F422459

General Info

Members Datasets Scaffolds Average Seq Length
362 238 724 200

Family's Representative Sequence

Representative Sequence 3300003354|JGI25160J50197_1023247|JGI25160J50197_10232472
Length 215
Sequence MKXTRHPTTTPHGAAAGHPGMGXPTVQPVPASVVEQVDAADVTLSNPKRAVISLGSNLGNRLETLQGAVDALEDTPGLRVKAVSPVYETVPWGVDPGSQPSYFNAVVLIKTTLPPSSLLERGQAIEEAFERVRDERWGPRTIDVDILAYQDVVSDDPRLTLPHPRAHERAFVLVPWHDIDPEAVVPGRGAVXELLSAVGXDGVEPRADLELRLPE

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
4 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
5 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
6 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
7 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
8 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
9 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
10 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
11 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
12 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
13 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
14 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
15 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
21 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
22 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
23 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
24 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
25 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
26 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
27 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
28 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
29 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
30 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
31 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
32 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
33 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
34 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
35 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
36 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
37 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
38 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
39 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
40 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
41 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
42 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
43 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
44 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
45 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
46 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
47 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
48 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
49 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
50 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
51 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
52 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
53 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
54 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
55 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
56 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
57 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
58 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
59 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
60 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
63 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
64 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
65 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
66 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
67 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
68 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
69 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
70 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
71 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
72 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
73 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
74 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
75 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
76 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
77 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
78 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
82 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
83 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
84 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
85 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
