F422210

General Info

Members Datasets Scaffolds Average Seq Length
361 199 723 252

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10063247|Ga0157373_100632472
Length 266
Sequence MRRELTEEMRMNGFARLLMAALALMMAPASAWAQGQFKLLVLAIPNKYHYEYIPVARESLERLAKLHSFEFTWTNKPEAFESDLSQYAAVMFLNTPGEELNPAQRKKFEDYMRAGGNAIVVHRAAIARPNNWVWYEKMVGRSFVIHPMLQTGVVTVADKNFPATYGLPDRWIWSDEFYVTTNPYNVPVHVVMNVDETSYDPTKIWPGQVAKPMGKDHPVAWYHQYEKGRVFVTLLGHNVEMYRDQHYLDHLMGGIYWAATGLGQQH

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
44 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
45 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
79 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
80 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
81 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
82 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
83 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
84 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
85 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
86 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
87 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
88 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
89 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
90 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
93 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
104 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
112 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
118 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
119 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
144 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
145 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
146 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
147 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
148 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
149 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
177 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
178 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
179 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
180 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
181 2643221556 Massilia sp. Root1485 Isolate Unclassified
182 2643221684 Massilia sp. Root133 Isolate Unclassified
183 2738541297 Duganella sp. GV083 Isolate Unclassified
184 2738541357 Duganella sp. GV053 Isolate Unclassified
185 2738543003 Duganella sp. GV066 Isolate Unclassified
186 2738543026 Duganella sp. GV089 Isolate Unclassified
187 2738543029 Duganella sp. GV039 Isolate Unclassified
188 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
189 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
190 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
191 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
192 2821131069 Duganella sp. 1224 Isolate Unclassified
193 2857564685 Duganella sp. R-74599 Isolate Unclassified
194 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
195 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
196 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
197 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
198 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
199 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.18
Metatranscriptomes 0
Isolates 5.82

Biome Distribution

Category Percentage (%)
Aerial Root 0.55
Bulb 0
Endosphere 11.08
Nodule 0
Rhizoplane 4.99
Rhizosphere 70.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10063247 3300013100 Bacteria 2621
2 JGI24736J21556_1010461 3300001904 Bacteria 1515
3 JGI24739J22299_10004027 3300001989 Bacteria 5621
4 JGI24739J22299_10016341 3300001989 Bacteria 2686
5 JGI24735J21928_10003198 3300002067 Bacteria 5598
6 JGI24735J21928_10034227 3300002067 Bacteria 1498
