F422307

General Info

Members Datasets Scaffolds Average Seq Length
361 150 722 165

Family's Representative Sequence

Representative Sequence 3300042157|Ga0439458_0027093|Ga0439458_0027093_160_660
Length 166
Sequence MTKKQARLLSERAIDQGIASTSNMGSTRAARSVTINVTESPLGWLFARGLVSRRQYDAGERLRSDWERAQLAPRVTMAWGAAAVAKGRVGGSAAEPDLTGAQMDAKRRFSDAVASAGPGLADILWRVVCAGEGMRDAETALGWPARPGKLVLILALDRVVDYYRIP

Samples

Sample ID Description Type Environment
1 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
126 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
127 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
128 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
129 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
141 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
142 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
143 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
144 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
145 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
146 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
147 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
148 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
149 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
150 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.78
Metatranscriptomes 2.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 0
Rhizosphere 99.17
Stem 0
Stem Tuber 0
Unclassified 10.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439458_0027093 3300042157 Bacteria 1351
2 rootH2_10078251 3300003320 Bacteria 2460
3 rootL2_10264467 3300003322 Bacteria 2222
4 Ga0065715_10168971 3300005293 Bacteria 1562
5 Ga0070658_10016337 3300005327 Bacteria 5940
6 Ga0070658_10089792 3300005327 Bacteria 2530
7 Ga0070658_10099190 3300005327 Bacteria 2407
8 Ga0070658_10619480 3300005327 Bacteria 938
9 Ga0070676_10099598 3300005328 Bacteria 1793
10 Ga0070676_10384743 3300005328 Bacteria 972
11 Ga0070683_100009633 3300005329 Bacteria 8268
12 Ga0070683_100149466 3300005329 Bacteria 2214
13 Ga0070683_100325948 3300005329 Bacteria 1462
14 Ga0070670_100124078 3300005331 Bacteria 2229
15 Ga0070677_10590992 3300005333 Unclassified 613
16 Ga0070677_10727393 3300005333 Unclassified 561
17 Ga0070666_10018963 3300005335 Bacteria 4433
18 Ga0070666_10044936 3300005335 Bacteria 2961
19 Ga0070666_10172081 3300005335 Unclassified 1517
20 Ga0070666_10262236 3300005335 Bacteria 1225
21 Ga0070680_100002495 3300005336 Bacteria 13637
22 Ga0070680_100137591 3300005336 Bacteria 2047
23 Ga0070660_100059867 3300005339 Bacteria 2954
24 Ga0070660_100086399 3300005339 Bacteria 2468
25 Ga0070660_100086828 3300005339 Bacteria 2462
26 Ga0070660_100088464 3300005339 Bacteria 2439
27 Ga0070689_100440763 3300005340 Bacteria 1107
28 Ga0070661_100011642 3300005344 Bacteria 6133
29 Ga0070661_100057159 3300005344 Bacteria 2859
30 Ga0070661_100095649 3300005344 Unclassified 2203
31 Ga0070661_100105163 3300005344 Bacteria 2104
32 Ga0070661_100274470 3300005344 Bacteria 1306
33 Ga0070661_100442214 3300005344 Bacteria 1033
34 Ga0070668_100196731 3300005347 Bacteria 1653
35 Ga0070668_100235326 3300005347 Bacteria 1516
36 Ga0070668_100279796 3300005347 Bacteria 1393
37 Ga0070669_100085431 3300005353 Bacteria 2356
38 Ga0070669_100778218 3300005353 Unclassified 812
39 Ga0070675_100003957 3300005354 Bacteria 11235
40 Ga0070675_100507774 3300005354 Unclassified 1087
41 Ga0070671_100000659 3300005355 Bacteria 24798
42 Ga0070671_101040182 3300005355 Bacteria 718
43 Ga0070673_100632188 3300005364 Bacteria 978
44 Ga0070659_100003958 3300005366 Bacteria 10541