101 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
102 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
103 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
107 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
108 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
111 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
112 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
118 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
121 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
146 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
152 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
153 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
154 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
155 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
156 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
157 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
158 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
160 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
161 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
162 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
163 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
164 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
165 2643221578 Streptomyces sp. Root63 Isolate Unclassified
166 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
167 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
168 2643221647 Streptomyces sp. Root369 Isolate Unclassified
169 2643221670 Streptomyces sp. Root431 Isolate Unclassified
170 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
171 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
172 2643221714 Streptomyces sp. Root264 Isolate Unclassified
173 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
174 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
175 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
176 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
177 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
178 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
179 2808606448 Streptomyces sp. 193411 Isolate Unclassified
180 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
181 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
182 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
183 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
184 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
185 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
186 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
187 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
188 2862574272 Streptomyces sp. AcE210 Isolate Nodule
189 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
190 2867369537 Streptomyces sp. Z26 Isolate Unclassified
191 2867428634 Streptomyces sp. RP5T Isolate Unclassified
192 2867475112 Streptomyces sp. TM32 Isolate Unclassified
193 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
194 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
195 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
196 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
197 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
198 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
199 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
200 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
201 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
202 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
203 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
204 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
205 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
206 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
207 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
208 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
209 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
210 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
211 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
212 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
213 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
214 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
215 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
216 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
217 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
218 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
219 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
220 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
221 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
222 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
