F422294

General Info

Members Datasets Scaffolds Average Seq Length
361 201 722 232

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1455613|Ga0436364_1455613_1085_1819
Length 244
Sequence MPPRVSAAWLRELDKIELAGMQTILIIDDDEAIRQVIGVMLENEGFRAVLAPDGKTGLQEAFSARPNLIVVDLRMPGLSGVDVCKAVRSSGMRTPLIVLSAIGDEIDKVLLLEIGADDYVVKPFGTRELLARIRALLRRASPDTSQVISFADVEVDLERLVVRRKGDEVKLTRAEFKLLAFFLQNPDRPLTRDVLLNSVWGYEAFPNTRTVDAHVVRLRQKLEPDSDTPRHFLTMHGIGYRFIP

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
119 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
120 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.28
Rhizosphere 97.51
Stem 0
Stem Tuber 0
Unclassified 3.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1455613 3300037853 Bacteria 14747
2 Ga0065704_10170990 3300005289 Bacteria 1292
3 Ga0065707_10034590 3300005295 Bacteria 1022
4 Ga0065707_10084394 3300005295 Bacteria 7256
5 Ga0065707_10110038 3300005295 Bacteria 2447
6 Ga0070658_10009065 3300005327 Bacteria 8004
7 Ga0070658_10070079 3300005327 Bacteria 2869
8 Ga0070658_10137822 3300005327 Bacteria 2037
9 Ga0070690_100000496 3300005330 Bacteria 19654
10 Ga0070690_100048411 3300005330 Bacteria 2707
11 Ga0070666_10030831 3300005335 Bacteria 3536
12 Ga0070680_100000953 3300005336 Bacteria 20481
13 Ga0068868_100415079 3300005338 Unclassified 1164
14 Ga0070660_100191193 3300005339 Bacteria 1658
15 Ga0070660_100243637 3300005339 Bacteria 1465
16 Ga0070689_100000079 3300005340 Bacteria 57509
17 Ga0070689_100233013 3300005340 Bacteria 1514
18 Ga0070691_10101253 3300005341 Bacteria 1431
19 Ga0070661_100141084 3300005344 Bacteria 1816
20 Ga0070675_100173966 3300005354 Bacteria 1858
21 Ga0070675_100257239 3300005354 Bacteria 1529
22 Ga0070673_100150474 3300005364 Bacteria 1971
23 Ga0070688_100000017 3300005365 Bacteria 73634
24 Ga0070688_100075151 3300005365 Bacteria 2171
25 Ga0070714_100149771 3300005435 Bacteria 2102
26 Ga0070713_100071824 3300005436 Bacteria 2926
27 Ga0070713_100695956 3300005436 Bacteria 970
28 Ga0070701_10187646 3300005438 Bacteria 1214
29 Ga0070711_100010814 3300005439 Bacteria 5658
30 Ga0070700_100000189 3300005441 Bacteria 35109
31 Ga0070694_100025686 3300005444 Bacteria 3811
32 Ga0070694_100029343 3300005444 Bacteria 3589
33 Ga0070694_100153015 3300005444 Bacteria 1686
34 Ga0070694_100279666 3300005444 Bacteria 1272
35 Ga0070708_100372026 3300005445 Unclassified 1347
36 Ga0070708_100583438 3300005445 Bacteria 1054
37 Ga0070681_10004676 3300005458 Bacteria 13088
38 Ga0070681_10005983 3300005458 Bacteria 11786
39 Ga0070681_10012567 3300005458 Bacteria 8401
40 Ga0070681_10059491 3300005458 Unclassified 3801
41 Ga0070681_10137164 3300005458 Bacteria 2376
42 Ga0068867_100067052 3300005459 Bacteria 2674
43 Ga0070685_10000325 3300005466 Bacteria 29309
44 Ga0070706_100015581 3300005467 Bacteria 7022
45 Ga0070706_100469748 3300005467 Bacteria 1170
46 Ga0070706_100622984 3300005467 Bacteria 1002
47 Ga0070707_100000786 3300005468 Bacteria 31365
48 Ga0070707_100044974 3300005468 Bacteria 4226
49 Ga0070698_100029894 3300005471 Bacteria 5653
50 Ga0070698_100078350 3300005471 Bacteria 3303
51 Ga0070698_100252186 3300005471 Bacteria 1697
52 Ga0070698_100511709 3300005471 Bacteria 1139
53 Ga0070699_100003165 3300005518 Bacteria 14567
54 Ga0070699_100395985 3300005518 Bacteria 1248
55 Ga0070679_100075083 3300005530 Bacteria 3371
56 Ga0070684_100105067 3300005535 Bacteria 2527
57 Ga0070697_100045975 3300005536 Bacteria 3538
