F422198

General Info

Members Datasets Scaffolds Average Seq Length
361 206 350 208

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10097632|Ga0105243_100976323
Length 231
Sequence MTNVEGEPMTTTANVPARGQRLPKSARRAQLLEAAQATFVEYGYHSAAMDEIADRAGVSKPVLYQHFPGKLDLYLALIDHHRGLLEQAVRDALASTTDNKQRVIACIDAYFEFVSRQGAPFRLIFESDLTNEPAVAERVEGVALTCGEALAEVIAGDTDLSDADAHLLGMALTGMAQVSARYWLSRGDWGPGEAGEVPREEAARIVGQLAWRGIGGFPKSEQVEQAALSRS

Samples

Sample ID Description Type Environment
1 2643221561 Nocardioides sp. Root151 Isolate Unclassified
2 2643221615 Nocardioides sp. Root224 Isolate Unclassified
3 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
4 2643221696 Nocardioides sp. Root140 Isolate Unclassified
5 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
6 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
7 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
8 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
9 2867369537 Streptomyces sp. Z26 Isolate Unclassified
10 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
100 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
101 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
102 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
103 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
104 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
114 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
115 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
116 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
117 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
119 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
120 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
128 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
129 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
130 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
131 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
132 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
133 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
169 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
206 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.57
Metatranscriptomes 1.39
Isolates 3.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.66
Nodule 0
Rhizoplane 13.85
Rhizosphere 79.78
Stem 0
Stem Tuber 0
Unclassified 4.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10003829 3300002075 Bacteria 3759
2 Ga0070658_10194385 3300005327 Bacteria 1711
3 Ga0070683_100034545 3300005329 Bacteria 4620
4 Ga0070683_100121117 3300005329 Bacteria 2472
5 Ga0070683_100236393 3300005329 Bacteria 1737
6 Ga0070683_100569212 3300005329 Bacteria 1084
7 Ga0070690_100317737 3300005330 Bacteria 1121
8 Ga0070670_100327116 3300005331 Bacteria 1344
9 Ga0070670_100624729 3300005331 Bacteria 965
10 Ga0070682_100022521 3300005337 Bacteria 3733
11 Ga0070682_100055009 3300005337 Bacteria 2498
12 Ga0070682_100363778 3300005337 Bacteria 1082
13 Ga0068868_100088102 3300005338 Bacteria 2498
14 Ga0068868_100209675 3300005338 Bacteria 1628
15 Ga0068868_100349622 3300005338 Bacteria 1266
16 Ga0070660_100167749 3300005339 Bacteria 1772
17 Ga0070689_100140653 3300005340 Bacteria 1941
18 Ga0070691_10053624 3300005341 Bacteria 1929
19 Ga0070692_10010777 3300005345 Bacteria 4176
20 Ga0070675_100063505 3300005354 Bacteria 3053
21 Ga0070674_100109361 3300005356 Bacteria 2027
22 Ga0070673_100049531 3300005364 Bacteria 3280
23 Ga0070659_100569835 3300005366 Bacteria 971
24 Ga0070667_100971250 3300005367 Bacteria 792
