 Ga0501035_0055944 Ga0501035_0055944_2158_2739 192
124 3300049823 Ga0501044_0008343 Ga0501044_0008343_170_751 192
125 3300049850 Ga0501204_004594 Ga0501204_004594_497_1078 192
126 3300049851 Ga0501212_007350 Ga0501212_007350_679_1260 192
127 3300003323 rootH1_10261218 rootH1_102612184 193
128 3300003323 rootH1_10309619 rootH1_103096192 193
129 3300003911 JGI25405J52794_10008307 JGI25405J52794_100083073 193
130 3300005290 Ga0065712_10258934 Ga0065712_102589341 193
131 3300005293 Ga0065715_10108221 Ga0065715_101082213 193
132 3300005293 Ga0065715_10139976 Ga0065715_101399762 193
133 3300005293 Ga0065715_10206543 Ga0065715_102065432 193
134 3300005328 Ga0070676_10002433 Ga0070676_100024338 193
135 3300005331 Ga0070670_100495632 Ga0070670_1004956322 193
136 3300005333 Ga0070677_10040101 Ga0070677_100401011 193
137 3300005334 Ga0068869_100014526 Ga0068869_1000145263 193
138 3300005334 Ga0068869_100032233 Ga0068869_1000322332 193
139 3300005335 Ga0070666_10012089 Ga0070666_100120892 193
140 3300005338 Ga0068868_100002459 Ga0068868_10000245910 193
141 3300005340 Ga0070689_100002177 Ga0070689_10000217715 193
142 3300005340 Ga0070689_100314199 Ga0070689_1003141992 193
143 3300005347 Ga0070668_100001962 Ga0070668_10000196216 193
144 3300005347 Ga0070668_100322970 Ga0070668_1003229702 193
145 3300005353 Ga0070669_100001502 Ga0070669_10000150221 193
146 3300005354 Ga0070675_100216302 Ga0070675_1002163023 193
147 3300005355 Ga0070671_100026070 Ga0070671_1000260705 193
148 3300005364 Ga0070673_100001736 Ga0070673_10000173614 193
149 3300005367 Ga0070667_100012621 Ga0070667_1000126213 193
150 3300005438 Ga0070701_10727895 Ga0070701_107278951 193
151 3300005441 Ga0070700_100397626 Ga0070700_1003976262 193
152 3300005444 Ga0070694_100002674 Ga0070694_1000026742 193
153 3300005455 Ga0070663_100351247 Ga0070663_1003512472 193
154 3300005456 Ga0070678_100007775 Ga0070678_1000077753 193
155 3300005456 Ga0070678_100018495 Ga0070678_1000184954 193
156 3300005459 Ga0068867_100163003 Ga0068867_1001630033 193
157 3300005459 Ga0068867_100776096 Ga0068867_1007760962 193
158 3300005471 Ga0070698_100620566 Ga0070698_1006205661 193
159 3300005536 Ga0070697_100410164 Ga0070697_1004101642 193
160 3300005543 Ga0070672_100005110 Ga0070672_1000051108 193
161 3300005548 Ga0070665_100001099 Ga0070665_10000109932 193
162 3300005548 Ga0070665_100027950 Ga0070665_1000279507 193
163 3300005548 Ga0070665_100057459 Ga0070665_1000574592 193
164 3300005615 Ga0070702_100001824 Ga0070702_10000182412 193
165 3300005617 Ga0068859_100015823 Ga0068859_1000158238 193
166 3300005617 Ga0068859_100017985 Ga0068859_1000179854 193
167 3300005617 Ga0068859_100031325 Ga0068859_1000313252 193
168 3300005617 Ga0068859_100109753 Ga0068859_1001097534 193
169 3300005617 Ga0068859_100155024 Ga0068859_1001550242 193
170 3300005617 Ga0068859_100985196 Ga0068859_1009851962 193
171 3300005618 Ga0068864_100003842 Ga0068864_1000038425 193
172 3300005618 Ga0068864_100011868 Ga0068864_1000118685 193
173 3300005718 Ga0068866_10374711 Ga0068866_103747112 193
174 3300005719 Ga0068861_100032037 Ga0068861_1000320372 193
175 3300005719 Ga0068861_100671402 Ga0068861_1006714022 193
176 3300005834 Ga0068851_10107513 Ga0068851_101075132 193