58 Ga0070697_100090634 3300005536 Bacteria 2527
59 Ga0070697_100138410 3300005536 Bacteria 2046
60 Ga0070686_100000195 3300005544 Bacteria 42157
61 Ga0070686_100001107 3300005544 Bacteria 15497
62 Ga0070686_100280430 3300005544 Bacteria 1229
63 Ga0070695_100588439 3300005545 Bacteria 872
64 Ga0070696_100004227 3300005546 Bacteria 9569
65 Ga0070696_100341896 3300005546 Bacteria 1157
66 Ga0070696_100353269 3300005546 Bacteria 1139
67 Ga0070665_100025242 3300005548 Bacteria 5988
68 Ga0070704_100020017 3300005549 Bacteria 4306
69 Ga0070704_100034729 3300005549 Bacteria 3422
70 Ga0070704_100110402 3300005549 Bacteria 2091
71 Ga0070704_100158463 3300005549 Bacteria 1788
72 Ga0068855_100006852 3300005563 Bacteria 13822
73 Ga0068855_100026715 3300005563 Bacteria 6908
74 Ga0068855_100044475 3300005563 Bacteria 5254
75 Ga0070702_100636702 3300005615 Bacteria 804
76 Ga0068852_100019161 3300005616 Bacteria 5409
77 Ga0068852_100341642 3300005616 Bacteria 1459
78 Ga0068859_100001873 3300005617 Bacteria 21420
79 Ga0068859_100934725 3300005617 Bacteria 951
80 Ga0068861_100068919 3300005719 Bacteria 2735
81 Ga0068863_100021423 3300005841 Bacteria 6169
82 Ga0068860_100659848 3300005843 Bacteria 1054
83 Ga0068862_100270336 3300005844 Bacteria 1554
84 Ga0081455_10013157 3300005937 Bacteria 8199
85 Ga0081455_10108205 3300005937 Bacteria 2215
86 Ga0070717_10316888 3300006028 Bacteria 1389
87 Ga0070715_10062273 3300006163 Bacteria 1641
88 Ga0070715_10222293 3300006163 Bacteria 972
89 Ga0070716_100104000 3300006173 Bacteria 1747
90 Ga0070716_100385571 3300006173 Bacteria 1003
91 Ga0070712_100418406 3300006175 Bacteria 1110
92 Ga0097621_100027141 3300006237 Bacteria 4499
93 Ga0068871_100178308 3300006358 Bacteria 1825
94 Ga0068871_100472349 3300006358 Bacteria 1127
95 Ga0075428_100033306 3300006844 Bacteria 5689
96 Ga0075430_100000879 3300006846 Bacteria 23585
97 Ga0075431_100006185 3300006847 Bacteria 11882
98 Ga0075433_10042770 3300006852 Bacteria 3932
99 Ga0075433_10129046 3300006852 Bacteria 2246
100 Ga0075433_10382631 3300006852 Bacteria 1242
101 Ga0075434_100009898 3300006871 Bacteria 8920
102 Ga0075434_100383385 3300006871 Bacteria 1426
103 Ga0075434_100625510 3300006871 Bacteria 1095
104 Ga0075436_100055727 3300006914 Bacteria 2730
105 Ga0075436_100166536 3300006914 Bacteria 1555
106 Ga0075436_100334590 3300006914 Bacteria 1089
107 Ga0097620_100001873 3300006931 Bacteria 21420
108 Ga0097620_100934518 3300006931 Bacteria 951
109 Ga0075435_100048531 3300007076 Bacteria 3411
110 Ga0075435_100076588 3300007076 Bacteria 2741
111 Ga0105240_10000375 3300009093 Bacteria 83925
112 Ga0105240_10004210 3300009093 Bacteria 21997
113 Ga0105240_10026398 3300009093 Bacteria 7619
114 Ga0105240_10263780 3300009093 Bacteria 1986
115 Ga0105245_10537164 3300009098 Unclassified 1190
116 Ga0105245_10612020 3300009098 Bacteria 1117
117 Ga0105245_11073327 3300009098 Unclassified 851
118 Ga0114129_10135337 3300009147 Bacteria 3381
119 Ga0114129_10213390 3300009147 Bacteria 2608
120 Ga0114129_10584628 3300009147 Unclassified 1449
121 Ga0105243_10225658 3300009148 Bacteria 1659
122 Ga0105243_11145041 3300009148 Bacteria 788
123 Ga0105241_10362585 3300009174 Bacteria 1261
124 Ga0105242_10019801 3300009176 Bacteria 5272
125 Ga0105242_10669465 3300009176 Bacteria 1012
126 Ga0105248_10000228 3300009177 Bacteria 64331
127 Ga0105237_10002126 3300009545 Bacteria 24939
128 Ga0105237_10031665 3300009545 Bacteria 5356
129 Ga0105238_10483254 3300009551 Bacteria 1238