45 Ga0070659_100069502 3300005366 Bacteria 2795
46 Ga0070659_100350847 3300005366 Bacteria 1238
47 Ga0070659_101106293 3300005366 Bacteria 698
48 Ga0070667_100025265 3300005367 Bacteria 4938
49 Ga0070667_100136782 3300005367 Bacteria 2143
50 Ga0070709_10236757 3300005434 Bacteria 1309
51 Ga0070713_100302770 3300005436 Bacteria 1472
52 Ga0070713_100306878 3300005436 Bacteria 1462
53 Ga0070713_100903146 3300005436 Bacteria 850
54 Ga0070663_100000895 3300005455 Bacteria 16190
55 Ga0070663_100114850 3300005455 Bacteria 2027
56 Ga0070663_100166693 3300005455 Bacteria 1700
57 Ga0070663_100427512 3300005455 Bacteria 1087
58 Ga0070663_100956340 3300005455 Bacteria 743
59 Ga0070678_100213127 3300005456 Archaea 1601
60 Ga0070662_100018759 3300005457 Bacteria 4684
61 Ga0070662_100193662 3300005457 Bacteria 1609
62 Ga0070681_10002458 3300005458 Bacteria 16970
63 Ga0070681_10095846 3300005458 Bacteria 2916
64 Ga0070681_10231207 3300005458 Bacteria 1764
65 Ga0068867_100313292 3300005459 Bacteria 1297
66 Ga0070679_100000947 3300005530 Bacteria 25222
67 Ga0070679_100107127 3300005530 Bacteria 2781
68 Ga0070679_100236200 3300005530 Bacteria 1787
69 Ga0070679_100290135 3300005530 Bacteria 1587
70 Ga0070679_100463854 3300005530 Bacteria 1211
71 Ga0070684_100025892 3300005535 Bacteria 4936
72 Ga0070684_100080997 3300005535 Bacteria 2872
73 Ga0068853_100143604 3300005539 Bacteria 2144
74 Ga0068853_100160788 3300005539 Bacteria 2027
75 Ga0068853_100166100 3300005539 Bacteria 1994
76 Ga0068853_100961289 3300005539 Bacteria 822
77 Ga0070686_100535788 3300005544 Unclassified 914
78 Ga0070695_100063814 3300005545 Bacteria 2395
79 Ga0070665_100369522 3300005548 Bacteria 1441
80 Ga0070665_101075155 3300005548 Unclassified 816
81 Ga0068855_100114811 3300005563 Bacteria 3087
82 Ga0068855_100169329 3300005563 Bacteria 2474
83 Ga0070664_100001431 3300005564 Bacteria 19035
84 Ga0070664_100022762 3300005564 Bacteria 5169
85 Ga0070664_100082451 3300005564 Bacteria 2773
86 Ga0070664_100210575 3300005564 Bacteria 1737
87 Ga0068857_100049513 3300005577 Bacteria 3727
88 Ga0068857_100103388 3300005577 Bacteria 2558
89 Ga0068854_100028745 3300005578 Bacteria 3844
90 Ga0068854_100067854 3300005578 Bacteria 2599
91 Ga0068854_100116916 3300005578 Bacteria 2019
92 Ga0068854_100129582 3300005578 Bacteria 1925
93 Ga0068854_101259118 3300005578 Bacteria 664
94 Ga0068856_100057461 3300005614 Bacteria 3841
95 Ga0068856_100141152 3300005614 Bacteria 2416
96 Ga0068856_101084168 3300005614 Bacteria 818
97 Ga0068852_100001175 3300005616 Bacteria 17321
98 Ga0068852_100043248 3300005616 Bacteria 3819
99 Ga0068852_100260994 3300005616 Bacteria 1663
100 Ga0068852_100464428 3300005616 Unclassified 1255
101 Ga0068852_100517599 3300005616 Bacteria 1190
102 Ga0068852_100620641 3300005616 Unclassified 1087
103 Ga0068852_101423764 3300005616 Unclassified 715
104 Ga0068859_100013726 3300005617 Bacteria 8123
105 Ga0068851_10077834 3300005834 Bacteria 1727
106 Ga0068851_10165814 3300005834 Bacteria 1216
107 Ga0068863_100179712 3300005841 Bacteria 2031
108 Ga0068858_100502426 3300005842 Bacteria 1172
109 Ga0068860_100417626 3300005843 Unclassified 1329
110 Ga0068862_100101966 3300005844 Bacteria 2511
111 Ga0068862_100174638 3300005844 Bacteria 1925
112 Ga0068862_100841376 3300005844 Bacteria 899
113 Ga0081539_10042892 3300005985 Bacteria 2629
114 Ga0070717_10445169 3300006028 Bacteria 1167
115 Ga0070712_100131730 3300006175 Bacteria 1896
116 Ga0097620_100013726 3300006931 Bacteria 8123
117 Ga0105240_10020495 3300009093 Bacteria 8816
118 Ga0105240_11696135 3300009093 Bacteria 660