177 3300005840 Ga0068870_10007867 Ga0068870_100078673 193
178 3300005840 Ga0068870_10272887 Ga0068870_102728871 193
179 3300005841 Ga0068863_100024639 Ga0068863_1000246397 193
180 3300005841 Ga0068863_100125190 Ga0068863_1001251902 193
181 3300005841 Ga0068863_100174480 Ga0068863_1001744802 193
182 3300005841 Ga0068863_100205457 Ga0068863_1002054572 193
183 3300005841 Ga0068863_100395217 Ga0068863_1003952172 193
184 3300005841 Ga0068863_100957365 Ga0068863_1009573651 193
185 3300005842 Ga0068858_100026693 Ga0068858_1000266935 193
186 3300005842 Ga0068858_100243481 Ga0068858_1002434812 193
187 3300005843 Ga0068860_100019547 Ga0068860_1000195477 193
188 3300005843 Ga0068860_100108761 Ga0068860_1001087612 193
189 3300005843 Ga0068860_100373428 Ga0068860_1003734282 193
190 3300005844 Ga0068862_100709994 Ga0068862_1007099942 193
191 3300005937 Ga0081455_10000711 Ga0081455_1000071122 193
192 3300005937 Ga0081455_10035076 Ga0081455_100350763 193
193 3300005937 Ga0081455_10069247 Ga0081455_100692472 193
194 3300006237 Ga0097621_100033108 Ga0097621_1000331083 193
195 3300006358 Ga0068871_100184692 Ga0068871_1001846923 193
196 3300006358 Ga0068871_100363602 Ga0068871_1003636022 193
197 3300006358 Ga0068871_100668281 Ga0068871_1006682812 193
198 3300006844 Ga0075428_100313235 Ga0075428_1003132353 193
199 3300006846 Ga0075430_100091841 Ga0075430_1000918413 193
200 3300006846 Ga0075430_100245791 Ga0075430_1002457912 193
201 3300006847 Ga0075431_100161506 Ga0075431_1001615062 193
202 3300006847 Ga0075431_100254979 Ga0075431_1002549793 193
203 3300006847 Ga0075431_100340837 Ga0075431_1003408373 193
204 3300006852 Ga0075433_10045465 Ga0075433_100454653 193
205 3300006880 Ga0075429_100051971 Ga0075429_1000519714 193
206 3300006880 Ga0075429_100126691 Ga0075429_1001266912 193
207 3300006880 Ga0075429_100468678 Ga0075429_1004686782 193
208 3300006931 Ga0097620_100015824 Ga0097620_1000158248 193
209 3300006931 Ga0097620_100017985 Ga0097620_1000179857 193
210 3300006931 Ga0097620_100031324 Ga0097620_1000313242 193
211 3300006931 Ga0097620_100109755 Ga0097620_1001097554 193
212 3300006931 Ga0097620_100155017 Ga0097620_1001550172 193
213 3300006931 Ga0097620_100985261 Ga0097620_1009852612 193
214 3300009094 Ga0111539_10003686 Ga0111539_1000368619 193
215 3300009101 Ga0105247_10054135 Ga0105247_100541354 193
216 3300009101 Ga0105247_10092721 Ga0105247_100927212 193
217 3300009147 Ga0114129_10165981 Ga0114129_101659812 193
218 3300009147 Ga0114129_10249420 Ga0114129_102494202 193
219 3300009174 Ga0105241_10221838 Ga0105241_102218382 193
220 3300009176 Ga0105242_10439423 Ga0105242_104394233 193
221 3300009177 Ga0105248_10030586 Ga0105248_100305863 193
222 3300009177 Ga0105248_10171167 Ga0105248_101711672 193
223 3300009545 Ga0105237_10053453 Ga0105237_100534532 193
224 3300009545 Ga0105237_10780123 Ga0105237_107801231 193
225 3300009553 Ga0105249_10055292 Ga0105249_100552923 193
226 3300013296 Ga0157374_10048149 Ga0157374_100481493 193
227 3300013296 Ga0157374_10064732 Ga0157374_100647322 193
228 3300013306 Ga0163162_10890692 Ga0163162_108906922 193
229 3300013308 Ga0157375_10034789 Ga0157375_100347894 193
230 3300013308 Ga0157375_10193398 Ga0157375_101933982 193
231 3300014325 Ga0163163_10005138 Ga0163163_100051387 193