130 Ga0105238_10833005 3300009551 Bacteria 939
131 Ga0105249_10037716 3300009553 Bacteria 4385
132 Ga0157370_10010193 3300013104 Bacteria 9924
133 Ga0157370_10496431 3300013104 Bacteria 1121
134 Ga0157369_10090384 3300013105 Bacteria 3269
135 Ga0157369_10223877 3300013105 Bacteria 1968
136 Ga0157374_10070939 3300013296 Unclassified 3284
137 Ga0157374_10177268 3300013296 Bacteria 2080
138 Ga0157374_10310808 3300013296 Bacteria 1560
139 Ga0157378_10391762 3300013297 Bacteria 1367
140 Ga0157372_10126362 3300013307 Bacteria 2940
141 Ga0157380_10011343 3300014326 Bacteria 6438
142 Ga0157380_10019408 3300014326 Bacteria 5066
143 Ga0157376_10072454 3300014969 Bacteria 2931
144 Ga0213873_10037203 3300021358 Bacteria 1239
145 Ga0213875_10013995 3300021388 Bacteria 3924
146 Ga0207680_10207229 3300025903 Bacteria 1339
147 Ga0207685_10033988 3300025905 Bacteria 1848
148 Ga0207705_10021389 3300025909 Bacteria 4616
149 Ga0207684_10029188 3300025910 Bacteria 4698
150 Ga0207684_10366658 3300025910 Bacteria 1239
151 Ga0207707_10002875 3300025912 Bacteria 15381
152 Ga0207707_10015829 3300025912 Bacteria 6576
153 Ga0207707_10026348 3300025912 Bacteria 5081
154 Ga0207707_10154031 3300025912 Bacteria 2010
155 Ga0207707_10361591 3300025912 Bacteria 1249
156 Ga0207695_10001508 3300025913 Bacteria 38700
157 Ga0207695_10002494 3300025913 Bacteria 27107
158 Ga0207695_10269204 3300025913 Bacteria 1600
159 Ga0207671_10119832 3300025914 Bacteria 2011
160 Ga0207671_10189930 3300025914 Bacteria 1602
161 Ga0207663_10007493 3300025916 Bacteria 5661
162 Ga0207660_10006625 3300025917 Bacteria 7514
163 Ga0207662_10009429 3300025918 Bacteria 5371
164 Ga0207649_10446319 3300025920 Bacteria 976
165 Ga0207652_10058674 3300025921 Bacteria 3316
166 Ga0207646_10000011 3300025922 Bacteria 370246
167 Ga0207646_10166434 3300025922 Bacteria 1990
168 Ga0207646_10213232 3300025922 Bacteria 1744
169 Ga0207646_10264527 3300025922 Bacteria 1554
170 Ga0207659_10141753 3300025926 Bacteria 1867
171 Ga0207659_10212834 3300025926 Bacteria 1550
172 Ga0207687_10681894 3300025927 Bacteria 871
173 Ga0207700_10640210 3300025928 Bacteria 948
174 Ga0207664_10163473 3300025929 Unclassified 1900
175 Ga0207664_10459273 3300025929 Bacteria 1137
176 Ga0207686_10007681 3300025934 Bacteria 5813
177 Ga0207686_10089279 3300025934 Bacteria 2031
178 Ga0207686_10620217 3300025934 Bacteria 853
179 Ga0207709_10594618 3300025935 Bacteria 875
180 Ga0207670_10000070 3300025936 Bacteria 72004
181 Ga0207665_10023833 3300025939 Bacteria 4030
182 Ga0207665_10375161 3300025939 Bacteria 1078
183 Ga0207667_10019465 3300025949 Bacteria 7577
184 Ga0207667_10052737 3300025949 Bacteria 4281
185 Ga0207667_10097332 3300025949 Bacteria 3037
186 Ga0207651_10156896 3300025960 Bacteria 1779
187 Ga0207677_10309102 3300026023 Unclassified 1309
188 Ga0207703_10465043 3300026035 Bacteria 1183
189 Ga0207639_10155441 3300026041 Bacteria 1921
190 Ga0207708_10000312 3300026075 Bacteria 38277
191 Ga0207702_10080968 3300026078 Bacteria 2819
192 Ga0207641_10016554 3300026088 Bacteria 6038
193 Ga0207648_10001772 3300026089 Bacteria 23645
194 Ga0207675_100063706 3300026118 Bacteria 3445
195 Ga0207698_10006116 3300026142 Bacteria 7492
196 Ga0207698_10330493 3300026142 Bacteria 1432
197 Ga0209998_10012120 3300027717 Bacteria 1789
198 Ga0209974_10032503 3300027876 Bacteria 1729
199 Ga0268264_10499047 3300028381 Bacteria 1187
200 Ga0265337_1002194 3300028556 Bacteria 9122
201 Ga0265319_1010508 3300028563 Bacteria 3855