119 Ga0105248_10253631 3300009177 Bacteria 1980
120 Ga0105238_10085047 3300009551 Bacteria 3152
121 Ga0105238_10241434 3300009551 Bacteria 1784
122 Ga0157373_10045184 3300013100 Bacteria 3145
123 Ga0157373_10103310 3300013100 Bacteria 2005
124 Ga0157373_10158549 3300013100 Unclassified 1592
125 Ga0157371_10043557 3300013102 Bacteria 3197
126 Ga0157370_10057124 3300013104 Bacteria 3713
127 Ga0157370_10701657 3300013104 Unclassified 924
128 Ga0157369_10183721 3300013105 Bacteria 2199
129 Ga0157369_10352006 3300013105 Bacteria 1530
130 Ga0157369_10373274 3300013105 Bacteria 1481
131 Ga0157369_10673928 3300013105 Bacteria 1066
132 Ga0157378_10011521 3300013297 Bacteria 7741
133 Ga0157372_10286904 3300013307 Bacteria 1914
134 Ga0157375_10676080 3300013308 Bacteria 1187
135 Ga0182008_10249185 3300014497 Bacteria 916
136 Ga0197907_10823380 3300020069 Bacteria 1469
137 Ga0206356_10523767 3300020070 Bacteria 1498
138 Ga0206354_10389409 3300020081 Unclassified 786
139 Ga0206354_11648204 3300020081 Bacteria 1037
140 Ga0206353_10742887 3300020082 Unclassified 1086
141 Ga0206353_11163782 3300020082 Bacteria 2356
142 Ga0206353_11980474 3300020082 Bacteria 717
143 Ga0224712_10157128 3300022467 Bacteria 1012
144 Ga0207656_10044687 3300025321 Bacteria 1892
145 Ga0207656_10165478 3300025321 Bacteria 1055
146 Ga0207682_10008668 3300025893 Bacteria 4021
147 Ga0207688_10011182 3300025901 Bacteria 4888
148 Ga0207680_10068378 3300025903 Bacteria 2191
149 Ga0207680_10105806 3300025903 Unclassified 1816
150 Ga0207680_10222801 3300025903 Bacteria 1294
151 Ga0207680_10549758 3300025903 Bacteria 824
152 Ga0207647_10008882 3300025904 Bacteria 7167
153 Ga0207647_10037979 3300025904 Bacteria 3048
154 Ga0207647_10056461 3300025904 Bacteria 2409
155 Ga0207647_10243577 3300025904 Unclassified 1032
156 Ga0207699_10222444 3300025906 Bacteria 1289
157 Ga0207705_10000411 3300025909 Bacteria 37615
158 Ga0207705_10004859 3300025909 Bacteria 10090
159 Ga0207705_10082381 3300025909 Bacteria 2346
160 Ga0207705_10132861 3300025909 Bacteria 1853
161 Ga0207705_10404512 3300025909 Bacteria 1056
162 Ga0207705_11170238 3300025909 Bacteria 591
163 Ga0207707_10107058 3300025912 Bacteria 2444
164 Ga0207707_10485120 3300025912 Bacteria 1055
165 Ga0207695_10025811 3300025913 Bacteria 6568
166 Ga0207693_10025397 3300025915 Bacteria 4698
167 Ga0207660_10005087 3300025917 Bacteria 8563
168 Ga0207660_10005391 3300025917 Bacteria 8301
169 Ga0207657_10006435 3300025919 Bacteria 12177
170 Ga0207657_10015454 3300025919 Bacteria 7395
171 Ga0207657_10036409 3300025919 Bacteria 4405
172 Ga0207657_10103483 3300025919 Bacteria 2360
173 Ga0207657_10278012 3300025919 Bacteria 1330
174 Ga0207649_10010742 3300025920 Bacteria 5034
175 Ga0207649_10069507 3300025920 Bacteria 2243
176 Ga0207649_10117964 3300025920 Bacteria 1785
177 Ga0207649_10123902 3300025920 Bacteria 1746
178 Ga0207649_10141772 3300025920 Bacteria 1645
179 Ga0207649_10250202 3300025920 Bacteria 1276
180 Ga0207652_10000920 3300025921 Bacteria 27721
181 Ga0207652_10162973 3300025921 Bacteria 1999
182 Ga0207652_10378721 3300025921 Bacteria 1277
183 Ga0207650_10493658 3300025925 Unclassified 1022
184 Ga0207650_10612112 3300025925 Bacteria 916
185 Ga0207700_10395675 3300025928 Bacteria 1210
186 Ga0207700_10459178 3300025928 Bacteria 1123
187 Ga0207664_10079086 3300025929 Bacteria 2668
188 Ga0207690_10027189 3300025932 Bacteria 3613
189 Ga0207690_10063435 3300025932 Bacteria 2519
190 Ga0207690_10177435 3300025932 Bacteria 1601
191 Ga0207690_10289757 3300025932 Bacteria 1277