223 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
224 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
225 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
226 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
227 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
228 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
229 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
230 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
231 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
232 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
233 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
234 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
235 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
236 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
237 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
238 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.07
Metatranscriptomes 1.1
Isolates 21.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.08
Nodule 0.28
Rhizoplane 0.83
Rhizosphere 77.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1023247 3300003354 Bacteria 1794
2 JGI25160J50197_1033705 3300003354 Bacteria 1283
3 JGI25160J50197_1050966 3300003354 Bacteria 878
4 Ga0006562J51391_1036308 3300003578 Bacteria 2593
5 Ga0006562J51391_1121765 3300003578 Bacteria 2443
6 Ga0006562J51391_1121767 3300003578 Bacteria 2070
7 Ga0068856_100291121 3300005614 Bacteria 1650
8 Ga0075367_10279989 3300006178 Bacteria 1048
9 Ga0105240_11416379 3300009093 Bacteria 730
10 Ga0105245_10116988 3300009098 Bacteria 2486
11 Ga0105243_10037310 3300009148 Bacteria 3776
12 Ga0105246_10001835 3300011119 Bacteria 12738
13 Ga0157369_10084702 3300013105 Bacteria 3388
14 Ga0157372_10031477 3300013307 Bacteria 5809
15 Ga0182007_10000526 3300015262 Bacteria 22600
16 Ga0183367_1015 3300015688 Bacteria 298435
17 Ga0209758_1010542 3300025297 Bacteria 5510
18 Ga0207426_1003642 3300025302 Bacteria 8146
19 Ga0207426_1008113 3300025302 Bacteria 4298
20 Ga0207426_1026130 3300025302 Bacteria 1959
21 Ga0207647_10004478 3300025904 Bacteria 10347
22 Ga0207643_10041887 3300025908 Bacteria 2581
23 Ga0207687_10045150 3300025927 Bacteria 3044
24 Ga0207687_10235315 3300025927 Bacteria 1449
25 Ga0207709_10196407 3300025935 Bacteria 1437
26 Ga0207678_10112561 3300026067 Bacteria 2321
27 Ga0209813_10032371 3300027866 Bacteria 1549
28 Ga0307517_10012587 3300028786 Bacteria 11590
29 Ga0307515_10001114 3300028794 Bacteria 61489
30 Ga0307515_10080258 3300028794 Bacteria 4258
31 Ga0307515_10084633 3300028794 Bacteria 4070
32 Ga0268256_1016621 3300030500 Bacteria 2101
33 Ga0307512_10024800 3300030522 Bacteria 5328
34 Ga0307513_10196208 3300031456 Bacteria 1864
35 Ga0307509_10128375 3300031507 Bacteria 2496
36 Ga0307509_10128768 3300031507 Bacteria 2491
37 Ga0307509_10229392 3300031507 Bacteria 1661
38 Ga0307508_10015832 3300031616 Bacteria 6870
39 Ga0307514_10008462 3300031649 Bacteria 8762
40 Ga0307514_10032610 3300031649 Bacteria 4166
41 Ga0307514_10037847 3300031649 Bacteria 3820
42 Ga0307514_10045550 3300031649 Bacteria 3432
43 Ga0307514_10078436 3300031649 Bacteria 2453
44 Ga0307516_10008687 3300031730 Bacteria 11431
45 Ga0307516_10093183 3300031730 Bacteria 2838
46 Ga0307518_10063133 3300031838 Bacteria 2689
47 Ga0307410_10168939 3300031852 Bacteria 1646
48 Ga0307410_10747038 3300031852 Bacteria 828
49 Ga0307416_100330524 3300032002 Bacteria 1531
50 Ga0307416_101097866 3300032002 Bacteria 900
51 Ga0307507_10036484 3300033179 Bacteria 5023
52 Ga0307510_10033810 3300033180 Bacteria 5736
53 Ga0307510_10211733 3300033180 Bacteria 1459
54 Ga0395899_0213436 3300037312 Bacteria 1340
55 Ga0395900_0151255 3300037418 Bacteria 2371
56 Ga0395900_0814016 3300037418 Bacteria 861
57 Ga0395900_0981587 3300037418 Bacteria 765
58 Ga0395898_0018706 3300037466 Bacteria 7062
59 Ga0395898_0047078 3300037466 Bacteria 4233
60 Ga0395905_0270808 3300037471 Bacteria 1584
61 Ga0436364_1424714 3300037853 Bacteria 20926
62 Ga0395901_0179114 3300038443 Bacteria 2223
63 Ga0439436_0006050 3300041404 Bacteria 3710
64 Ga0439439_0000554 3300041406 Bacteria 6514
65 Ga0451853_3823001 3300041512 Bacteria 1972
66 Ga0439433_0000267 3300041999 Bacteria 8812
67 Ga0439442_018578 3300042002 Bacteria 1437
68 Ga0439449_0007088 3300042007 Bacteria 4267
69 Ga0439457_001481 3300042014 Bacteria 7043
70 Ga0439457_040002 3300042014 Bacteria 1045
71 Ga0439462_0025196 3300042015 Bacteria 1565
72 Ga0439458_0031194 3300042157 Bacteria 1270
73 Ga0466969_0191983 3300044656 Bacteria 933
74 Ga0466972_0001857 3300044658 Bacteria 10346