202 Ga0265334_10009757 3300028573 Bacteria 4060
203 Ga0265318_10002401 3300028577 Bacteria 10016
204 Ga0265318_10002479 3300028577 Bacteria 9857
205 Ga0265318_10025626 3300028577 Bacteria 2327
206 Ga0265322_10026919 3300028654 Bacteria 1643
207 Ga0265336_10001058 3300028666 Bacteria 13467
208 Ga0265338_10000320 3300028800 Bacteria 87120
209 Ga0265338_10020424 3300028800 Bacteria 6965
210 Ga0265338_10129864 3300028800 Bacteria 1992
211 Ga0265338_10177816 3300028800 Bacteria 1625
212 Ga0265338_10353945 3300028800 Bacteria 1055
213 Ga0265324_10003157 3300029957 Bacteria 7996
214 Ga0265324_10023766 3300029957 Bacteria 2181
215 Ga0265328_10084326 3300031239 Bacteria 1172
216 Ga0265320_10001712 3300031240 Bacteria 15584
217 Ga0265320_10002752 3300031240 Bacteria 12138
218 Ga0265320_10024064 3300031240 Bacteria 3228
219 Ga0265320_10055563 3300031240 Bacteria 1905
220 Ga0265325_10023986 3300031241 Bacteria 3321
221 Ga0265325_10030686 3300031241 Bacteria 2881
222 Ga0265325_10080883 3300031241 Bacteria 1615
223 Ga0265327_10008632 3300031251 Bacteria 7550
224 Ga0265316_10027972 3300031344 Bacteria 4657
225 Ga0265316_10066913 3300031344 Unclassified 2779
226 Ga0265316_10087023 3300031344 Bacteria 2388
227 Ga0265316_10115117 3300031344 Bacteria 2033
228 Ga0265313_10019154 3300031595 Bacteria 3820
229 Ga0265314_10054435 3300031711 Bacteria 2769
230 Ga0265342_10036117 3300031712 Bacteria 3020
231 Ga0265342_10233809 3300031712 Bacteria 986
232 Ga0373926_0006029 3300035083 Unclassified 4011
233 Ga0373940_0005127 3300035088 Bacteria 2821
234 Ga0373940_0040103 3300035088 Bacteria 1284
235 Ga0373923_0208450 3300035111 Bacteria 905
236 Ga0373945_0063808 3300035116 Bacteria 1380
237 Ga0373954_0098102 3300035118 Bacteria 1412
238 Ga0373956_0115751 3300035119 Bacteria 1250
239 Ga0373943_0106120 3300035170 Bacteria 1476
240 Ga0373924_0039101 3300035410 Bacteria 1937
241 Ga0373935_0112389 3300035692 Bacteria 1809
242 Ga0373927_0000140 3300035695 Bacteria 56241
243 Ga0373927_0037612 3300035695 Bacteria 3145
244 Ga0373927_0138821 3300035695 Bacteria 1589
245 Ga0373927_0360641 3300035695 Bacteria 958
246 Ga0373933_0068808 3300035724 Bacteria 2151
247 Ga0373933_0138001 3300035724 Bacteria 1537
248 Ga0373947_0003269 3300035725 Bacteria 9608
249 Ga0373947_0015311 3300035725 Bacteria 4402
250 Ga0373947_0327529 3300035725 Bacteria 1025
251 Ga0373937_0066814 3300036401 Bacteria 3312
252 Ga0373937_0071105 3300036401 Bacteria 3209
253 Ga0373925_0000288 3300037068 Bacteria 52560
254 Ga0373925_0008637 3300037068 Bacteria 7422
255 Ga0373925_0295023 3300037068 Bacteria 1308
256 Ga0436364_0814971 3300037853 Unclassified 3046
257 Ga0436364_0936164 3300037853 Bacteria 1676
258 Ga0436364_1473619 3300037853 Bacteria 847
259 Ga0436365_1513494 3300039437 Bacteria 2100
260 Ga0436365_1704990 3300039437 Bacteria 3852
261 Ga0436362_0790244 3300039453 Unclassified 644
262 Ga0436362_1284255 3300039453 Bacteria 1248
263 Ga0451839_1030826 3300041496 Bacteria 849
264 Ga0451577_0081001 3300042876 Bacteria 2895
265 Ga0453683_0426335 3300044673 Bacteria 856
266 Ga0453683_0472591 3300044673 Bacteria 812
267 Ga0466966_0139888 3300044684 Bacteria 1480
268 Ga0451576_0358118 3300045051 Bacteria 1528
269 Ga0466967_0029116 3300045976 Bacteria 4619
270 Ga0495603_0115809 3300046455 Bacteria 1563
271 Ga0495629_0367808 3300046459 Bacteria 979
272 Ga0495580_0021581 3300046472 Bacteria 4749
273 Ga0495580_0030550 3300046472 Bacteria 3900
274 Ga0495582_0146040 3300046473 Bacteria 1342