232 3300014325 Ga0163163_10471560 Ga0163163_104715601 193
233 3300014497 Ga0182008_10013984 Ga0182008_100139842 193
234 3300014745 Ga0157377_10500139 Ga0157377_105001392 193
235 3300014968 Ga0157379_10192441 Ga0157379_101924411 193
236 3300014968 Ga0157379_10532022 Ga0157379_105320222 193
237 3300014968 Ga0157379_10888823 Ga0157379_108888231 193
238 3300015262 Ga0182007_10008346 Ga0182007_100083466 193
239 3300017792 Ga0163161_10003576 Ga0163161_100035768 193
240 3300025315 Ga0207697_10018869 Ga0207697_100188692 193
241 3300025893 Ga0207682_10031974 Ga0207682_100319743 193
242 3300025899 Ga0207642_10304049 Ga0207642_103040492 193
243 3300025900 Ga0207710_10157960 Ga0207710_101579601 193
244 3300025903 Ga0207680_10061581 Ga0207680_100615812 193
245 3300025907 Ga0207645_10001646 Ga0207645_100016467 193
246 3300025907 Ga0207645_10274580 Ga0207645_102745802 193
247 3300025908 Ga0207643_10022341 Ga0207643_100223413 193
248 3300025912 Ga0207707_10646190 Ga0207707_106461901 193
249 3300025917 Ga0207660_10412656 Ga0207660_104126563 193
250 3300025918 Ga0207662_10449811 Ga0207662_104498112 193
251 3300025923 Ga0207681_10014671 Ga0207681_100146715 193
252 3300025925 Ga0207650_10167970 Ga0207650_101679702 193
253 3300025925 Ga0207650_11074373 Ga0207650_110743731 193
254 3300025926 Ga0207659_10036792 Ga0207659_100367923 193
255 3300025931 Ga0207644_10009966 Ga0207644_100099667 193
256 3300025936 Ga0207670_10225562 Ga0207670_102255622 193
257 3300025937 Ga0207669_10100592 Ga0207669_101005922 193
258 3300025938 Ga0207704_10002734 Ga0207704_100027344 193
259 3300025940 Ga0207691_10006881 Ga0207691_100068817 193
260 3300025941 Ga0207711_10038498 Ga0207711_100384983 193
261 3300025941 Ga0207711_10135038 Ga0207711_101350381 193
262 3300025942 Ga0207689_10002291 Ga0207689_1000229118 193
263 3300025942 Ga0207689_10053332 Ga0207689_100533323 193
264 3300025960 Ga0207651_10003999 Ga0207651_100039992 193
265 3300025961 Ga0207712_10045048 Ga0207712_100450483 193
266 3300025972 Ga0207668_10001330 Ga0207668_1000133010 193
267 3300025986 Ga0207658_10655842 Ga0207658_106558422 193
268 3300026023 Ga0207677_10024441 Ga0207677_100244412 193
269 3300026023 Ga0207677_10278407 Ga0207677_102784072 193
270 3300026035 Ga0207703_10021845 Ga0207703_100218455 193
271 3300026088 Ga0207641_10008990 Ga0207641_100089907 193
272 3300026088 Ga0207641_10059225 Ga0207641_100592255 193
273 3300026089 Ga0207648_10001556 Ga0207648_1000155613 193
274 3300026089 Ga0207648_10021591 Ga0207648_100215913 193
275 3300026089 Ga0207648_10126893 Ga0207648_101268933 193
276 3300026089 Ga0207648_10377394 Ga0207648_103773942 193
277 3300026095 Ga0207676_10006669 Ga0207676_100066696 193
278 3300026118 Ga0207675_100301578 Ga0207675_1003015782 193
279 3300026118 Ga0207675_100312485 Ga0207675_1003124853 193
280 3300026121 Ga0207683_10000250 Ga0207683_1000025054 193
281 3300028379 Ga0268266_10000304 Ga0268266_100003046 193
282 3300028379 Ga0268266_10090258 Ga0268266_100902583 193
283 3300028381 Ga0268264_10009183 Ga0268264_1000918311 193
284 3300028381 Ga0268264_10102010 Ga0268264_101020102 193
285 3300028381 Ga0268264_10341395 Ga0268264_103413952 193
286 3300028381 Ga0268264_10786197 Ga0268264_107861972 193
287 3300031824 Ga0307413_10088793 Ga0307413_100887932 193