75 Ga0466972_0040092 3300044658 Bacteria 2283
76 Ga0466965_0325441 3300044683 Bacteria 838
77 Ga0466966_0218271 3300044684 Bacteria 1151
78 Ga0466961_0015169 3300044693 Bacteria 4948
79 Ga0466961_0017644 3300044693 Bacteria 4585
80 Ga0466963_0137008 3300044694 Bacteria 1694
81 Ga0466971_0003676 3300044719 Bacteria 6558
82 Ga0466970_0008127 3300044765 Bacteria 5268
83 Ga0466970_0145370 3300044765 Bacteria 1308
84 Ga0466960_0007800 3300044901 Bacteria 4365
85 Ga0466960_0216204 3300044901 Bacteria 1053
86 Ga0466959_0009781 3300045049 Bacteria 6831
87 Ga0466958_0083029 3300045836 Bacteria 1974
88 Ga0466967_0021592 3300045976 Bacteria 5234
89 Ga0495592_0008676 3300046454 Bacteria 7629
90 Ga0495592_0020948 3300046454 Bacteria 4972
91 Ga0495592_0085600 3300046454 Bacteria 2272
92 Ga0495603_0005199 3300046455 Bacteria 7769
93 Ga0495603_0005365 3300046455 Bacteria 7644
94 Ga0495603_0206286 3300046455 Bacteria 1135
95 Ga0495590_0101678 3300046457 Bacteria 1021
96 Ga0495629_0013418 3300046459 Bacteria 5910
97 Ga0495629_0019785 3300046459 Bacteria 4805
98 Ga0495629_0039860 3300046459 Bacteria 3305
99 Ga0495629_0048425 3300046459 Bacteria 2979
100 Ga0495629_0214326 3300046459 Bacteria 1330
101 Ga0495651_0000452 3300046462 Bacteria 31571
102 Ga0495651_0014333 3300046462 Bacteria 6128
103 Ga0495653_0015562 3300046463 Bacteria 6199
104 Ga0495653_0134323 3300046463 Bacteria 1747
105 Ga0495580_0005367 3300046472 Bacteria 10610
106 Ga0495662_0000295 3300046476 Bacteria 21630
107 Ga0495662_0000594 3300046476 Bacteria 16710
108 Ga0495662_0072531 3300046476 Bacteria 1669
109 Ga0495664_0000447 3300046477 Bacteria 20283
110 Ga0495664_0009031 3300046477 Bacteria 5571
111 Ga0495584_0094499 3300046491 Bacteria 1509
112 Ga0495594_0000428 3300046499 Bacteria 21181
113 Ga0495594_0006912 3300046499 Bacteria 5838
114 Ga0495594_0284962 3300046499 Bacteria 941
115 Ga0495594_0410325 3300046499 Bacteria 770
116 Ga0495607_0173485 3300046501 Bacteria 1087
117 Ga0495583_0114252 3300046506 Bacteria 1142
118 Ga0495583_0299067 3300046506 Bacteria 639
119 Ga0495608_0002684 3300046511 Bacteria 12783
120 Ga0495610_0078819 3300046512 Bacteria 1518
121 Ga0495618_0020423 3300046514 Bacteria 4077
122 Ga0495618_0047298 3300046514 Bacteria 2715
123 Ga0495618_0211908 3300046514 Bacteria 1224
124 Ga0495620_0043993 3300046515 Bacteria 1942
125 Ga0495628_0051523 3300046516 Bacteria 3254
126 Ga0495628_0057080 3300046516 Bacteria 3071
127 Ga0495628_0802404 3300046516 Bacteria 658
128 Ga0495630_0031034 3300046517 Bacteria 3977
129 Ga0495631_0034323 3300046518 Bacteria 2275
130 Ga0495631_0039117 3300046518 Bacteria 2106
131 Ga0495643_0012515 3300046522 Bacteria 5115
132 Ga0495648_0038823 3300046524 Bacteria 3038
133 Ga0495666_0000558 3300046526 Bacteria 16637
134 Ga0495642_0079256 3300046528 Bacteria 1381
135 Ga0495652_0006292 3300046529 Bacteria 11060
136 Ga0495652_0042387 3300046529 Bacteria 3925
137 Ga0495652_0788772 3300046529 Bacteria 633
138 Ga0495665_0012118 3300046531 Bacteria 4669
139 Ga0495640_0019300 3300046533 Bacteria 5035
140 Ga0495586_0001586 3300046535 Bacteria 12508
141 Ga0495586_0117810 3300046535 Bacteria 1482
142 Ga0495587_0000644 3300046536 Bacteria 23420
143 Ga0495587_0006714 3300046536 Bacteria 7494
144 Ga0495645_0007656 3300046543 Bacteria 7515
145 Ga0495645_0024175 3300046543 Bacteria 4407
146 Ga0495645_0084794 3300046543 Bacteria 2268
147 Ga0495645_0161895 3300046543 Bacteria 1546
148 Ga0495622_0007748 3300046557 Bacteria 4988
149 Ga0495622_0273714 3300046557 Bacteria 739
150 Ga0495667_0212381 3300046559 Bacteria 1236
151 Ga0495667_0337122 3300046559 Bacteria 953
152 Ga0495634_0000804 3300046642 Bacteria 30477
153 Ga0495634_0040901 3300046642 Bacteria 3149
154 Ga0495634_0081157 3300046642 Bacteria 2121
155 Ga0495611_0211398 3300046648 Bacteria 903
156 Ga0495611_0217501 3300046648 Bacteria 889
157 Ga0495625_0009340 3300046660 Bacteria 8215
158 Ga0495625_0133484 3300046660 Bacteria 1680
159 Ga0495635_0022293 3300046663 Bacteria 4408
160 Ga0495635_0038619 3300046663 Bacteria 3304
161 Ga0495635_0112149 3300046663 Bacteria 1862
162 Ga0495588_0004337 3300046674 Bacteria 6263
163 Ga0495588_0042450 3300046674 Bacteria 2325
164 Ga0495588_0296037 3300046674 Bacteria 852
165 Ga0495657_0014700 3300046675 Bacteria 5745
166 Ga0495657_0018804 3300046675 Bacteria 4993
167 Ga0495657_0052496 3300046675 Bacteria 2732
168 Ga0495599_0015293 3300046678 Bacteria 4760
169 Ga0495599_0175593 3300046678 Bacteria 1321
170 Ga0495599_0234269 3300046678 Bacteria 1121
171 Ga0495623_0037248 3300046679 Bacteria 3113
172 Ga0495623_0107912 3300046679 Bacteria 1690
173 Ga0495646_0000131 3300046680 Bacteria 37843