192 Ga0207706_10013574 3300025933 Bacteria 7401
193 Ga0207706_10015283 3300025933 Bacteria 6942
194 Ga0207706_10088494 3300025933 Bacteria 2722
195 Ga0207706_10104259 3300025933 Bacteria 2495
196 Ga0207670_10458452 3300025936 Bacteria 1029
197 Ga0207691_10003436 3300025940 Bacteria 15408
198 Ga0207689_10094336 3300025942 Bacteria 2458
199 Ga0207661_10005358 3300025944 Bacteria 9034
200 Ga0207661_10006845 3300025944 Bacteria 8079
201 Ga0207661_10544659 3300025944 Bacteria 1063
202 Ga0207679_10104750 3300025945 Bacteria 2220
203 Ga0207667_10014526 3300025949 Bacteria 8974
204 Ga0207667_10718651 3300025949 Bacteria 1000
205 Ga0207668_10339462 3300025972 Bacteria 1253
206 Ga0207640_10004827 3300025981 Bacteria 7323
207 Ga0207640_10222297 3300025981 Bacteria 1447
208 Ga0207640_10323776 3300025981 Bacteria 1228
209 Ga0207640_10676417 3300025981 Unclassified 882
210 Ga0207658_10020014 3300025986 Bacteria 4632
211 Ga0207658_10154719 3300025986 Unclassified 1872
212 Ga0207658_10226934 3300025986 Bacteria 1574
213 Ga0207703_10042229 3300026035 Bacteria 3657
214 Ga0207639_10071946 3300026041 Bacteria 2706
215 Ga0207639_10147140 3300026041 Bacteria 1969
216 Ga0207639_10150040 3300026041 Bacteria 1951
217 Ga0207639_10597817 3300026041 Unclassified 1017
218 Ga0207678_10000439 3300026067 Bacteria 37786
219 Ga0207678_10029360 3300026067 Bacteria 4799
220 Ga0207678_10043291 3300026067 Bacteria 3896
221 Ga0207678_10298690 3300026067 Bacteria 1384
222 Ga0207678_10643076 3300026067 Bacteria 931
223 Ga0207702_10045309 3300026078 Bacteria 3700
224 Ga0207702_10198048 3300026078 Bacteria 1860
225 Ga0207702_11764380 3300026078 Bacteria 611
226 Ga0207641_10234612 3300026088 Unclassified 1707
227 Ga0207674_10008911 3300026116 Bacteria 11530
228 Ga0207674_10089985 3300026116 Bacteria 3061
229 Ga0207675_101825079 3300026118 Unclassified 627
230 Ga0207683_10005676 3300026121 Bacteria 10700
231 Ga0207698_10012227 3300026142 Bacteria 5607
232 Ga0207698_10013479 3300026142 Bacteria 5394
233 Ga0207698_10707414 3300026142 Bacteria 1003
234 Ga0207698_10749812 3300026142 Bacteria 975
235 Ga0207698_10815078 3300026142 Unclassified 936
236 Ga0207698_10939477 3300026142 Bacteria 873
237 Ga0207698_11350747 3300026142 Bacteria 727
238 Ga0268266_10251421 3300028379 Bacteria 1635
239 Ga0268266_10868569 3300028379 Unclassified 872
240 Ga0268265_10109314 3300028380 Bacteria 2253
241 Ga0268265_10214104 3300028380 Bacteria 1681
242 Ga0316182_1306404 3300030745 Bacteria 1507
243 Ga0307408_100003754 3300031548 Bacteria 10341
244 Ga0307408_100501952 3300031548 Bacteria 1062
245 Ga0307408_101234235 3300031548 Unclassified 698
246 Ga0307408_101628354 3300031548 Bacteria 613
247 Ga0307405_10099700 3300031731 Bacteria 1945
248 Ga0307405_10749124 3300031731 Bacteria 813
249 Ga0307405_10994733 3300031731 Bacteria 715
250 Ga0307413_10053338 3300031824 Bacteria 2447
251 Ga0307413_10122606 3300031824 Bacteria 1763
252 Ga0307413_11149644 3300031824 Bacteria 673
253 Ga0307410_10022098 3300031852 Bacteria 3926
254 Ga0307410_10036588 3300031852 Bacteria 3198
255 Ga0307410_10110702 3300031852 Bacteria 1986
256 Ga0307410_10806249 3300031852 Unclassified 799
257 Ga0307406_10042361 3300031901 Bacteria 2842
258 Ga0307406_10195486 3300031901 Bacteria 1485
259 Ga0307406_10353383 3300031901 Bacteria 1149
260 Ga0307407_10017768 3300031903 Bacteria 3579
261 Ga0307407_10035851 3300031903 Bacteria 2728
262 Ga0307407_10084595 3300031903 Bacteria 1928
263 Ga0307412_10050148 3300031911 Bacteria 2754
264 Ga0307412_10061741 3300031911 Bacteria 2520
265 Ga0307412_10320298 3300031911 Bacteria 1233