7 JGI25153J46596_10072565 3300003215 Bacteria 885
8 rootH1_10018568 3300003316 Bacteria 10350
9 rootH1_10018568 3300003323 Bacteria 2750
10 rootH1_10096628 3300003316 Bacteria 2879
11 rootH2_10016741 3300003320 Bacteria 3910
12 rootL2_10009593 3300003322 Bacteria 33533
13 rootL2_10018135 3300003322 Bacteria 16077
14 rootL2_10039709 3300003322 Bacteria 9598
15 rootL2_10056953 3300003322 Bacteria 2371
16 rootL2_10355809 3300003322 Bacteria 1388
17 rootH1_10027754 3300003323 Bacteria 9798
18 Ga0055525_1000028 3300003759 Bacteria 331683
19 Ga0055529_1000027 3300003763 Bacteria 292744
20 Ga0055526_1000026 3300003771 Bacteria 154116
21 Ga0055526_1011553 3300003771 Bacteria 3960
22 Ga0055537_1000100 3300003773 Bacteria 64929
23 Ga0055524_1011042 3300003775 Bacteria 3555
24 Ga0055534_1000085 3300003784 Bacteria 72934
25 Ga0055528_1000458 3300003790 Bacteria 32517
26 Ga0065165_1044660 3300005262 Bacteria 1295
27 Ga0070658_10255623 3300005327 Bacteria 1487
28 Ga0070660_100015173 3300005339 Bacteria 5558
29 Ga0070660_100017752 3300005339 Bacteria 5190
30 Ga0070661_100135977 3300005344 Bacteria 1850
31 Ga0070659_100101805 3300005366 Bacteria 2312
32 Ga0070659_100300469 3300005366 Bacteria 1338
33 Ga0070665_100655472 3300005548 Bacteria 1063
34 Ga0068855_100007105 3300005563 Bacteria 13582
35 Ga0068855_100318507 3300005563 Bacteria 1720
36 Ga0068857_100051427 3300005577 Bacteria 3656
37 Ga0068854_100029627 3300005578 Bacteria 3790
38 Ga0068852_100087313 3300005616 Bacteria 2782
39 Ga0075368_10000192 3300006042 Bacteria 16735
40 Ga0075363_100052449 3300006048 Bacteria 2177
41 Ga0075363_100155596 3300006048 Bacteria 1292
42 Ga0075367_10000053 3300006178 Bacteria 27481
43 Ga0075366_10253469 3300006195 Bacteria 1074
44 Ga0075370_10082256 3300006353 Bacteria 1851
45 Ga0075370_10124345 3300006353 Bacteria 1503
46 Ga0105244_10001844 3300009036 Bacteria 16549
47 Ga0105244_10007825 3300009036 Bacteria 6749
48 Ga0105244_10145350 3300009036 Bacteria 1138
49 Ga0105240_10738095 3300009093 Bacteria 1071
50 Ga0105245_10248151 3300009098 Bacteria 1728
51 Ga0105243_10059929 3300009148 Bacteria 3039
52 Ga0105241_10007989 3300009174 Bacteria 7781
53 Ga0105242_10007310 3300009176 Bacteria 8505
54 Ga0105237_10083174 3300009545 Bacteria 3192
55 Ga0157371_10000003 3300013102 Bacteria 543317
56 Ga0157371_10070879 3300013102 Bacteria 2467
57 Ga0182008_10018396 3300014497 Bacteria 3618
58 Ga0182007_10036268 3300015262 Bacteria 1659
59 Ga0182007_10087800 3300015262 Bacteria 1023
60 Ga0209563_100011 3300025230 Bacteria 1187808
61 Ga0209437_114802 3300025233 Bacteria 1079
62 Ga0207425_1000381 3300025245 Bacteria 30305
63 Ga0209677_102081 3300025253 Bacteria 7901
64 Ga0209148_1000600 3300025254 Bacteria 32520
65 Ga0209565_1000082 3300025263 Bacteria 154452
66 Ga0209455_1000033 3300025272 Bacteria 504606
67 Ga0209673_1000422 3300025273 Bacteria 73685
68 Ga0209675_1000176 3300025291 Bacteria 73644
69 Ga0209025_1015853 3300025294 Bacteria 4501
70 Ga0209564_1000028 3300025295 Bacteria 510986
71 Ga0209564_1000438 3300025295 Bacteria 71794
72 Ga0209758_1000278 3300025297 Bacteria 102052
73 Ga0209256_1000323 3300025299 Bacteria 82313
74 Ga0207655_1046077 3300025728 Bacteria 1814
75 Ga0207647_10009287 3300025904 Bacteria 6992
76 Ga0207647_10213403 3300025904 Bacteria 1114
77 Ga0207705_10010288 3300025909 Bacteria 6803
78 Ga0207654_10005163 3300025911 Bacteria 6587
79 Ga0207671_10002606 3300025914 Bacteria 19042
80 Ga0207657_10002873 3300025919 Bacteria 18512
81 Ga0207657_10020866 3300025919 Bacteria 6182
82 Ga0207687_10040904 3300025927 Bacteria 3180
83 Ga0207706_10014928 3300025933 Bacteria 7034
84 Ga0207706_10089068 3300025933 Bacteria 2713
85 Ga0207709_10018419 3300025935 Bacteria 3911
86 Ga0207667_10047268 3300025949 Bacteria 4555