174 Ga0495646_0003153 3300046680 Bacteria 10231
175 Ga0495646_0133746 3300046680 Bacteria 1394
176 Ga0495658_0009989 3300046683 Bacteria 4737
177 Ga0495613_0000387 3300046689 Bacteria 38006
178 Ga0495613_0000838 3300046689 Bacteria 23741
179 Ga0495613_0009859 3300046689 Bacteria 7104
180 Ga0495613_0019541 3300046689 Bacteria 5048
181 Ga0495613_0039200 3300046689 Bacteria 3512
182 Ga0495613_0133681 3300046689 Bacteria 1776
183 Ga0495613_0332715 3300046689 Bacteria 1046
184 Ga0495670_0019839 3300046691 Bacteria 3313
185 Ga0495671_0017683 3300046692 Bacteria 3791
186 Ga0495649_0036513 3300046694 Bacteria 2699
187 Ga0495589_0004926 3300046794 Bacteria 7078
188 Ga0495589_0015671 3300046794 Bacteria 3896
189 Ga0495589_0090134 3300046794 Bacteria 1489
190 Ga0495600_0014590 3300046809 Bacteria 4952
191 Ga0495600_0049340 3300046809 Bacteria 2746
192 Ga0495600_0526507 3300046809 Bacteria 724
193 Ga0495581_0002564 3300047315 Bacteria 10319
194 Ga0495581_0004459 3300047315 Bacteria 8094
195 Ga0495581_0159433 3300047315 Bacteria 1319
196 Ga0495581_0396904 3300047315 Bacteria 805
197 Ga0495604_0000385 3300047317 Bacteria 39910
198 Ga0495604_0002049 3300047317 Bacteria 16276
199 Ga0495636_0009043 3300047318 Bacteria 3917
200 Ga0495636_0015289 3300047318 Bacteria 3059
201 Ga0495636_0101048 3300047318 Bacteria 1261
202 Ga0495636_0192046 3300047318 Bacteria 930
203 Ga0495636_0294346 3300047318 Bacteria 758
204 Ga0495674_0283907 3300047319 Bacteria 1355
205 Ga0495672_0328504 3300047320 Bacteria 716
206 Ga0495676_0006399 3300047321 Bacteria 10855
207 Ga0495676_0018648 3300047321 Bacteria 6120
208 Ga0495676_0041155 3300047321 Bacteria 3805
209 Ga0495676_0113231 3300047321 Bacteria 1986
210 Ga0495680_0008962 3300047322 Bacteria 9041
211 Ga0495683_0045077 3300047323 Bacteria 2216
212 Ga0495687_001389 3300047443 Bacteria 22370
213 Ga0495687_018465 3300047443 Bacteria 3447
214 Ga0495687_034087 3300047443 Bacteria 2303
215 Ga0495687_036692 3300047443 Bacteria 2190
216 Ga0495687_158272 3300047443 Bacteria 765
217 Ga0495675_0018911 3300047444 Bacteria 4377
218 Ga0495675_0047009 3300047444 Bacteria 2746
219 Ga0495675_0078842 3300047444 Bacteria 2074
220 Ga0495677_0128439 3300047445 Bacteria 969
221 Ga0495685_010959 3300047447 Bacteria 3049
222 Ga0495685_015908 3300047447 Bacteria 2569
223 Ga0495685_054218 3300047447 Bacteria 1357
224 Ga0495685_125061 3300047447 Bacteria 843
225 Ga0495684_0426136 3300047471 Bacteria 926
226 Ga0495686_0037377 3300047472 Bacteria 3111
227 Ga0495593_0019228 3300047673 Bacteria 3831
228 Ga0495593_0065085 3300047673 Bacteria 1901
229 Ga0495602_0019221 3300048088 Bacteria 6792
230 Ga0495602_0107656 3300048088 Bacteria 2271
231 Ga0495614_0000388 3300048089 Bacteria 17839
232 Ga0495614_0030230 3300048089 Bacteria 2330
233 Ga0495614_0077995 3300048089 Bacteria 1433
234 Ga0495614_0105849 3300048089 Bacteria 1232
235 Ga0496102_0622039 3300048905 Bacteria 1003
236 Ga0496109_0311658 3300048912 Bacteria 1485
237 Ga0501323_000903 3300049539 Bacteria 2426
238 Ga0501031_0014106 3300049568 Bacteria 5200
239 Ga0501031_0379194 3300049568 Bacteria 915
240 Ga0501032_0015155 3300049569 Bacteria 5444
241 Ga0501033_0003676 3300049570 Bacteria 12485
242 Ga0501033_0248784 3300049570 Bacteria 1260
243 Ga0501034_0032795 3300049571 Bacteria 5273
244 Ga0501034_0078121 3300049571 Bacteria 3315
245 Ga0501034_0161883 3300049571 Bacteria 2208
246 Ga0501036_0048326 3300049572 Bacteria 3602
247 Ga0501036_1044782 3300049572 Bacteria 668
248 Ga0501037_0014639 3300049573 Bacteria 5772
249 Ga0501037_0122216 3300049573 Bacteria 1871
250 Ga0501038_0054996 3300049574 Bacteria 3421
251 Ga0501039_0062980 3300049575 Bacteria 2874
252 Ga0501039_0487442 3300049575 Bacteria 968
253 Ga0501042_0009583 3300049578 Bacteria 6461
254 Ga0501043_0022684 3300049579 Bacteria 4922
255 Ga0501047_0011071 3300049581 Bacteria 8536
256 Ga0501047_0677926 3300049581 Bacteria 849
257 Ga0501048_0068645 3300049582 Bacteria 2503
258 Ga0501048_0109964 3300049582 Bacteria 1946
259 Ga0501257_072445 3300049686 Bacteria 881
260 Ga0501035_0019947 3300049822 Bacteria 6158
261 Ga0501035_0144221 3300049822 Bacteria 2069
262 Ga0501035_0567996 3300049822 Bacteria 927
263 Ga0501044_0016081 3300049823 Bacteria 8042
264 Ga0501044_0036755 3300049823 Bacteria 5122
265 Ga0501044_0095789 3300049823 Bacteria 2990
266 nmdc:mga03n38_38927_c1 3300050490 Bacteria 2059
267 nmdc:mga0yw44_108099_c2 3300050492 Bacteria 833
268 nmdc:mga06z11_43143_c1 3300050494 Bacteria 2267
269 nmdc:mga04h51_38476_c1 3300050495 Bacteria 1549
270 Ga0495601_0027787 3300053077 Bacteria 3500
271 Ga0495601_0214192 3300053077 Bacteria 1258