275 Ga0495639_0078745 3300046475 Bacteria 1532
276 Ga0495639_0209965 3300046475 Bacteria 955
277 Ga0495662_0154176 3300046476 Bacteria 1132
278 Ga0495608_0424680 3300046511 Bacteria 811
279 Ga0495586_0302351 3300046535 Bacteria 917
280 Ga0495667_0089681 3300046559 Bacteria 1993
281 Ga0495634_0232168 3300046642 Bacteria 1135
282 Ga0495635_0008743 3300046663 Bacteria 7071
283 Ga0495657_0001112 3300046675 Bacteria 23550
284 Ga0495674_0402421 3300047319 Unclassified 1105
285 Ga0495680_0078432 3300047322 Bacteria 2499
286 Ga0495614_0099330 3300048089 Bacteria 1271
287 Ga0496114_0498154 3300048917 Bacteria 1078
288 Ga0501031_0001343 3300049568 Bacteria 15154
289 Ga0501031_0001440 3300049568 Bacteria 14763
290 Ga0501031_0114818 3300049568 Bacteria 1759
291 Ga0501031_0268545 3300049568 Bacteria 1108
292 Ga0501032_0037719 3300049569 Bacteria 3295
293 Ga0501032_0117415 3300049569 Bacteria 1759
294 Ga0501032_0121315 3300049569 Bacteria 1728
295 Ga0501032_0135011 3300049569 Bacteria 1626
296 Ga0501036_0075201 3300049572 Bacteria 2857
297 Ga0501036_0114187 3300049572 Bacteria 2282
298 Ga0501036_0117729 3300049572 Bacteria 2244
299 Ga0501036_0137976 3300049572 Bacteria 2058
300 Ga0501037_0003669 3300049573 Bacteria 11144
301 Ga0501037_0007727 3300049573 Bacteria 7871
302 Ga0501037_0046840 3300049573 Bacteria 3170
303 Ga0501038_0026216 3300049574 Bacteria 5192
304 Ga0501038_0047717 3300049574 Bacteria 3709
305 Ga0501038_0057418 3300049574 Bacteria 3342
306 Ga0501039_0000747 3300049575 Bacteria 23375
307 Ga0501039_0102994 3300049575 Bacteria 2228
308 Ga0501039_0119718 3300049575 Bacteria 2062
309 Ga0501039_0210471 3300049575 Bacteria 1529
310 Ga0501039_0480630 3300049575 Bacteria 975
311 Ga0501040_0085530 3300049576 Bacteria 2189
312 Ga0501040_0092423 3300049576 Bacteria 2104
313 Ga0501041_0001550 3300049577 Bacteria 12786
314 Ga0501041_0003568 3300049577 Bacteria 8955
315 Ga0501042_0000105 3300049578 Bacteria 34410
316 Ga0501042_0046282 3300049578 Bacteria 3101
317 Ga0501042_0076318 3300049578 Bacteria 2399
318 Ga0501042_0143533 3300049578 Bacteria 1721
319 Ga0501043_0024553 3300049579 Bacteria 4730
320 Ga0501043_0227886 3300049579 Bacteria 1440
321 Ga0501046_0003369 3300049580 Bacteria 14676
322 Ga0501046_0005804 3300049580 Bacteria 11015
323 Ga0501047_0046313 3300049581 Bacteria 4203
324 Ga0501047_0289687 3300049581 Bacteria 1481
325 Ga0501048_0005273 3300049582 Bacteria 9847
326 Ga0501048_0278925 3300049582 Bacteria 1188
327 Ga0501071_0069654 3300049587 Bacteria 2562
328 Ga0501071_0214269 3300049587 Bacteria 1449
329 Ga0501073_0104403 3300049589 Bacteria 1967
330 Ga0501075_0393429 3300049591 Bacteria 1057
331 Ga0501076_0025396 3300049592 Bacteria 4584
332 Ga0501077_0036164 3300049593 Bacteria 3145
333 Ga0501077_0118339 3300049593 Bacteria 1679
334 Ga0501079_0110598 3300049741 Bacteria 2135
335 Ga0501080_0163692 3300049742 Bacteria 2053
336 Ga0501081_0122694 3300049743 Bacteria 1852
337 Ga0501081_0452839 3300049743 Bacteria 954
338 Ga0501035_0011060 3300049822 Bacteria 8357
339 Ga0501035_0013936 3300049822 Bacteria 7418
340 Ga0501035_0039413 3300049822 Bacteria 4275
341 Ga0501035_0217675 3300049822 Bacteria 1632
342 Ga0501045_0178373 3300049824 Bacteria 1583
343 Ga0501045_0186745 3300049824 Bacteria 1544
344 Ga0501045_0415545 3300049824 Bacteria 1001
345 nmdc:mga05p37_266051_c1 3300050507 Bacteria 2050
346 nmdc:mga05p37_333167_c1 3300050507 Bacteria 1792
347 nmdc:mga0qj67_1918_c1 3300050509 Bacteria 14764