266 Ga0307409_100002567 3300031995 Bacteria 9540
267 Ga0307409_100007625 3300031995 Bacteria 6490
268 Ga0307409_100037297 3300031995 Bacteria 3582
269 Ga0307409_100045130 3300031995 Bacteria 3325
270 Ga0307409_100093175 3300031995 Bacteria 2474
271 Ga0307409_100393104 3300031995 Unclassified 1322
272 Ga0307409_100844676 3300031995 Unclassified 926
273 Ga0307416_100003438 3300032002 Bacteria 9303
274 Ga0307416_100017253 3300032002 Bacteria 5044
275 Ga0307416_100110442 3300032002 Bacteria 2421
276 Ga0307416_100256018 3300032002 Bacteria 1707
277 Ga0307416_100971046 3300032002 Bacteria 952
278 Ga0307416_101842646 3300032002 Bacteria 709
279 Ga0307414_10050704 3300032004 Bacteria 2876
280 Ga0307414_10451152 3300032004 Bacteria 1128
281 Ga0307414_11674387 3300032004 Bacteria 593
282 Ga0307411_10011300 3300032005 Bacteria 4812
283 Ga0307411_10079442 3300032005 Bacteria 2252
284 Ga0307411_10125866 3300032005 Bacteria 1864
285 Ga0307411_10132438 3300032005 Bacteria 1824
286 Ga0307411_10297823 3300032005 Unclassified 1292
287 Ga0307411_11479979 3300032005 Unclassified 623
288 Ga0307415_100007038 3300032126 Bacteria 6119
289 Ga0307415_100058072 3300032126 Bacteria 2662
290 Ga0307415_100234575 3300032126 Bacteria 1480
291 Ga0373931_0594614 3300035691 Bacteria 723
292 Ga0395899_0098756 3300037312 Bacteria 2109
293 Ga0395899_0105839 3300037312 Bacteria 2026
294 Ga0395899_0253022 3300037312 Unclassified 1208
295 Ga0395900_0011149 3300037418 Bacteria 9188
296 Ga0395900_0034108 3300037418 Bacteria 5239
297 Ga0395900_0061338 3300037418 Bacteria 3866
298 Ga0395900_0171241 3300037418 Bacteria 2210
299 Ga0395900_0192353 3300037418 Bacteria 2069
300 Ga0395900_0281718 3300037418 Bacteria 1654
301 Ga0395900_0383612 3300037418 Bacteria 1373
302 Ga0395900_0479176 3300037418 Bacteria 1197
303 Ga0395898_0034433 3300037466 Bacteria 5048
304 Ga0395898_0161658 3300037466 Bacteria 2142
305 Ga0395898_0378249 3300037466 Bacteria 1350
306 Ga0395898_0931995 3300037466 Unclassified 806
307 Ga0395905_0024148 3300037471 Bacteria 5738
308 Ga0395905_0024791 3300037471 Bacteria 5660
309 Ga0395905_0029510 3300037471 Bacteria 5167
310 Ga0395905_0047432 3300037471 Bacteria 4026
311 Ga0395905_0069718 3300037471 Bacteria 3293
312 Ga0395905_0091962 3300037471 Bacteria 2844
313 Ga0395905_0179717 3300037471 Bacteria 1986
314 Ga0395905_0183926 3300037471 Bacteria 1962
315 Ga0395905_0310516 3300037471 Unclassified 1465
316 Ga0395905_0481579 3300037471 Bacteria 1140
317 Ga0395905_0654398 3300037471 Bacteria 953
318 Ga0395905_0669253 3300037471 Bacteria 940
319 Ga0395905_1458492 3300037471 Bacteria 588
320 Ga0395901_0060109 3300038443 Bacteria 3954
321 Ga0395901_0075822 3300038443 Bacteria 3508
322 Ga0395901_0092540 3300038443 Bacteria 3165
323 Ga0395901_0189134 3300038443 Bacteria 2159
324 Ga0395901_0245650 3300038443 Bacteria 1866
325 Ga0395901_0290067 3300038443 Bacteria 1698
326 Ga0395901_0471002 3300038443 Bacteria 1282
327 Ga0395901_0610737 3300038443 Bacteria 1098
328 Ga0395901_0782865 3300038443 Unclassified 944
329 Ga0439449_0268891 3300042007 Bacteria 642
330 Ga0450920_075514 3300042122 Bacteria 688
331 Ga0450899_031785 3300042135 Bacteria 643
332 Ga0450905_005829 3300042142 Bacteria 1655
333 Ga0450906_039298 3300042145 Bacteria 835
334 Ga0439458_0000136 3300042157 Bacteria 15596
335 Ga0466965_0125312 3300044683 Bacteria 1329
336 Ga0466966_0176898 3300044684 Bacteria 1295
337 Ga0466971_0236693 3300044719 Bacteria 868
338 Ga0466957_0092046 3300044842 Bacteria 1901
339 Ga0466957_0208744 3300044842 Bacteria 1285
340 Ga0466967_0061921 3300045976 Bacteria 3320