272 Ga0495619_0020042 3300053085 Bacteria 4256
273 Ga0500644_0014521 3300053088 Bacteria 2225
274 Ga0500640_013458 3300053095 Bacteria 3384
275 Ga0500660_081095 3300053100 Bacteria 1484
276 Ga0500553_080330 3300053101 Bacteria 1469
277 Ga0500580_103688 3300053113 Bacteria 1114
278 Ga0500614_004813 3300053123 Bacteria 2839
279 Ga0500573_0054380 3300053140 Bacteria 2298
280 Ga0500573_0067317 3300053140 Bacteria 2047
281 Ga0500603_039218 3300053150 Bacteria 1257
282 Ga0466962_0019361 3300061719 Bacteria 3271
283 Ga0466962_0019634 3300061719 Bacteria 3248
284 2547411639 2547132111 Bacteria 8013147
285 2585305143 2582581313 Bacteria 10042643
286 2585318316 2582581314 Bacteria 11452267
287 2616701480 2616644814 Bacteria 11555299
288 2616903622 2616644941 Bacteria 8510691
289 2643899707 2643221578 Bacteria 9213798
290 2644017104 2643221601 Bacteria 7493239
291 2644173935 2643221631 Bacteria 8168043
292 2644266170 2643221647 Bacteria 10741251
293 2644390180 2643221670 Bacteria 6497041
294 2644403675 2643221673 Bacteria 9196637
295 2644437589 2643221678 Bacteria 9540101
296 2644627953 2643221714 Bacteria 9015452
297 2768642033 2767802112 Bacteria 6465194
298 2784589404 2784132148 Bacteria 8627943
299 2785370483 2784746768 Bacteria 10036182
300 2793980734 2791355406 Bacteria 11364898
301 2804845884 2802429296 Bacteria 7227771
302 2808843044 2808606359 Bacteria 9866990
303 2809233067 2808606448 Bacteria 8656184
304 2811845356 2808606982 Bacteria 7791042
305 2812357079 2811994879 Bacteria 9313447
306 2819698267 2818991463 Bacteria 7948711
307 2819741215 2818991472 Bacteria 10089953
308 2852640058 2852635781 Bacteria 8251373
309 2862179487 2862178590 Bacteria 8583590
310 2862286669 2862281513 Bacteria 9621493
311 2862510263 2862507626 Bacteria 9425308
312 2862578445 2862574272 Bacteria 10567477
313 2862709562 2862705112 Bacteria 6563286
314 2867372984 2867369537 Bacteria 6501581
315 2867435703 2867428634 Bacteria 9590268
316 2867475968 2867475112 Bacteria 6909112
317 2873154958 2873151551 Bacteria 8625867
318 2875394677 2875391855 Bacteria 7600475
319 2877680137 2877676314 Bacteria 9512378
320 2912718727 2912715099 Bacteria 9460473
321 2912731051 2912723979 Bacteria 8557534
322 2912761862 2912757875 Bacteria 7940295
323 2918504616 2918501144 Bacteria 8668083
324 2919471460 2919468124 Bacteria 9133025
325 2935392663 2935390628 Bacteria 7043367
326 2946049958 2946045630 Bacteria 8527308
327 2946068799 2946064051 Bacteria 8957905
328 2946076845 2946072368 Bacteria 8999607
329 2947228111 2947224130 Bacteria 9938529
330 2954005937 2954002825 Bacteria 9173742
331 2954385070 2954380949 Bacteria 10050426
332 2954695888 2954691527 Bacteria 10720516
333 2954711079 2954701450 Bacteria 10834262
334 2954715293 2954711539 Bacteria 10867210
335 2954725234 2954721474 Bacteria 10456478
336 2954736582 2954731030 Bacteria 10243860
337 2954744167 2954740390 Bacteria 10229294
338 2954755431 2954749733 Bacteria 10366972
339 2954763110 2954759201 Bacteria 9358192
340 2966602469 2966598605 Bacteria 7676064
341 2990045594 2990044586 Bacteria 6603797
342 2990089266 2990088156 Bacteria 6657676
343 2995468025 2995463766 Bacteria 8577691
344 2997454276 2997451912 Bacteria 8492419
345 2997600246 2997600082 Bacteria 9896405
346 3006428468 3006425503 Bacteria 6491253
347 3006492243 3006486233 Bacteria 8157040
348 8008485886 8008485437 Bacteria 7198341
349 8008578065 8008574985 Bacteria 7815457
350 8025415814 8025413630 Bacteria 7014048
351 8025479503 8025478263 Bacteria 8209203
352 8025524970 8025524527 Bacteria 7197316
353 8025538144 8025530807 Bacteria 8495698
354 8047897901 8047893842 Bacteria 11723082
355 8048133115 8048127548 Bacteria 11053136
356 8048360993 8048356638 Bacteria 11044339
357 8048374864 8048369669 Bacteria 11666822
358 8048383358 8048379754 Bacteria 11877923
359 8054166944 8054160619 Bacteria 7783213
360 8056454026 8056447290 Bacteria 7680491
361 8056669213 8056667051 Bacteria 6953971
362 8056833228 8056829672 Bacteria 9045328
363 JGI25160J50197_1023247
364 JGI25160J50197_1033705
365 JGI25160J50197_1050966
366 Ga0006562J51391_1036308
367 Ga0006562J51391_1121765
368 Ga0006562J51391_1121767
369 Ga0068856_100291121
370 Ga0075367_10279989
371 Ga0105240_11416379
372 Ga0105245_10116988
373 Ga0105243_10037310
374 Ga0105246_10001835
375 Ga0157369_10084702
376 Ga0157372_10031477
377 Ga0182007_10000526
378 Ga0183367_1015
379 Ga0209758_1010542
380 Ga0207426_1003642
381 Ga0207426_1008113
382 Ga0207426_1026130
383 Ga0207647_10004478
384 Ga0207643_10041887
385 Ga0207687_10045150
386 Ga0207687_10235315
387 Ga0207709_10196407
388 Ga0207678_10112561
389 Ga0209813_10032371