348 nmdc:mga06r32_5849_c1 3300050510 Bacteria 11068
349 nmdc:mga0n895_135907_c1 3300050512 Bacteria 2485
350 nmdc:mga0n895_314272_c1 3300050512 Bacteria 1587
351 nmdc:mga0n895_317827_c1 3300050512 Bacteria 1578
352 nmdc:mga0n895_436074_c1 3300050512 Bacteria 1324
353 nmdc:mga0rr50_511217_c1 3300050513 Bacteria 1022
354 nmdc:mga08x19_122899_c1 3300050514 Bacteria 1741
355 nmdc:mga08x19_67128_c1 3300050514 Bacteria 2332
356 nmdc:mga08x19_90015_c1 3300050514 Bacteria 2024
357 nmdc:mga0a205_226554_c1 3300050515 Bacteria 1754
358 nmdc:mga0a205_238070_c1 3300050515 Bacteria 1702
359 Ga0495612_0054750 3300053078 Bacteria 1644
360 Ga0495619_0024354 3300053085 Bacteria 3882
361 Ga0501082_0274791 3300060353 Bacteria 1467
362 Ga0436364_1455613
363 Ga0065704_10170990
364 Ga0065707_10034590
365 Ga0065707_10084394
366 Ga0065707_10110038
367 Ga0070658_10009065
368 Ga0070658_10070079
369 Ga0070658_10137822
370 Ga0070690_100000496
371 Ga0070690_100048411
372 Ga0070666_10030831
373 Ga0070680_100000953
374 Ga0068868_100415079
375 Ga0070660_100191193
376 Ga0070660_100243637
377 Ga0070689_100000079
378 Ga0070689_100233013
379 Ga0070691_10101253
380 Ga0070661_100141084
381 Ga0070675_100173966
382 Ga0070675_100257239
383 Ga0070673_100150474
384 Ga0070688_100000017
385 Ga0070688_100075151
386 Ga0070714_100149771
387 Ga0070713_100071824
388 Ga0070713_100695956
389 Ga0070701_10187646
390 Ga0070711_100010814
391 Ga0070700_100000189
392 Ga0070694_100025686
393 Ga0070694_100029343
394 Ga0070694_100153015
395 Ga0070694_100279666
396 Ga0070708_100372026
397 Ga0070708_100583438
398 Ga0070681_10004676
399 Ga0070681_10005983
400 Ga0070681_10012567
401 Ga0070681_10059491
402 Ga0070681_10137164
403 Ga0068867_100067052
404 Ga0070685_10000325
405 Ga0070706_100015581
406 Ga0070706_100469748
407 Ga0070706_100622984
408 Ga0070707_100000786
409 Ga0070707_100044974
410 Ga0070698_100029894
411 Ga0070698_100078350
412 Ga0070698_100252186
413 Ga0070698_100511709
414 Ga0070699_100003165
415 Ga0070699_100395985
416 Ga0070679_100075083
417 Ga0070684_100105067
418 Ga0070697_100045975
419 Ga0070697_100090634
420 Ga0070697_100138410
421 Ga0070686_100000195
422 Ga0070686_100001107
423 Ga0070686_100280430
424 Ga0070695_100588439
425 Ga0070696_100004227
426 Ga0070696_100341896
427 Ga0070696_100353269
428 Ga0070665_100025242
429 Ga0070704_100020017
430 Ga0070704_100034729
431 Ga0070704_100110402
432 Ga0070704_100158463
433 Ga0068855_100006852
434 Ga0068855_100026715
435 Ga0068855_100044475
436 Ga0070702_100636702
437 Ga0068852_100019161
438 Ga0068852_100341642
439 Ga0068859_100001873
440 Ga0068859_100934725
441 Ga0068861_100068919
442 Ga0068863_100021423
443 Ga0068860_100659848
444 Ga0068862_100270336
445 Ga0081455_10013157
446 Ga0081455_10108205
447 Ga0070717_10316888
448 Ga0070715_10062273
449 Ga0070715_10222293
450 Ga0070716_100104000
451 Ga0070716_100385571
452 Ga0070712_100418406
453 Ga0097621_100027141
454 Ga0068871_100178308
455 Ga0068871_100472349
456 Ga0075428_100033306
457 Ga0075430_100000879
458 Ga0075431_100006185
459 Ga0075433_10042770
460 Ga0075433_10129046
461 Ga0075433_10382631
462 Ga0075434_100009898
463 Ga0075434_100383385
464 Ga0075434_100625510
465 Ga0075436_100055727
466 Ga0075436_100166536
467 Ga0075436_100334590
468 Ga0097620_100001873
469 Ga0097620_100934518
470 Ga0075435_100048531
471 Ga0075435_100076588
472 Ga0105240_10000375
473 Ga0105240_10004210
474 Ga0105240_10026398
475 Ga0105240_10263780
476 Ga0105245_10537164