25 Ga0070663_100099277 3300005455 Bacteria 2170
26 Ga0070663_100614621 3300005455 Bacteria 915
27 Ga0070678_100138766 3300005456 Bacteria 1942
28 Ga0070662_100180398 3300005457 Bacteria 1664
29 Ga0068867_100005197 3300005459 Bacteria 9186
30 Ga0070685_10282512 3300005466 Bacteria 1112
31 Ga0070698_100007036 3300005471 Bacteria 12186
32 Ga0070684_100042445 3300005535 Bacteria 3926
33 Ga0070684_100721714 3300005535 Bacteria 930
34 Ga0070672_100007939 3300005543 Bacteria 7249
35 Ga0070686_100040392 3300005544 Bacteria 2911
36 Ga0070664_100505669 3300005564 Bacteria 1114
37 Ga0070702_100001326 3300005615 Bacteria 10037
38 Ga0068852_100014642 3300005616 Bacteria 6047
39 Ga0068852_100054261 3300005616 Bacteria 3454
40 Ga0068866_10114143 3300005718 Bacteria 1512
41 Ga0068861_100046229 3300005719 Bacteria 3281
42 Ga0068861_100574541 3300005719 Bacteria 1031
43 Ga0068870_10003690 3300005840 Bacteria 6508
44 Ga0068862_100215416 3300005844 Bacteria 1737
45 Ga0075365_10282749 3300006038 Bacteria 1167
46 Ga0075365_10514933 3300006038 Bacteria 846
47 Ga0070716_100111220 3300006173 Bacteria 1698
48 Ga0068865_100319867 3300006881 Bacteria 1248
49 Ga0068865_100583250 3300006881 Bacteria 943
50 Ga0111539_10121164 3300009094 Bacteria 3065
51 Ga0111539_10789209 3300009094 Bacteria 1105
52 Ga0105245_10157041 3300009098 Bacteria 2155
53 Ga0105245_10469564 3300009098 Bacteria 1270
54 Ga0105245_10631231 3300009098 Bacteria 1100
55 Ga0105245_11433159 3300009098 Bacteria 741
56 Ga0105247_10237131 3300009101 Bacteria 1241
57 Ga0114129_10106836 3300009147 Bacteria 3866
58 Ga0105243_10001391 3300009148 Bacteria 21405
59 Ga0105243_10097632 3300009148 Bacteria 2432
60 Ga0105242_10241685 3300009176 Bacteria 1623
61 Ga0105242_10478904 3300009176 Bacteria 1179
62 Ga0105242_10932003 3300009176 Bacteria 871
63 Ga0105248_10025357 3300009177 Bacteria 6591
64 Ga0105248_10972678 3300009177 Bacteria 959
65 Ga0105238_10141549 3300009551 Bacteria 2382
66 Ga0105238_10953697 3300009551 Bacteria 878
67 Ga0105249_10002076 3300009553 Bacteria 17368
68 Ga0105249_10251044 3300009553 Bacteria 1754
69 Ga0105249_11537318 3300009553 Bacteria 738
70 Ga0105239_10406142 3300010375 Bacteria 1542
71 Ga0105239_10512189 3300010375 Bacteria 1365
72 Ga0105246_10058265 3300011119 Bacteria 2675
73 Ga0105246_10590523 3300011119 Bacteria 958
74 Ga0157370_10450056 3300013104 Bacteria 1184
75 Ga0157369_10382821 3300013105 Bacteria 1460
76 Ga0157374_10290029 3300013296 Bacteria 1617
77 Ga0163162_10379482 3300013306 Bacteria 1547
78 Ga0163162_10781011 3300013306 Bacteria 1073
79 Ga0157372_10128746 3300013307 Bacteria 2911
80 Ga0157372_11535245 3300013307 Bacteria 767
81 Ga0157375_11026492 3300013308 Bacteria 963
82 Ga0163163_10086482 3300014325 Bacteria 3144
83 Ga0163163_10175818 3300014325 Bacteria 2187
84 Ga0157380_10270036 3300014326 Bacteria 1550
85 Ga0157380_10349885 3300014326 Bacteria 1382
86 Ga0157380_10494826 3300014326 Bacteria 1186
87 Ga0157377_10002878 3300014745 Bacteria 7691
88 Ga0157377_10089155 3300014745 Bacteria 1818
89 Ga0157377_10215675 3300014745 Bacteria 1226
90 Ga0163161_10177862 3300017792 Bacteria 1630
91 Ga0206353_10112771 3300020082 Bacteria 1115
92 Ga0206353_10134077 3300020082 Bacteria 9223
93 Ga0206353_10839062 3300020082 Bacteria 809
94 Ga0206353_11176613 3300020082 Bacteria 3065
95 Ga0207682_10277133 3300025893 Bacteria 784
96 Ga0207688_10003906 3300025901 Bacteria 8129
97 Ga0207688_10223864 3300025901 Bacteria 1134
98 Ga0207643_10002935 3300025908 Bacteria 9206