87 Ga0207667_10352108 3300025949 Bacteria 1502
88 Ga0207648_10290722 3300026089 Bacteria 1463
89 Ga0207674_10046823 3300026116 Bacteria 4438
90 Ga0207698_10241129 3300026142 Bacteria 1648
91 Ga0209813_10000119 3300027866 Bacteria 28404
92 Ga0265314_10090613 3300031711 Bacteria 1991
93 Ga0307412_10052096 3300031911 Bacteria 2708
94 Ga0307414_10009530 3300032004 Bacteria 5585
95 Ga0307411_10042235 3300032005 Bacteria 2907
96 Ga0395899_0008930 3300037312 Bacteria 7714
97 Ga0395899_0018238 3300037312 Bacteria 5338
98 Ga0395899_0072209 3300037312 Bacteria 2525
99 Ga0395899_0208456 3300037312 Bacteria 1359
100 Ga0395900_0000322 3300037418 Bacteria 70864
101 Ga0395900_0001027 3300037418 Bacteria 35806
102 Ga0395900_0025665 3300037418 Bacteria 6031
103 Ga0395900_0026796 3300037418 Bacteria 5898
104 Ga0395900_0039001 3300037418 Bacteria 4896
105 Ga0395900_0284203 3300037418 Bacteria 1645
106 Ga0395898_0057723 3300037466 Bacteria 3781
107 Ga0395898_0098416 3300037466 Bacteria 2808
108 Ga0395898_0236458 3300037466 Bacteria 1742
109 Ga0395898_0292960 3300037466 Bacteria 1552
110 Ga0395905_0223843 3300037471 Bacteria 1760
111 Ga0395905_0524029 3300037471 Bacteria 1085
112 Ga0395905_0586381 3300037471 Bacteria 1016
113 Ga0395901_0000332 3300038443 Bacteria 57814
114 Ga0395901_0016227 3300038443 Bacteria 7586
115 Ga0395901_0031576 3300038443 Bacteria 5460
116 Ga0395901_0078870 3300038443 Bacteria 3438
117 Ga0395901_0165440 3300038443 Bacteria 2322
118 Ga0395901_0212295 3300038443 Bacteria 2025
119 Ga0439439_0015758 3300041406 Bacteria 1847
120 Ga0439465_0060628 3300041413 Bacteria 1253
121 Ga0451791_0457617 3300041451 Bacteria 1431
122 Ga0451791_1411177 3300041451 Bacteria 1767
123 Ga0451797_0544335 3300041453 Bacteria 2050
124 Ga0451800_1379318 3300041459 Bacteria 1376
125 Ga0451806_406702 3300041462 Bacteria 1924
126 Ga0451807_1233906 3300041486 Bacteria 4397
127 Ga0451837_1272931 3300041494 Bacteria 2114
128 Ga0451845_0709635 3300041501 Bacteria 2065
129 Ga0451843_0892371 3300041509 Bacteria 2691
130 Ga0439448_0005100 3300042005 Bacteria 3735
131 Ga0439448_0008827 3300042005 Bacteria 2957
132 Ga0439448_0011990 3300042005 Bacteria 2589
133 Ga0439455_0000974 3300042012 Bacteria 4478
134 Ga0439455_0016606 3300042012 Bacteria 1705
135 Ga0439458_0000366 3300042157 Bacteria 11347
136 Ga0439458_0004612 3300042157 Bacteria 3145
137 Ga0439458_0008168 3300042157 Bacteria 2326
138 Ga0439458_0042919 3300042157 Bacteria 1102
139 Ga0466969_0002860 3300044656 Bacteria 9221
140 Ga0466972_0085946 3300044658 Bacteria 1495
141 Ga0466965_0015766 3300044683 Bacteria 3591
142 Ga0466965_0070380 3300044683 Bacteria 1758
143 Ga0466965_0071987 3300044683 Bacteria 1739
144 Ga0466966_0000222 3300044684 Bacteria 38030
145 Ga0466966_0032039 3300044684 Bacteria 3409
146 Ga0466966_0032708 3300044684 Bacteria 3368
147 Ga0466966_0033496 3300044684 Bacteria 3326
148 Ga0466963_0032379 3300044694 Bacteria 3385
149 Ga0466964_0008606 3300044706 Bacteria 3836
150 Ga0466964_0134343 3300044706 Bacteria 1130
151 Ga0466968_0001882 3300044735 Bacteria 7587
152 Ga0466970_0037869 3300044765 Bacteria 2558
153 Ga0466970_0082164 3300044765 Bacteria 1742
154 Ga0466957_0000013 3300044842 Bacteria 71310
155 Ga0466957_0014286 3300044842 Bacteria 4622
156 Ga0466957_0130668 3300044842 Bacteria 1608
157 Ga0466959_0049334 3300045049 Bacteria 3092
158 Ga0466959_0145678 3300045049 Bacteria 1671
159 Ga0466958_0002680 3300045836 Bacteria 9016
160 Ga0466958_0214149 3300045836 Bacteria 1228
161 Ga0466958_0303895 3300045836 Bacteria 1024
162 Ga0466967_0023855 3300045976 Bacteria 5020
163 Ga0495617_000011 3300046452 Bacteria 301936
164 Ga0495617_008186 3300046452 Bacteria 3610
165 Ga0495590_0000022 3300046457 Bacteria 205122
166 Ga0495590_0015579 3300046457 Bacteria 2756