288 3300031852 Ga0307410_10018917 Ga0307410_100189174 193
289 3300031901 Ga0307406_10082616 Ga0307406_100826164 193
290 3300032005 Ga0307411_10005650 Ga0307411_100056509 193
291 3300042012 Ga0439455_0099629 Ga0439455_0099629_165_749 193
292 3300042439 Ga0439464_0026637 Ga0439464_0026637_111_722 193
293 3300042532 Ga0450893_0000417 Ga0450893_0000417_2354_2962 193
294 3300042876 Ga0451577_0100388 Ga0451577_0100388_469_1059 193
295 3300044656 Ga0466969_0007334 Ga0466969_0007334_2022_2624 193
296 3300044684 Ga0466966_0448508 Ga0466966_0448508_58_660 193
297 3300045049 Ga0466959_0009729 Ga0466959_0009729_5654_6256 193
298 3300048912 Ga0496109_1220111 Ga0496109_1220111_67_651 193
299 3300048916 Ga0496113_0132888 Ga0496113_0132888_759_1346 193
300 3300048917 Ga0496114_0522905 Ga0496114_0522905_14_598 193
301 3300048929 Ga0496126_0001692 Ga0496126_0001692_11743_12333 193
302 3300049519 Ga0501296_000639 Ga0501296_000639_1763_2347 193
303 3300049521 Ga0501298_007328 Ga0501298_007328_1080_1664 193
304 3300049574 Ga0501038_0177452 Ga0501038_0177452_235_822 193
305 3300049577 Ga0501041_0220920 Ga0501041_0220920_409_1008 193
306 3300049578 Ga0501042_0851895 Ga0501042_0851895_48_647 193
307 3300049581 Ga0501047_0005973 Ga0501047_0005973_601_1188 193
308 3300049588 Ga0501072_0234526 Ga0501072_0234526_180_779 193
309 3300049591 Ga0501075_0127741 Ga0501075_0127741_1212_1811 193
310 3300049593 Ga0501077_0145267 Ga0501077_0145267_13_606 193
311 3300049649 Ga0501198_002986 Ga0501198_002986_75_659 193
312 3300049652 Ga0501202_039121 Ga0501202_039121_62_646 193
313 3300049654 Ga0501207_024436 Ga0501207_024436_227_811 193
314 3300049656 Ga0501209_072972 Ga0501209_072972_175_759 193
315 3300049664 Ga0501224_017859 Ga0501224_017859_184_768 193
316 3300049665 Ga0501227_002123 Ga0501227_002123_1773_2357 193
317 3300049669 Ga0501235_024964 Ga0501235_024964_310_894 193
318 3300049677 Ga0501247_012886 Ga0501247_012886_135_719 193
319 3300049679 Ga0501249_022760 Ga0501249_022760_624_1208 193
320 3300049688 Ga0501259_063183 Ga0501259_063183_34_618 193
321 3300049690 Ga0501261_008279 Ga0501261_008279_338_922 193
322 3300049707 Ga0501234_006620 Ga0501234_006620_941_1525 193
323 3300049765 Ga0501268_043571 Ga0501268_043571_171_755 193
324 3300049773 Ga0501276_014527 Ga0501276_014527_51_635 193
325 3300049779 Ga0501283_007907 Ga0501283_007907_909_1493 193
326 3300049823 Ga0501044_0000455 Ga0501044_0000455_14820_15407 193
327 3300049824 Ga0501045_0333039 Ga0501045_0333039_473_1072 193
328 3300049851 Ga0501212_003240 Ga0501212_003240_609_1193 193
329 3300049853 Ga0501226_004208 Ga0501226_004208_289_873 193
330 3300050507 nmdc:mga05p37_143080_c1 nmdc:mga05p37_143080_c1_712_1299 193
331 3300050507 nmdc:mga05p37_204159_c1 nmdc:mga05p37_204159_c1_1010_1621 193
332 3300050507 nmdc:mga05p37_30404_c1 nmdc:mga05p37_30404_c1_5257_5868 193
333 3300050507 nmdc:mga05p37_738725_c1 nmdc:mga05p37_738725_c1_461_1045 193
334 3300050508 nmdc:mga09592_10246_c1 nmdc:mga09592_10246_c1_788_1375 193
335 3300050508 nmdc:mga09592_109913_c1 nmdc:mga09592_109913_c1_745_1356 193
336 3300050508 nmdc:mga09592_86988_c1 nmdc:mga09592_86988_c1_1658_2269 193
337 3300050509 nmdc:mga0qj67_476548_c1 nmdc:mga0qj67_476548_c1_92_679 193