390 Ga0307517_10012587
391 Ga0307515_10001114
392 Ga0307515_10080258
393 Ga0307515_10084633
394 Ga0268256_1016621
395 Ga0307512_10024800
396 Ga0307513_10196208
397 Ga0307509_10128375
398 Ga0307509_10128768
399 Ga0307509_10229392
400 Ga0307508_10015832
401 Ga0307514_10008462
402 Ga0307514_10032610
403 Ga0307514_10037847
404 Ga0307514_10045550
405 Ga0307514_10078436
406 Ga0307516_10008687
407 Ga0307516_10093183
408 Ga0307518_10063133
409 Ga0307410_10168939
410 Ga0307410_10747038
411 Ga0307416_100330524
412 Ga0307416_101097866
413 Ga0307507_10036484
414 Ga0307510_10033810
415 Ga0307510_10211733
416 Ga0395899_0213436
417 Ga0395900_0151255
418 Ga0395900_0814016
419 Ga0395900_0981587
420 Ga0395898_0018706
421 Ga0395898_0047078
422 Ga0395905_0270808
423 Ga0436364_1424714
424 Ga0395901_0179114
425 Ga0439436_0006050
426 Ga0439439_0000554
427 Ga0451853_3823001
428 Ga0439433_0000267
429 Ga0439442_018578
430 Ga0439449_0007088
431 Ga0439457_001481
432 Ga0439457_040002
433 Ga0439462_0025196
434 Ga0439458_0031194
435 Ga0466969_0191983
436 Ga0466972_0001857
437 Ga0466972_0040092
438 Ga0466965_0325441
439 Ga0466966_0218271
440 Ga0466961_0015169
441 Ga0466961_0017644
442 Ga0466963_0137008
443 Ga0466971_0003676
444 Ga0466970_0008127
445 Ga0466970_0145370
446 Ga0466960_0007800
447 Ga0466960_0216204
448 Ga0466959_0009781
449 Ga0466958_0083029
450 Ga0466967_0021592
451 Ga0495592_0008676
452 Ga0495592_0020948
453 Ga0495592_0085600
454 Ga0495603_0005199
455 Ga0495603_0005365
456 Ga0495603_0206286
457 Ga0495590_0101678
458 Ga0495629_0013418
459 Ga0495629_0019785
460 Ga0495629_0039860
461 Ga0495629_0048425
462 Ga0495629_0214326
463 Ga0495651_0000452
464 Ga0495651_0014333
465 Ga0495653_0015562
466 Ga0495653_0134323
467 Ga0495580_0005367
468 Ga0495662_0000295
469 Ga0495662_0000594
470 Ga0495662_0072531
471 Ga0495664_0000447
472 Ga0495664_0009031
473 Ga0495584_0094499
474 Ga0495594_0000428
475 Ga0495594_0006912
476 Ga0495594_0284962
477 Ga0495594_0410325
478 Ga0495607_0173485
479 Ga0495583_0114252
480 Ga0495583_0299067
481 Ga0495608_0002684
482 Ga0495610_0078819
483 Ga0495618_0020423
484 Ga0495618_0047298
485 Ga0495618_0211908
486 Ga0495620_0043993
487 Ga0495628_0051523
488 Ga0495628_0057080
489 Ga0495628_0802404
490 Ga0495630_0031034
491 Ga0495631_0034323
492 Ga0495631_0039117
493 Ga0495643_0012515
494 Ga0495648_0038823
495 Ga0495666_0000558
496 Ga0495642_0079256
497 Ga0495652_0006292
498 Ga0495652_0042387
499 Ga0495652_0788772
500 Ga0495665_0012118
501 Ga0495640_0019300
502 Ga0495586_0001586
503 Ga0495586_0117810
504 Ga0495587_0000644
505 Ga0495587_0006714
506 Ga0495645_0007656
507 Ga0495645_0024175
508 Ga0495645_0084794
509 Ga0495645_0161895
510 Ga0495622_0007748
511 Ga0495622_0273714
512 Ga0495667_0212381
513 Ga0495667_0337122
514 Ga0495634_0000804
515 Ga0495634_0040901
516 Ga0495634_0081157
517 Ga0495611_0211398
518 Ga0495611_0217501
519 Ga0495625_0009340
520 Ga0495625_0133484
521 Ga0495635_0022293
522 Ga0495635_0038619
523 Ga0495635_0112149
524 Ga0495588_0004337
525 Ga0495588_0042450
526 Ga0495588_0296037
527 Ga0495657_0014700
528 Ga0495657_0018804
529 Ga0495657_0052496
530 Ga0495599_0015293
531 Ga0495599_0175593
532 Ga0495599_0234269
533 Ga0495623_0037248
534 Ga0495623_0107912
535 Ga0495646_0000131
536 Ga0495646_0003153
537 Ga0495646_0133746
538 Ga0495658_0009989
539 Ga0495613_0000387
540 Ga0495613_0000838
541 Ga0495613_0009859
542 Ga0495613_0019541
543 Ga0495613_0039200
544 Ga0495613_0133681
545 Ga0495613_0332715
546 Ga0495670_0019839
547 Ga0495671_0017683
548 Ga0495649_0036513
549 Ga0495589_0004926
550 Ga0495589_0015671
551 Ga0495589_0090134
552 Ga0495600_0014590
553 Ga0495600_0049340
554 Ga0495600_0526507
555 Ga0495581_0002564
556 Ga0495581_0004459
557 Ga0495581_0159433
558 Ga0495581_0396904
559 Ga0495604_0000385
560 Ga0495604_0002049
561 Ga0495636_0009043
562 Ga0495636_0015289
563 Ga0495636_0101048
564 Ga0495636_0192046
565 Ga0495636_0294346
566 Ga0495674_0283907
567 Ga0495672_0328504
568 Ga0495676_0006399
569 Ga0495676_0018648
570 Ga0495676_0041155
571 Ga0495676_0113231
572 Ga0495680_0008962
573 Ga0495683_0045077
574 Ga0495687_001389
575 Ga0495687_018465
576 Ga0495687_034087
577 Ga0495687_036692
578 Ga0495687_158272
579 Ga0495675_0018911
580 Ga0495675_0047009
581 Ga0495675_0078842
582 Ga0495677_0128439
583 Ga0495685_010959
584 Ga0495685_015908
585 Ga0495685_054218
586 Ga0495685_125061
587 Ga0495684_0426136
588 Ga0495686_0037377
589 Ga0495593_0019228
590 Ga0495593_0065085
591 Ga0495602_0019221
592 Ga0495602_0107656
593 Ga0495614_0000388
594 Ga0495614_0030230
595 Ga0495614_0077995
596 Ga0495614_0105849
597 Ga0496102_0622039
598 Ga0496109_0311658