477 Ga0105245_10612020
478 Ga0105245_11073327
479 Ga0114129_10135337
480 Ga0114129_10213390
481 Ga0114129_10584628
482 Ga0105243_10225658
483 Ga0105243_11145041
484 Ga0105241_10362585
485 Ga0105242_10019801
486 Ga0105242_10669465
487 Ga0105248_10000228
488 Ga0105237_10002126
489 Ga0105237_10031665
490 Ga0105238_10483254
491 Ga0105238_10833005
492 Ga0105249_10037716
493 Ga0157370_10010193
494 Ga0157370_10496431
495 Ga0157369_10090384
496 Ga0157369_10223877
497 Ga0157374_10070939
498 Ga0157374_10177268
499 Ga0157374_10310808
500 Ga0157378_10391762
501 Ga0157372_10126362
502 Ga0157380_10011343
503 Ga0157380_10019408
504 Ga0157376_10072454
505 Ga0213873_10037203
506 Ga0213875_10013995
507 Ga0207680_10207229
508 Ga0207685_10033988
509 Ga0207705_10021389
510 Ga0207684_10029188
511 Ga0207684_10366658
512 Ga0207707_10002875
513 Ga0207707_10015829
514 Ga0207707_10026348
515 Ga0207707_10154031
516 Ga0207707_10361591
517 Ga0207695_10001508
518 Ga0207695_10002494
519 Ga0207695_10269204
520 Ga0207671_10119832
521 Ga0207671_10189930
522 Ga0207663_10007493
523 Ga0207660_10006625
524 Ga0207662_10009429
525 Ga0207649_10446319
526 Ga0207652_10058674
527 Ga0207646_10000011
528 Ga0207646_10166434
529 Ga0207646_10213232
530 Ga0207646_10264527
531 Ga0207659_10141753
532 Ga0207659_10212834
533 Ga0207687_10681894
534 Ga0207700_10640210
535 Ga0207664_10163473
536 Ga0207664_10459273
537 Ga0207686_10007681
538 Ga0207686_10089279
539 Ga0207686_10620217
540 Ga0207709_10594618
541 Ga0207670_10000070
542 Ga0207665_10023833
543 Ga0207665_10375161
544 Ga0207667_10019465
545 Ga0207667_10052737
546 Ga0207667_10097332
547 Ga0207651_10156896
548 Ga0207677_10309102
549 Ga0207703_10465043
550 Ga0207639_10155441
551 Ga0207708_10000312
552 Ga0207702_10080968
553 Ga0207641_10016554
554 Ga0207648_10001772
555 Ga0207675_100063706
556 Ga0207698_10006116
557 Ga0207698_10330493
558 Ga0209998_10012120
559 Ga0209974_10032503
560 Ga0268264_10499047
561 Ga0265337_1002194
562 Ga0265319_1010508
563 Ga0265334_10009757
564 Ga0265318_10002401
565 Ga0265318_10002479
566 Ga0265318_10025626
567 Ga0265322_10026919
568 Ga0265336_10001058
569 Ga0265338_10000320
570 Ga0265338_10020424
571 Ga0265338_10129864
572 Ga0265338_10177816
573 Ga0265338_10353945
574 Ga0265324_10003157
575 Ga0265324_10023766
576 Ga0265328_10084326
577 Ga0265320_10001712
578 Ga0265320_10002752
579 Ga0265320_10024064
580 Ga0265320_10055563
581 Ga0265325_10023986
582 Ga0265325_10030686
583 Ga0265325_10080883
584 Ga0265327_10008632
585 Ga0265316_10027972
586 Ga0265316_10066913
587 Ga0265316_10087023
588 Ga0265316_10115117
589 Ga0265313_10019154
590 Ga0265314_10054435
591 Ga0265342_10036117
592 Ga0265342_10233809
593 Ga0373926_0006029
594 Ga0373940_0005127
595 Ga0373940_0040103
596 Ga0373923_0208450
597 Ga0373945_0063808
598 Ga0373954_0098102
599 Ga0373956_0115751
600 Ga0373943_0106120
601 Ga0373924_0039101
602 Ga0373935_0112389
603 Ga0373927_0000140
604 Ga0373927_0037612
605 Ga0373927_0138821
606 Ga0373927_0360641
607 Ga0373933_0068808
608 Ga0373933_0138001
609 Ga0373947_0003269
610 Ga0373947_0015311
611 Ga0373947_0327529
612 Ga0373937_0066814
613 Ga0373937_0071105
614 Ga0373925_0000288
615 Ga0373925_0008637
616 Ga0373925_0295023
617 Ga0436364_0814971
618 Ga0436364_0936164
619 Ga0436364_1473619
620 Ga0436365_1513494
621 Ga0436365_1704990
622 Ga0436362_0790244
623 Ga0436362_1284255
624 Ga0451839_1030826
625 Ga0451577_0081001
626 Ga0453683_0426335
627 Ga0453683_0472591
628 Ga0466966_0139888