338 3300050510 nmdc:mga06r32_383743_c1 nmdc:mga06r32_383743_c1_738_1349 193
339 3300050510 nmdc:mga06r32_82373_c1 nmdc:mga06r32_82373_c1_2087_2698 193
340 3300050511 nmdc:mga08y16_5870_c1 nmdc:mga08y16_5870_c1_1384_1971 193
341 3300050515 nmdc:mga0a205_16883_c1 nmdc:mga0a205_16883_c1_2345_2932 193
342 3300050515 nmdc:mga0a205_245853_c1 nmdc:mga0a205_245853_c1_142_753 193
343 3300050515 nmdc:mga0a205_47557_c1 nmdc:mga0a205_47557_c1_2501_3085 193
344 3300053124 Ga0500617_069191 Ga0500617_069191_481_1077 193
345 3300053130 Ga0500642_0169314 Ga0500642_0169314_217_813 193
346 3300005840 Ga0068870_10123493 Ga0068870_101234932 195
347 3300011119 Ga0105246_10232309 Ga0105246_102323092 195
348 3300014325 Ga0163163_10406891 Ga0163163_104068912 195
349 3300026095 Ga0207676_10200072 Ga0207676_102000721 195
350 3300007788 Ga0099795_10114471 Ga0099795_101144711 196
351 3300031730 Ga0307516_10000050 Ga0307516_1000005032 199
352 3300005614 Ga0068856_100453051 Ga0068856_1004530512 200
353 3300003203 JGI25406J46586_10030720 JGI25406J46586_100307201 202
354 3300005290 Ga0065712_10195419 Ga0065712_101954191 202
355 3300005336 Ga0070680_100203059 Ga0070680_1002030592 202
356 3300005844 Ga0068862_100484191 Ga0068862_1004841912 202
357 3300005985 Ga0081539_10006384 Ga0081539_100063847 202
358 3300006881 Ga0068865_100254457 Ga0068865_1002544572 202
359 3300009553 Ga0105249_10433504 Ga0105249_104335042 202
360 3300013308 Ga0157375_10210526 Ga0157375_102105263 202
361 3300025908 Ga0207643_10338368 Ga0207643_103383682 202
362 3300025938 Ga0207704_10345368 Ga0207704_103453682 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06736

TMEM175

Endosomal/lysosomal potassium channel TMEM175

42

126

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.8372 13 187
6w8n-assembly1.cif.gz_B structure of a trans-membrane protein 0.7926 12 183
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.7793 13 187
6w8p-assembly1.cif.gz_B structure of membrane protein with ions 0.7678 12 197
6w8o-assembly1.cif.gz_B structure of an apo membrane protein 0.7569 12 197
ID Description Score Start End Superfamily
af_A0A0R0HUX5_50_167_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.6795 15 135 1.20.930.20
af_Q3EBY6_10_127_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.6705 22 130 1.20.930.20
af_Q8MZ67_1_133_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6669 49 172 1.20.140.150
af_A0A0R0HUX5_50_167_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.6463 15 135 1.20.930.20
af_Q8MZ67_1_133_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6117 49 172 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A538BXR0-F1-model_v4 DUF1211 domain-containing protein 0.9719 23 194 GO:0005267
GO:0015252
GO:0016020
AF-A0A3B1D0B9-F1-model_v4 Integral membrane protein 0.9633 65 197 GO:0005267
GO:0015252
GO:0016020
AF-A0A2U3QFG1-F1-model_v4 DUF1211 domain-containing protein 0.9629 12 202 GO:0005267
GO:0015252
GO:0016020
AF-A0A529IS94-F1-model_v4 DUF1211 domain-containing protein 0.9604 10 198 GO:0005267
GO:0015252
GO:0016020
AF-A0A7V8CUZ7-F1-model_v4 DUF1211 domain-containing protein 0.9585 12 190 GO:0005267
GO:0015252
GO:0016020

Feature Viewer

pLDDT pTM Quality
79.01 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map