341 Ga0466967_0205780 3300045976 Bacteria 1865
342 Ga0466967_0324820 3300045976 Bacteria 1485
343 Ga0495583_0191194 3300046506 Bacteria 835
344 Ga0495620_0054999 3300046515 Bacteria 1679
345 Ga0495642_0087184 3300046528 Bacteria 1319
346 Ga0495668_0003882 3300046616 Bacteria 10912
347 Ga0495669_0024687 3300046684 Bacteria 2618
348 Ga0495669_0056758 3300046684 Bacteria 1765
349 Ga0495669_0103449 3300046684 Bacteria 1324
350 Ga0495669_0142805 3300046684 Bacteria 1130
351 Ga0495677_0034155 3300047445 Bacteria 1855
352 Ga0501202_030603 3300049652 Unclassified 1121
353 Ga0501209_189634 3300049656 Bacteria 630
354 Ga0501224_008390 3300049664 Bacteria 1507
355 Ga0501233_023451 3300049668 Unclassified 1341
356 Ga0501235_011380 3300049669 Bacteria 1952
357 Ga0501234_009953 3300049707 Bacteria 1483
358 Ga0501268_019111 3300049765 Bacteria 1158
359 Ga0501273_031058 3300049770 Unclassified 760
360 Ga0495655_0030799 3300053083 Bacteria 1301
361 Ga0500658_0000126 3300053134 Bacteria 36382
362 Ga0439458_0027093
363 rootH2_10078251
364 rootL2_10264467
365 Ga0065715_10168971
366 Ga0070658_10016337
367 Ga0070658_10089792
368 Ga0070658_10099190
369 Ga0070658_10619480
370 Ga0070676_10099598
371 Ga0070676_10384743
372 Ga0070683_100009633
373 Ga0070683_100149466
374 Ga0070683_100325948
375 Ga0070670_100124078
376 Ga0070677_10590992
377 Ga0070677_10727393
378 Ga0070666_10018963
379 Ga0070666_10044936
380 Ga0070666_10172081
381 Ga0070666_10262236
382 Ga0070680_100002495
383 Ga0070680_100137591
384 Ga0070660_100059867
385 Ga0070660_100086399
386 Ga0070660_100086828
387 Ga0070660_100088464
388 Ga0070689_100440763
389 Ga0070661_100011642
390 Ga0070661_100057159
391 Ga0070661_100095649
392 Ga0070661_100105163
393 Ga0070661_100274470
394 Ga0070661_100442214
395 Ga0070668_100196731
396 Ga0070668_100235326
397 Ga0070668_100279796
398 Ga0070669_100085431
399 Ga0070669_100778218
400 Ga0070675_100003957
401 Ga0070675_100507774
402 Ga0070671_100000659
403 Ga0070671_101040182
404 Ga0070673_100632188
405 Ga0070659_100003958
406 Ga0070659_100069502
407 Ga0070659_100350847
408 Ga0070659_101106293
409 Ga0070667_100025265
410 Ga0070667_100136782
411 Ga0070709_10236757
412 Ga0070713_100302770
413 Ga0070713_100306878
414 Ga0070713_100903146
415 Ga0070663_100000895
416 Ga0070663_100114850
417 Ga0070663_100166693
418 Ga0070663_100427512
419 Ga0070663_100956340
420 Ga0070678_100213127
421 Ga0070662_100018759
422 Ga0070662_100193662
423 Ga0070681_10002458
424 Ga0070681_10095846
425 Ga0070681_10231207
426 Ga0068867_100313292
427 Ga0070679_100000947
428 Ga0070679_100107127
429 Ga0070679_100236200
430 Ga0070679_100290135
431 Ga0070679_100463854
432 Ga0070684_100025892
433 Ga0070684_100080997
434 Ga0068853_100143604
435 Ga0068853_100160788
436 Ga0068853_100166100
437 Ga0068853_100961289
438 Ga0070686_100535788
439 Ga0070695_100063814
440 Ga0070665_100369522
441 Ga0070665_101075155
442 Ga0068855_100114811
443 Ga0068855_100169329
444 Ga0070664_100001431
445 Ga0070664_100022762
446 Ga0070664_100082451
447 Ga0070664_100210575
448 Ga0068857_100049513
449 Ga0068857_100103388
450 Ga0068854_100028745
451 Ga0068854_100067854
452 Ga0068854_100116916
453 Ga0068854_100129582
454 Ga0068854_101259118
455 Ga0068856_100057461
456 Ga0068856_100141152
457 Ga0068856_101084168
458 Ga0068852_100001175
459 Ga0068852_100043248
460 Ga0068852_100260994
461 Ga0068852_100464428
462 Ga0068852_100517599
463 Ga0068852_100620641
464 Ga0068852_101423764
465 Ga0068859_100013726
466 Ga0068851_10077834
467 Ga0068851_10165814
468 Ga0068863_100179712
469 Ga0068858_100502426
470 Ga0068860_100417626