629 Ga0451576_0358118
630 Ga0466967_0029116
631 Ga0495603_0115809
632 Ga0495629_0367808
633 Ga0495580_0021581
634 Ga0495580_0030550
635 Ga0495582_0146040
636 Ga0495639_0078745
637 Ga0495639_0209965
638 Ga0495662_0154176
639 Ga0495608_0424680
640 Ga0495586_0302351
641 Ga0495667_0089681
642 Ga0495634_0232168
643 Ga0495635_0008743
644 Ga0495657_0001112
645 Ga0495674_0402421
646 Ga0495680_0078432
647 Ga0495614_0099330
648 Ga0496114_0498154
649 Ga0501031_0001343
650 Ga0501031_0001440
651 Ga0501031_0114818
652 Ga0501031_0268545
653 Ga0501032_0037719
654 Ga0501032_0117415
655 Ga0501032_0121315
656 Ga0501032_0135011
657 Ga0501036_0075201
658 Ga0501036_0114187
659 Ga0501036_0117729
660 Ga0501036_0137976
661 Ga0501037_0003669
662 Ga0501037_0007727
663 Ga0501037_0046840
664 Ga0501038_0026216
665 Ga0501038_0047717
666 Ga0501038_0057418
667 Ga0501039_0000747
668 Ga0501039_0102994
669 Ga0501039_0119718
670 Ga0501039_0210471
671 Ga0501039_0480630
672 Ga0501040_0085530
673 Ga0501040_0092423
674 Ga0501041_0001550
675 Ga0501041_0003568
676 Ga0501042_0000105
677 Ga0501042_0046282
678 Ga0501042_0076318
679 Ga0501042_0143533
680 Ga0501043_0024553
681 Ga0501043_0227886
682 Ga0501046_0003369
683 Ga0501046_0005804
684 Ga0501047_0046313
685 Ga0501047_0289687
686 Ga0501048_0005273
687 Ga0501048_0278925
688 Ga0501071_0069654
689 Ga0501071_0214269
690 Ga0501073_0104403
691 Ga0501075_0393429
692 Ga0501076_0025396
693 Ga0501077_0036164
694 Ga0501077_0118339
695 Ga0501079_0110598
696 Ga0501080_0163692
697 Ga0501081_0122694
698 Ga0501081_0452839
699 Ga0501035_0011060
700 Ga0501035_0013936
701 Ga0501035_0039413
702 Ga0501035_0217675
703 Ga0501045_0178373
704 Ga0501045_0186745
705 Ga0501045_0415545
706 nmdc:mga05p37_266051_c1
707 nmdc:mga05p37_333167_c1
708 nmdc:mga0qj67_1918_c1
709 nmdc:mga06r32_5849_c1
710 nmdc:mga0n895_135907_c1
711 nmdc:mga0n895_314272_c1
712 nmdc:mga0n895_317827_c1
713 nmdc:mga0n895_436074_c1
714 nmdc:mga0rr50_511217_c1
715 nmdc:mga08x19_122899_c1
716 nmdc:mga08x19_67128_c1
717 nmdc:mga08x19_90015_c1
718 nmdc:mga0a205_226554_c1
719 nmdc:mga0a205_238070_c1
720 Ga0495612_0054750
721 Ga0495619_0024354
722 Ga0501082_0274791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

24

134

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

166

242

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9833 7 129
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9813 7 126
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9812 7 126
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9801 7 126
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9765 7 123
ID Description Score Start End Superfamily
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.979 6 87 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9754 7 91 3.40.50.2300
af_Q2FWH6_1_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.974 6 130 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9736 7 87 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9721 6 85 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7C1ETQ0-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9867 6 126 GO:0000155
AF-A0A7W0T7H3-F1-model_v4 Response regulator 0.9797 7 126 GO:0000160
AF-A0A2A5G3C3-F1-model_v4 Two-component system response regulator 0.9788 7 123 GO:0000160
AF-A0A1G8SP82-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9773 7 123 GO:0000155
GO:0006935
AF-A0A147GR81-F1-model_v4 Chemotaxis protein CheY 0.977 8 127 GO:0000160
GO:0008081

Map