167 Ga0495638_0000592 3300046460 Bacteria 40907
168 Ga0495638_0030390 3300046460 Bacteria 3478
169 Ga0495638_0041359 3300046460 Bacteria 2916
170 Ga0495638_0073195 3300046460 Bacteria 2092
171 Ga0495653_0000029 3300046463 Bacteria 145049
172 Ga0495650_0000519 3300046471 Bacteria 57139
173 Ga0495650_0000936 3300046471 Bacteria 33895
174 Ga0495650_0001014 3300046471 Bacteria 31681
175 Ga0495650_0003138 3300046471 Bacteria 12372
176 Ga0495605_0000055 3300046474 Bacteria 157514
177 Ga0495605_0007634 3300046474 Bacteria 6134
178 Ga0495639_0020158 3300046475 Bacteria 2912
179 Ga0495584_0000576 3300046491 Bacteria 24776
180 Ga0495584_0001279 3300046491 Bacteria 15309
181 Ga0495584_0016857 3300046491 Bacteria 3725
182 Ga0495584_0139638 3300046491 Bacteria 1230
183 Ga0495596_0003895 3300046500 Bacteria 7397
184 Ga0495607_0001005 3300046501 Bacteria 25961
185 Ga0495607_0002113 3300046501 Bacteria 16581
186 Ga0495607_0006089 3300046501 Bacteria 8530
187 Ga0495607_0010848 3300046501 Bacteria 6095
188 Ga0495607_0033016 3300046501 Bacteria 3152
189 Ga0495607_0088713 3300046501 Bacteria 1680
190 Ga0495583_0000220 3300046506 Bacteria 96267
191 Ga0495583_0021960 3300046506 Bacteria 3270
192 Ga0495606_0000419 3300046507 Bacteria 71128
193 Ga0495606_0001756 3300046507 Bacteria 27822
194 Ga0495606_0007027 3300046507 Bacteria 10207
195 Ga0495606_0143618 3300046507 Bacteria 1407
196 Ga0495610_0000007 3300046512 Bacteria 820919
197 Ga0495610_0002096 3300046512 Bacteria 17031
198 Ga0495610_0002659 3300046512 Bacteria 14738
199 Ga0495610_0006547 3300046512 Bacteria 7976
200 Ga0495616_0002554 3300046513 Bacteria 12011
201 Ga0495616_0013235 3300046513 Bacteria 4661
202 Ga0495616_0017260 3300046513 Bacteria 3982
203 Ga0495631_0084244 3300046518 Bacteria 1370
204 Ga0495632_0000006 3300046519 Bacteria 345883
205 Ga0495632_0000365 3300046519 Bacteria 43021
206 Ga0495637_0000161 3300046520 Bacteria 51201
207 Ga0495637_0002161 3300046520 Bacteria 11006
208 Ga0495643_0000021 3300046522 Bacteria 293465
209 Ga0495643_0000533 3300046522 Bacteria 47419
210 Ga0495643_0001501 3300046522 Bacteria 21131
211 Ga0495643_0001842 3300046522 Bacteria 18025
212 Ga0495643_0022603 3300046522 Bacteria 3586
213 Ga0495643_0040700 3300046522 Bacteria 2537
214 Ga0495643_0089351 3300046522 Bacteria 1591
215 Ga0495643_0220853 3300046522 Bacteria 899
216 Ga0495648_0000004 3300046524 Bacteria 373639
217 Ga0495648_0002776 3300046524 Bacteria 15794
218 Ga0495648_0005049 3300046524 Bacteria 11083
219 Ga0495648_0017834 3300046524 Bacteria 5058
220 Ga0495648_0101697 3300046524 Bacteria 1585
221 Ga0495648_0137590 3300046524 Bacteria 1289
222 Ga0495663_0000008 3300046525 Bacteria 260614
223 Ga0495642_0004646 3300046528 Bacteria 5319
224 Ga0495654_0064566 3300046530 Bacteria 1750
225 Ga0495609_0000038 3300046538 Bacteria 182264
226 Ga0495609_0000190 3300046538 Bacteria 61573
227 Ga0495609_0037867 3300046538 Bacteria 2175
228 Ga0495597_0001983 3300046542 Bacteria 13734
229 Ga0495597_0112349 3300046542 Bacteria 1141
230 Ga0495622_0000053 3300046557 Bacteria 102938
231 Ga0495622_0000382 3300046557 Bacteria 30517
232 Ga0495633_0000111 3300046558 Bacteria 109982
233 Ga0495633_0000700 3300046558 Bacteria 30672
234 Ga0495633_0001789 3300046558 Bacteria 15868
235 Ga0495633_0002990 3300046558 Bacteria 11561
236 Ga0495633_0003600 3300046558 Bacteria 10252
237 Ga0495656_0019724 3300046615 Bacteria 2606
238 Ga0495668_0000135 3300046616 Bacteria 111827
239 Ga0495668_0000970 3300046616 Bacteria 31672
240 Ga0495668_0001086 3300046616 Bacteria 28354
241 Ga0495668_0007354 3300046616 Bacteria 7055
242 Ga0495668_0009653 3300046616 Bacteria 5902
243 Ga0495668_0123819 3300046616 Bacteria 1414
244 Ga0495625_0003362 3300046660 Bacteria 16070
245 Ga0495625_0027297 3300046660 Bacteria 4300