471 Ga0068862_100101966
472 Ga0068862_100174638
473 Ga0068862_100841376
474 Ga0081539_10042892
475 Ga0070717_10445169
476 Ga0070712_100131730
477 Ga0097620_100013726
478 Ga0105240_10020495
479 Ga0105240_11696135
480 Ga0105248_10253631
481 Ga0105238_10085047
482 Ga0105238_10241434
483 Ga0157373_10045184
484 Ga0157373_10103310
485 Ga0157373_10158549
486 Ga0157371_10043557
487 Ga0157370_10057124
488 Ga0157370_10701657
489 Ga0157369_10183721
490 Ga0157369_10352006
491 Ga0157369_10373274
492 Ga0157369_10673928
493 Ga0157378_10011521
494 Ga0157372_10286904
495 Ga0157375_10676080
496 Ga0182008_10249185
497 Ga0197907_10823380
498 Ga0206356_10523767
499 Ga0206354_10389409
500 Ga0206354_11648204
501 Ga0206353_10742887
502 Ga0206353_11163782
503 Ga0206353_11980474
504 Ga0224712_10157128
505 Ga0207656_10044687
506 Ga0207656_10165478
507 Ga0207682_10008668
508 Ga0207688_10011182
509 Ga0207680_10068378
510 Ga0207680_10105806
511 Ga0207680_10222801
512 Ga0207680_10549758
513 Ga0207647_10008882
514 Ga0207647_10037979
515 Ga0207647_10056461
516 Ga0207647_10243577
517 Ga0207699_10222444
518 Ga0207705_10000411
519 Ga0207705_10004859
520 Ga0207705_10082381
521 Ga0207705_10132861
522 Ga0207705_10404512
523 Ga0207705_11170238
524 Ga0207707_10107058
525 Ga0207707_10485120
526 Ga0207695_10025811
527 Ga0207693_10025397
528 Ga0207660_10005087
529 Ga0207660_10005391
530 Ga0207657_10006435
531 Ga0207657_10015454
532 Ga0207657_10036409
533 Ga0207657_10103483
534 Ga0207657_10278012
535 Ga0207649_10010742
536 Ga0207649_10069507
537 Ga0207649_10117964
538 Ga0207649_10123902
539 Ga0207649_10141772
540 Ga0207649_10250202
541 Ga0207652_10000920
542 Ga0207652_10162973
543 Ga0207652_10378721
544 Ga0207650_10493658
545 Ga0207650_10612112
546 Ga0207700_10395675
547 Ga0207700_10459178
548 Ga0207664_10079086
549 Ga0207690_10027189
550 Ga0207690_10063435
551 Ga0207690_10177435
552 Ga0207690_10289757
553 Ga0207706_10013574
554 Ga0207706_10015283
555 Ga0207706_10088494
556 Ga0207706_10104259
557 Ga0207670_10458452
558 Ga0207691_10003436
559 Ga0207689_10094336
560 Ga0207661_10005358
561 Ga0207661_10006845
562 Ga0207661_10544659
563 Ga0207679_10104750
564 Ga0207667_10014526
565 Ga0207667_10718651
566 Ga0207668_10339462
567 Ga0207640_10004827
568 Ga0207640_10222297
569 Ga0207640_10323776
570 Ga0207640_10676417
571 Ga0207658_10020014
572 Ga0207658_10154719
573 Ga0207658_10226934
574 Ga0207703_10042229
575 Ga0207639_10071946
576 Ga0207639_10147140
577 Ga0207639_10150040
578 Ga0207639_10597817
579 Ga0207678_10000439
580 Ga0207678_10029360
581 Ga0207678_10043291
582 Ga0207678_10298690
583 Ga0207678_10643076
584 Ga0207702_10045309
585 Ga0207702_10198048
586 Ga0207702_11764380
587 Ga0207641_10234612
588 Ga0207674_10008911
589 Ga0207674_10089985
590 Ga0207675_101825079
591 Ga0207683_10005676
592 Ga0207698_10012227
593 Ga0207698_10013479
594 Ga0207698_10707414
595 Ga0207698_10749812
596 Ga0207698_10815078
597 Ga0207698_10939477
598 Ga0207698_11350747
599 Ga0268266_10251421
600 Ga0268266_10868569
601 Ga0268265_10109314
602 Ga0268265_10214104
603 Ga0316182_1306404
604 Ga0307408_100003754
605 Ga0307408_100501952
606 Ga0307408_101234235
607 Ga0307408_101628354
608 Ga0307405_10099700
609 Ga0307405_10749124
610 Ga0307405_10994733
611 Ga0307413_10053338
612 Ga0307413_10122606
613 Ga0307413_11149644
614 Ga0307410_10022098
615 Ga0307410_10036588
616 Ga0307410_10110702
617 Ga0307410_10806249
618 Ga0307406_10042361
619 Ga0307406_10195486
620 Ga0307406_10353383
621 Ga0307407_10017768
622 Ga0307407_10035851
623 Ga0307407_10084595
624 Ga0307412_10050148
625 Ga0307412_10061741