599 Ga0501323_000903
600 Ga0501031_0014106
601 Ga0501031_0379194
602 Ga0501032_0015155
603 Ga0501033_0003676
604 Ga0501033_0248784
605 Ga0501034_0032795
606 Ga0501034_0078121
607 Ga0501034_0161883
608 Ga0501036_0048326
609 Ga0501036_1044782
610 Ga0501037_0014639
611 Ga0501037_0122216
612 Ga0501038_0054996
613 Ga0501039_0062980
614 Ga0501039_0487442
615 Ga0501042_0009583
616 Ga0501043_0022684
617 Ga0501047_0011071
618 Ga0501047_0677926
619 Ga0501048_0068645
620 Ga0501048_0109964
621 Ga0501257_072445
622 Ga0501035_0019947
623 Ga0501035_0144221
624 Ga0501035_0567996
625 Ga0501044_0016081
626 Ga0501044_0036755
627 Ga0501044_0095789
628 nmdc:mga03n38_38927_c1
629 nmdc:mga0yw44_108099_c2
630 nmdc:mga06z11_43143_c1
631 nmdc:mga04h51_38476_c1
632 Ga0495601_0027787
633 Ga0495601_0214192
634 Ga0495619_0020042
635 Ga0500644_0014521
636 Ga0500640_013458
637 Ga0500660_081095
638 Ga0500553_080330
639 Ga0500580_103688
640 Ga0500614_004813
641 Ga0500573_0054380
642 Ga0500573_0067317
643 Ga0500603_039218
644 Ga0466962_0019361
645 Ga0466962_0019634
646 2547411639
647 2585305143
648 2585318316
649 2616701480
650 2616903622
651 2643899707
652 2644017104
653 2644173935
654 2644266170
655 2644390180
656 2644403675
657 2644437589
658 2644627953
659 2768642033
660 2784589404
661 2785370483
662 2793980734
663 2804845884
664 2808843044
665 2809233067
666 2811845356
667 2812357079
668 2819698267
669 2819741215
670 2852640058
671 2862179487
672 2862286669
673 2862510263
674 2862578445
675 2862709562
676 2867372984
677 2867435703
678 2867475968
679 2873154958
680 2875394677
681 2877680137
682 2912718727
683 2912731051
684 2912761862
685 2918504616
686 2919471460
687 2935392663
688 2946049958
689 2946068799
690 2946076845
691 2947228111
692 2954005937
693 2954385070
694 2954695888
695 2954711079
696 2954715293
697 2954725234
698 2954736582
699 2954744167
700 2954755431
701 2954763110
702 2966602469
703 2990045594
704 2990089266
705 2995468025
706 2997454276
707 2997600246
708 3006428468
709 3006492243
710 8008485886
711 8008578065
712 8025415814
713 8025479503
714 8025524970
715 8025538144
716 8047897901
717 8048133115
718 8048360993
719 8048374864
720 8048383358
721 8054166944
722 8056454026
723 8056669213
724 8056833228

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01288

HPPK

7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)

51

181

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ilo-assembly1.cif.gz_A crystal structure of e. coli hppk(d97a) in complex with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin 0.9435 47 202
4m5j-assembly1.cif.gz_A the identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase 0.9431 46 202
3kuh-assembly1.cif.gz_A crystal structure of e. coli hppk(h115a) in complex with ampcpp and hp 0.9408 47 202
6an4-assembly1.cif.gz_A crystal structure of escherichia coli hppk in complex with bisubstrate analogue inhibitor hp-39 (j1f) 0.9386 47 202
1tmm-assembly1.cif.gz_A crystal structure of ternary complex of e.coli hppk(w89a) with mgampcpp and 6-hydroxymethylpterin 0.9379 47 202
ID Description Score Start End Superfamily
af_Q54YD9_144_293_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.941 46 194 3.30.70.560
3mcoA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9183 46 202 3.30.70.560
af_Q54YD9_144_293_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9109 46 194 3.30.70.560
af_Q4LB35_295_465_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9099 46 201 3.30.70.560
3mcmB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9001 46 202 3.30.70.560
ID Description Score Start End GO Terms
AF-A0A522VVI8-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3) (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase) (7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase) 0.9778 46 147 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-D3HSM6-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3) (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase) (7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase) 0.975 46 180 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A433K2Y0-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3) (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase) (7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase) 0.9737 46 175 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A350J538-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9729 46 157 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A1W9RBK4-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9707 44 179 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656

Map