246 Ga0495625_0035755 3300046660 Bacteria 3658
247 Ga0495659_0002229 3300046664 Bacteria 6302
248 Ga0495661_0000070 3300046665 Bacteria 124795
249 Ga0495661_0000400 3300046665 Bacteria 46177
250 Ga0495661_0002871 3300046665 Bacteria 13037
251 Ga0495661_0021831 3300046665 Bacteria 4167
252 Ga0495661_0131134 3300046665 Bacteria 1373
253 Ga0495588_0000172 3300046674 Bacteria 81934
254 Ga0495669_0025770 3300046684 Bacteria 2566
255 Ga0495670_0137016 3300046691 Bacteria 1278
256 Ga0495671_0000017 3300046692 Bacteria 293465
257 Ga0495671_0000033 3300046692 Bacteria 197509
258 Ga0495671_0071509 3300046692 Bacteria 1704
259 Ga0495649_0004983 3300046694 Bacteria 8540
260 Ga0495649_0015621 3300046694 Bacteria 4316
261 Ga0495649_0103835 3300046694 Bacteria 1509
262 Ga0495649_0133409 3300046694 Bacteria 1310
263 Ga0495589_0000126 3300046794 Bacteria 70547
264 Ga0495589_0000211 3300046794 Bacteria 49487
265 Ga0495660_0000047 3300046810 Bacteria 149291
266 Ga0495636_0016828 3300047318 Bacteria 2924
267 Ga0495672_0000286 3300047320 Bacteria 70060
268 Ga0495672_0000370 3300047320 Bacteria 56357
269 Ga0495672_0000392 3300047320 Bacteria 53737
270 Ga0495683_0019667 3300047323 Bacteria 3484
271 Ga0495683_0020206 3300047323 Bacteria 3437
272 Ga0495687_000071 3300047443 Bacteria 159096
273 Ga0495687_001454 3300047443 Bacteria 21721
274 Ga0495687_004968 3300047443 Bacteria 8695
275 Ga0495687_057821 3300047443 Bacteria 1611
276 Ga0495677_0000016 3300047445 Bacteria 126981
277 Ga0495677_0000429 3300047445 Bacteria 17994
278 Ga0495677_0005213 3300047445 Bacteria 4943
279 Ga0495677_0006244 3300047445 Bacteria 4498
280 Ga0495679_018038 3300047446 Bacteria 2514
281 Ga0495685_010877 3300047447 Bacteria 3057
282 Ga0495673_0000074 3300047469 Bacteria 210788
283 Ga0495673_0000166 3300047469 Bacteria 112730
284 Ga0495681_0007730 3300047470 Bacteria 6818
285 Ga0495681_0028014 3300047470 Bacteria 2905
286 Ga0495686_0000130 3300047472 Bacteria 152244
287 Ga0495686_0004081 3300047472 Bacteria 12186
288 Ga0495686_0004395 3300047472 Bacteria 11613
289 Ga0495686_0025378 3300047472 Bacteria 3885
290 Ga0495626_0000005 3300048091 Bacteria 337534
291 Ga0495626_0000042 3300048091 Bacteria 169058
292 Ga0495626_0000533 3300048091 Bacteria 37890
293 Ga0495626_0005639 3300048091 Bacteria 7252
294 Ga0495626_0008046 3300048091 Bacteria 5819
295 Ga0495626_0010689 3300048091 Bacteria 4883
296 Ga0496100_0263427 3300048903 Bacteria 1279
297 Ga0496102_0033976 3300048905 Bacteria 4586
298 Ga0496104_0116242 3300048907 Bacteria 2567
299 Ga0496104_0551881 3300048907 Bacteria 1063
300 Ga0496105_0180689 3300048908 Bacteria 1728
301 Ga0496106_0001337 3300048909 Bacteria 18480
302 Ga0496106_0424383 3300048909 Bacteria 1069
303 Ga0496107_0097749 3300048910 Bacteria 2150
304 Ga0496107_0217736 3300048910 Bacteria 1420
305 Ga0496113_0013889 3300048916 Bacteria 5474
306 Ga0496115_0427795 3300048918 Bacteria 1072
307 Ga0496116_0000108 3300048919 Bacteria 187993
308 Ga0496116_0016484 3300048919 Bacteria 5778
309 Ga0496117_0176412 3300048920 Bacteria 1234
310 Ga0496118_0029527 3300048921 Bacteria 4596
311 Ga0496119_0022107 3300048922 Bacteria 4568
312 Ga0496121_0005905 3300048924 Bacteria 15494
313 Ga0496122_0001079 3300048925 Bacteria 47351
314 Ga0496122_0048672 3300048925 Bacteria 3255
315 Ga0496122_0082758 3300048925 Bacteria 2228
316 Ga0496122_0138112 3300048925 Bacteria 1531
317 Ga0496123_0001623 3300048926 Bacteria 30278
318 Ga0496123_0002969 3300048926 Bacteria 19747
319 Ga0496124_0000043 3300048927 Bacteria 300907
320 Ga0496124_0000495 3300048927 Bacteria 67554
321 Ga0496124_0001310 3300048927 Bacteria 37574
322 Ga0496124_0002742 3300048927 Bacteria 22465
323 Ga0496124_0006067 3300048927 Bacteria 13294
324 Ga0496124_0096051 3300048927 Bacteria 2408
325 Ga0496124_0099091 3300048927 Bacteria 2364