626 Ga0307412_10320298
627 Ga0307409_100002567
628 Ga0307409_100007625
629 Ga0307409_100037297
630 Ga0307409_100045130
631 Ga0307409_100093175
632 Ga0307409_100393104
633 Ga0307409_100844676
634 Ga0307416_100003438
635 Ga0307416_100017253
636 Ga0307416_100110442
637 Ga0307416_100256018
638 Ga0307416_100971046
639 Ga0307416_101842646
640 Ga0307414_10050704
641 Ga0307414_10451152
642 Ga0307414_11674387
643 Ga0307411_10011300
644 Ga0307411_10079442
645 Ga0307411_10125866
646 Ga0307411_10132438
647 Ga0307411_10297823
648 Ga0307411_11479979
649 Ga0307415_100007038
650 Ga0307415_100058072
651 Ga0307415_100234575
652 Ga0373931_0594614
653 Ga0395899_0098756
654 Ga0395899_0105839
655 Ga0395899_0253022
656 Ga0395900_0011149
657 Ga0395900_0034108
658 Ga0395900_0061338
659 Ga0395900_0171241
660 Ga0395900_0192353
661 Ga0395900_0281718
662 Ga0395900_0383612
663 Ga0395900_0479176
664 Ga0395898_0034433
665 Ga0395898_0161658
666 Ga0395898_0378249
667 Ga0395898_0931995
668 Ga0395905_0024148
669 Ga0395905_0024791
670 Ga0395905_0029510
671 Ga0395905_0047432
672 Ga0395905_0069718
673 Ga0395905_0091962
674 Ga0395905_0179717
675 Ga0395905_0183926
676 Ga0395905_0310516
677 Ga0395905_0481579
678 Ga0395905_0654398
679 Ga0395905_0669253
680 Ga0395905_1458492
681 Ga0395901_0060109
682 Ga0395901_0075822
683 Ga0395901_0092540
684 Ga0395901_0189134
685 Ga0395901_0245650
686 Ga0395901_0290067
687 Ga0395901_0471002
688 Ga0395901_0610737
689 Ga0395901_0782865
690 Ga0439449_0268891
691 Ga0450920_075514
692 Ga0450899_031785
693 Ga0450905_005829
694 Ga0450906_039298
695 Ga0439458_0000136
696 Ga0466965_0125312
697 Ga0466966_0176898
698 Ga0466971_0236693
699 Ga0466957_0092046
700 Ga0466957_0208744
701 Ga0466967_0061921
702 Ga0466967_0205780
703 Ga0466967_0324820
704 Ga0495583_0191194
705 Ga0495620_0054999
706 Ga0495642_0087184
707 Ga0495668_0003882
708 Ga0495669_0024687
709 Ga0495669_0056758
710 Ga0495669_0103449
711 Ga0495669_0142805
712 Ga0495677_0034155
713 Ga0501202_030603
714 Ga0501209_189634
715 Ga0501224_008390
716 Ga0501233_023451
717 Ga0501235_011380
718 Ga0501234_009953
719 Ga0501268_019111
720 Ga0501273_031058
721 Ga0495655_0030799
722 Ga0500658_0000126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20057

DUF6456

Domain of unknown function (DUF6456)

33

165

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.8977 102 162
4cxf-assembly1.cif.gz_A structure of cnrh in complex with the cytosolic domain of cnry 0.8916 98 162
3vep-assembly4.cif.gz_H crystal structure of sigd4 in complex with its negative regulator rsda 0.8879 105 164
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.8717 102 162
2h27-assembly2.cif.gz_D crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna 0.8619 104 162
ID Description Score Start End Superfamily
3vepE00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9117 108 162 1.10.10.10
4cxfA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9075 99 162 1.10.10.10
3vepH00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8826 108 164 1.10.10.10
3vfzA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8728 102 162 1.10.10.10
2h27D00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8619 104 162 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A846VMF0-F1-model_v4 deleted 0.8516 50 164
AF-A0A840ZBF8-F1-model_v4 DUF6456 domain-containing protein 0.8504 25 164
AF-A0A7C1M537-F1-model_v4 DUF6456 domain-containing protein 0.8386 39 163
AF-A0A1E4K4G8-F1-model_v4 DUF6456 domain-containing protein 0.8262 30 164
AF-A0A520YCN6-F1-model_v4 DUF6456 domain-containing protein 0.8176 25 164

Map