326 Ga0496124_0182912 3300048927 Bacteria 1611
327 Ga0496124_0378185 3300048927 Bacteria 991
328 Ga0496125_0007772 3300048928 Bacteria 11345
329 Ga0496126_0001869 3300048929 Bacteria 30670
330 Ga0495678_001093 3300049459 Bacteria 22888
331 Ga0495678_002276 3300049459 Bacteria 13323
332 Ga0495678_010297 3300049459 Bacteria 4553
333 Ga0501035_0035484 3300049822 Bacteria 4525
334 nmdc:mga03n38_19180_c1 3300050490 Bacteria 2713
335 nmdc:mga06z11_80_c1 3300050494 Bacteria 40560
336 nmdc:mga04h51_82_c1 3300050495 Bacteria 29569
337 nmdc:mga07m45_101130_c1 3300050496 Bacteria 1655
338 nmdc:mga07m45_10462_c1 3300050496 Bacteria 4847
339 Ga0500594_0006936 3300053118 Bacteria 2554
340 Ga0500559_0102309 3300053136 Bacteria 1321
341 Ga0500586_012801 3300053145 Bacteria 2451
342 2512644836 2512564014 Bacteria 4639632
343 2600224501 2599185359 Bacteria 4772316
344 2643801204 2643221556 Bacteria 7251154
345 2644471804 2643221684 Bacteria 7145183
346 2738827809 2738541297 Bacteria 6549566
347 2739151605 2738541357 Bacteria 6549408
348 2739193525 2738543003 Bacteria 6549560
349 2739320001 2738543026 Bacteria 6549408
350 2739338242 2738543029 Bacteria 6549249
351 2739794016 2739367756 Bacteria 4553612
352 2809146496 2808606418 Bacteria 6724496
353 2819551467 2818991438 Bacteria 5793701
354 2819716662 2818991466 Bacteria 4748179
355 2821136207 2821131069 Bacteria 6108407
356 2857569431 2857564685 Bacteria 6290584
357 2928530951 2928526807 Bacteria 4760224
358 2928972450 2928968154 Bacteria 4633371
359 2990267808 2990265787 Bacteria 3943888
360 2993694951 2993693658 Bacteria 4040749
361 8047675398 8047673197 Bacteria 7395230
362 8054306149 8054302542 Bacteria 5698134
363 Ga0157373_10063247
364 JGI24736J21556_1010461
365 JGI24739J22299_10004027
366 JGI24739J22299_10016341
367 JGI24735J21928_10003198
368 JGI24735J21928_10034227
369 JGI25153J46596_10072565
370 rootH1_10018568
371 rootH1_10096628
372 rootH2_10016741
373 rootL2_10009593
374 rootL2_10018135
375 rootL2_10039709
376 rootL2_10056953
377 rootL2_10355809
378 rootH1_10027754
379 Ga0055525_1000028
380 Ga0055529_1000027
381 Ga0055526_1000026
382 Ga0055526_1011553
383 Ga0055537_1000100
384 Ga0055524_1011042
385 Ga0055534_1000085
386 Ga0055528_1000458
387 Ga0065165_1044660
388 Ga0070658_10255623
389 Ga0070660_100015173
390 Ga0070660_100017752
391 Ga0070661_100135977
392 Ga0070659_100101805
393 Ga0070659_100300469
394 Ga0070665_100655472
395 Ga0068855_100007105
396 Ga0068855_100318507
397 Ga0068857_100051427
398 Ga0068854_100029627
399 Ga0068852_100087313
400 Ga0075368_10000192
401 Ga0075363_100052449
402 Ga0075363_100155596
403 Ga0075367_10000053
404 Ga0075366_10253469
405 Ga0075370_10082256
406 Ga0075370_10124345
407 Ga0105244_10001844
408 Ga0105244_10007825
409 Ga0105244_10145350
410 Ga0105240_10738095
411 Ga0105245_10248151
412 Ga0105243_10059929
413 Ga0105241_10007989
414 Ga0105242_10007310
415 Ga0105237_10083174
416 Ga0157371_10000003
417 Ga0157371_10070879
418 Ga0182008_10018396
419 Ga0182007_10036268
420 Ga0182007_10087800
421 Ga0209563_100011
422 Ga0209437_114802
423 Ga0207425_1000381
424 Ga0209677_102081
425 Ga0209148_1000600
426 Ga0209565_1000082
427 Ga0209455_1000033
428 Ga0209673_1000422
429 Ga0209675_1000176
430 Ga0209025_1015853
431 Ga0209564_1000028
432 Ga0209564_1000438
433 Ga0209758_1000278
434 Ga0209256_1000323
435 Ga0207655_1046077
436 Ga0207647_10009287
437 Ga0207647_10213403
438 Ga0207705_10010288
439 Ga0207654_10005163
440 Ga0207671_10002606
441 Ga0207657_10002873
442 Ga0207657_10020866
443 Ga0207687_10040904
444 Ga0207706_10014928
445 Ga0207706_10089068
446 Ga0207709_10018419
447 Ga0207667_10047268
448 Ga0207667_10352108
449 Ga0207648_10290722
450 Ga0207674_10046823
451 Ga0207698_10241129
452 Ga0209813_10000119
453 Ga0265314_10090613
454 Ga0307412_10052096
455 Ga0307414_10009530
456 Ga0307411_10042235
457 Ga0395899_0008930
458 Ga0395899_0018238
459 Ga0395899_0072209
460 Ga0395899_0208456
461 Ga0395900_0000322
462 Ga0395900_0001027
463 Ga0395900_0025665
464 Ga0395900_0026796
465 Ga0395900_0039001
466 Ga0395900_0284203
467 Ga0395898_0057723
468 Ga0395898_0098416
469 Ga0395898_0236458
470 Ga0395898_0292960
471 Ga0395905_0223843
472 Ga0395905_0524029
473 Ga0395905_0586381
474 Ga0395901_0000332
475 Ga0395901_0016227
476 Ga0395901_0031576
477 Ga0395901_0078870
478 Ga0395901_0165440
479 Ga0395901_0212295
480 Ga0439439_0015758
481 Ga0439465_0060628
482 Ga0451791_0457617
483 Ga0451791_1411177
484 Ga0451797_0544335
485 Ga0451800_1379318
486 Ga0451806_406702
487 Ga0451807_1233906
488 Ga0451837_1272931
489 Ga0451845_0709635
490 Ga0451843_0892371
491 Ga0439448_0005100
492 Ga0439448_0008827
493 Ga0439448_0011990
494 Ga0439455_0000974
495 Ga0439455_0016606
496 Ga0439458_0000366
497 Ga0439458_0004612
498 Ga0439458_0008168
499 Ga0439458_0042919
500 Ga0466969_0002860
501 Ga0466972_0085946
502 Ga0466965_0015766
503 Ga0466965_0070380
504 Ga0466965_0071987
505 Ga0466966_0000222
506 Ga0466966_0032039
507 Ga0466966_0032708
508 Ga0466966_0033496
509 Ga0466963_0032379
510 Ga0466964_0008606
511 Ga0466964_0134343
512 Ga0466968_0001882
513 Ga0466970_0037869
514 Ga0466970_0082164
515 Ga0466957_0000013
516 Ga0466957_0014286
517 Ga0466957_0130668
518 Ga0466959_0049334
519 Ga0466959_0145678
520 Ga0466958_0002680
521 Ga0466958_0214149
522 Ga0466958_0303895
523 Ga0466967_0023855
524 Ga0495617_000011
525 Ga0495617_008186
526 Ga0495590_0000022
527 Ga0495590_0015579
528 Ga0495638_0000592
529 Ga0495638_0030390
530 Ga0495638_0041359
531 Ga0495638_0073195
532 Ga0495653_0000029
533 Ga0495650_0000519
534 Ga0495650_0000936
535 Ga0495650_0001014
536 Ga0495650_0003138
537 Ga0495605_0000055
538 Ga0495605_0007634
539 Ga0495639_0020158
540 Ga0495584_0000576
541 Ga0495584_0001279
542 Ga0495584_0016857
543 Ga0495584_0139638
544 Ga0495596_0003895
545 Ga0495607_0001005
546 Ga0495607_0002113
547 Ga0495607_0006089
548 Ga0495607_0010848
549 Ga0495607_0033016
550 Ga0495607_0088713
551 Ga0495583_0000220
552 Ga0495583_0021960
553 Ga0495606_0000419
554 Ga0495606_0001756
555 Ga0495606_0007027
556 Ga0495606_0143618
557 Ga0495610_0000007
558 Ga0495610_0002096
559 Ga0495610_0002659
560 Ga0495610_0006547
561 Ga0495616_0002554
562 Ga0495616_0013235
563 Ga0495616_0017260
564 Ga0495631_0084244
565 Ga0495632_0000006
566 Ga0495632_0000365
567 Ga0495637_0000161
568 Ga0495637_0002161
569 Ga0495643_0000021
570 Ga0495643_0000533
571 Ga0495643_0001501
572 Ga0495643_0001842
573 Ga0495643_0022603
574 Ga0495643_0040700
575 Ga0495643_0089351
576 Ga0495643_0220853
577 Ga0495648_0000004
578 Ga0495648_0002776
579 Ga0495648_0005049
580 Ga0495648_0017834
581 Ga0495648_0101697
582 Ga0495648_0137590
583 Ga0495663_0000008
584 Ga0495642_0004646
585 Ga0495654_0064566
586 Ga0495609_0000038
587 Ga0495609_0000190
588 Ga0495609_0037867
589 Ga0495597_0001983
590 Ga0495597_0112349
591 Ga0495622_0000053
592 Ga0495622_0000382
593 Ga0495633_0000111
594 Ga0495633_0000700
595 Ga0495633_0001789
596 Ga0495633_0002990
597 Ga0495633_0003600
598 Ga0495656_0019724
599 Ga0495668_0000135
600 Ga0495668_0000970
601 Ga0495668_0001086
602 Ga0495668_0007354
603 Ga0495668_0009653
604 Ga0495668_0123819
605 Ga0495625_0003362
606 Ga0495625_0027297
607 Ga0495625_0035755
608 Ga0495659_0002229
609 Ga0495661_0000070
610 Ga0495661_0000400
611 Ga0495661_0002871
612 Ga0495661_0021831
613 Ga0495661_0131134
614 Ga0495588_0000172
615 Ga0495669_0025770
616 Ga0495670_0137016
617 Ga0495671_0000017
618 Ga0495671_0000033
619 Ga0495671_0071509
620 Ga0495649_0004983
621 Ga0495649_0015621
622 Ga0495649_0103835
623 Ga0495649_0133409
624 Ga0495589_0000126
625 Ga0495589_0000211
626 Ga0495660_0000047
627 Ga0495636_0016828
628 Ga0495672_0000286
629 Ga0495672_0000370
630 Ga0495672_0000392
631 Ga0495683_0019667
632 Ga0495683_0020206
633 Ga0495687_000071
634 Ga0495687_001454
635 Ga0495687_004968
636 Ga0495687_057821
637 Ga0495677_0000016
638 Ga0495677_0000429
639 Ga0495677_0005213
640 Ga0495677_0006244
641 Ga0495679_018038
642 Ga0495685_010877
643 Ga0495673_0000074
644 Ga0495673_0000166
645 Ga0495681_0007730
646 Ga0495681_0028014
647 Ga0495686_0000130
648 Ga0495686_0004081
649 Ga0495686_0004395
650 Ga0495686_0025378
651 Ga0495626_0000005
652 Ga0495626_0000042
653 Ga0495626_0000533
654 Ga0495626_0005639
655 Ga0495626_0008046
656 Ga0495626_0010689
657 Ga0496100_0263427
658 Ga0496102_0033976
659 Ga0496104_0116242
660 Ga0496104_0551881
661 Ga0496105_0180689
662 Ga0496106_0001337
663 Ga0496106_0424383
664 Ga0496107_0097749
665 Ga0496107_0217736
666 Ga0496113_0013889
667 Ga0496115_0427795
668 Ga0496116_0000108
669 Ga0496116_0016484
670 Ga0496117_0176412
671 Ga0496118_0029527
672 Ga0496119_0022107
673 Ga0496121_0005905
674 Ga0496122_0001079
675 Ga0496122_0048672
676 Ga0496122_0082758
677 Ga0496122_0138112
678 Ga0496123_0001623
679 Ga0496123_0002969
680 Ga0496124_0000043
681 Ga0496124_0000495
682 Ga0496124_0001310
683 Ga0496124_0002742
684 Ga0496124_0006067
685 Ga0496124_0096051
686 Ga0496124_0099091
687 Ga0496124_0182912
688 Ga0496124_0378185
689 Ga0496125_0007772
690 Ga0496126_0001869
691 Ga0495678_001093
692 Ga0495678_002276
693 Ga0495678_010297
694 Ga0501035_0035484
695 nmdc:mga03n38_19180_c1
696 nmdc:mga06z11_80_c1
697 nmdc:mga04h51_82_c1
698 nmdc:mga07m45_101130_c1
699 nmdc:mga07m45_10462_c1
700 Ga0500594_0006936
701 Ga0500559_0102309
702 Ga0500586_012801
703 2512644836
704 2600224501
705 2643801204
706 2644471804
707 2738827809
708 2739151605
709 2739193525
710 2739320001
711 2739338242
712 2739794016
713 2809146496
714 2819551467
715 2819716662
716 2821136207
717 2857569431
718 2928530951
719 2928972450
720 2990267808
721 2993694951
722 8047675398
723 8054306149

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06283

ThuA

Trehalose utilisation

38

258

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pxy-assembly1.cif.gz_A crystal structure of a putative thua-like protein (bacuni_01602) from bacteroides uniformis atcc 8492 at 1.50 a resolution 0.8273 27 250
4e5v-assembly2.cif.gz_B crystal structure of a putative thua-like protein (parmer_02418) from parabacteroides merdae atcc 43184 at 1.75 a resolution 0.7659 27 256
4pxy-assembly1.cif.gz_A crystal structure of a putative thua-like protein (bacuni_01602) from bacteroides uniformis atcc 8492 at 1.50 a resolution 0.7616 27 250
4irq-assembly3.cif.gz_C crystal structure of catalytic domain of human beta1,4galactosyltransferase 7 in closed conformation in complex with manganese and udp 0.7081 25 63
4irp-assembly3.cif.gz_B crystal structure of catalytic domain of human beta1,4-galactosyltransferase-7 in open conformation with manganses and udp 0.7021 22 63
ID Description Score Start End Superfamily
4pxyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8295 27 250 3.40.50.880
4pxyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7628 27 250 3.40.50.880
4e5vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7547 25 256 3.40.50.880
4irpB00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7021 22 63 3.90.550.10
af_P20966_1_97_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6907 28 110 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A4Q3IDD9-F1-model_v4 deleted 0.9872 121 256
AF-A0A4Q6CLZ4-F1-model_v4 deleted 0.9861 86 256
AF-A0A4Q6CLZ4-F1-model_v4 deleted 0.9804 86 256
AF-A0A4Q3IDD9-F1-model_v4 deleted 0.9801 121 256
AF-A0A031HR95-F1-model_v4 ThuA-like domain-containing protein 0.9727 16 255

Map