99 Ga0207705_10311771 3300025909 Bacteria 1208
100 Ga0207684_10365908 3300025910 Bacteria 1241
101 Ga0207657_10209218 3300025919 Bacteria 1566
102 Ga0207646_10216518 3300025922 Bacteria 1730
103 Ga0207681_10227581 3300025923 Bacteria 1446
104 Ga0207650_10245265 3300025925 Bacteria 1449
105 Ga0207659_10530390 3300025926 Bacteria 999
106 Ga0207687_10067354 3300025927 Bacteria 2547
107 Ga0207687_10640183 3300025927 Bacteria 899
108 Ga0207690_10241973 3300025932 Bacteria 1390
109 Ga0207706_10421678 3300025933 Bacteria 1156
110 Ga0207686_10144068 3300025934 Bacteria 1650
111 Ga0207686_10328208 3300025934 Bacteria 1146
112 Ga0207670_10276521 3300025936 Bacteria 1307
113 Ga0207669_10098482 3300025937 Bacteria 1926
114 Ga0207669_10254668 3300025937 Bacteria 1309
115 Ga0207704_10312277 3300025938 Bacteria 1209
116 Ga0207665_10599483 3300025939 Bacteria 860
117 Ga0207691_10004297 3300025940 Bacteria 13840
118 Ga0207691_10353813 3300025940 Bacteria 1256
119 Ga0207711_10110575 3300025941 Bacteria 2443
120 Ga0207661_10132422 3300025944 Bacteria 2138
121 Ga0207679_10241955 3300025945 Bacteria 1529
122 Ga0207651_10034874 3300025960 Bacteria 3264
123 Ga0207712_10209700 3300025961 Bacteria 1551
124 Ga0207677_10229522 3300026023 Bacteria 1494
125 Ga0207677_10537294 3300026023 Bacteria 1017
126 Ga0207678_10154741 3300026067 Bacteria 1957
127 Ga0207678_10715936 3300026067 Bacteria 881
128 Ga0207708_10004360 3300026075 Bacteria 10429
129 Ga0207648_10000657 3300026089 Bacteria 38679
130 Ga0207675_100004832 3300026118 Bacteria 12978
131 Ga0207683_10024174 3300026121 Bacteria 5229
132 Ga0207683_10132899 3300026121 Bacteria 2238
133 Ga0207698_10017359 3300026142 Bacteria 4879
134 Ga0207698_10088157 3300026142 Bacteria 2530
135 Ga0316181_1270130 3300030744 Bacteria 3461
136 Ga0316575_10000402 3300031665 Bacteria 12338
137 Ga0316579_10004938 3300031691 Bacteria 5342
138 Ga0316579_10008693 3300031691 Bacteria 4243
139 Ga0316579_10117623 3300031691 Bacteria 1276
140 Ga0316576_10013670 3300031727 Bacteria 5405
141 Ga0316576_10041888 3300031727 Bacteria 3298
142 Ga0316576_10123583 3300031727 Bacteria 1944
143 Ga0316578_10002423 3300031728 Bacteria 8174
144 Ga0316578_10005181 3300031728 Bacteria 6284
145 Ga0316578_10009335 3300031728 Bacteria 5042
146 Ga0316577_10043992 3300031733 Bacteria 2497
147 Ga0307413_10018518 3300031824 Bacteria 3657
148 Ga0307407_10010966 3300031903 Bacteria 4294
149 Ga0307407_10353724 3300031903 Bacteria 1041
150 Ga0307407_10356416 3300031903 Bacteria 1037
151 Ga0307412_10213475 3300031911 Bacteria 1474
152 Ga0307409_100008760 3300031995 Bacteria 6167
153 Ga0307416_100025327 3300032002 Bacteria 4347
154 Ga0307414_10412440 3300032004 Bacteria 1176
155 Ga0307411_10354876 3300032005 Bacteria 1197
156 Ga0307415_100016620 3300032126 Bacteria 4391
157 Ga0316583_10008427 3300032133 Bacteria 3719
158 Ga0316583_10049846 3300032133 Bacteria 1474
159 Ga0316585_10010572 3300032137 Bacteria 2710
160 Ga0316580_10002795 3300032139 Bacteria 4864
161 Ga0307507_10000020 3300033179 Bacteria 220880
162 Ga0316596_1030704 3300033541 Bacteria 1394
163 Ga0316574_0000472 3300035398 Bacteria 16265
164 Ga0316574_0002491 3300035398 Bacteria 9252
165 Ga0316574_0019204 3300035398 Bacteria 4029
166 Ga0316574_0021558 3300035398 Bacteria 3827
167 Ga0316582_0005888 3300036647 Bacteria 6374
168 Ga0316582_0012104 3300036647 Bacteria 4802
169 Ga0316584_0000855 3300036712 Bacteria 17288
170 Ga0316584_0010405 3300036712 Bacteria 6498
171 Ga0316584_0031778 3300036712 Bacteria 3903
172 Ga0373925_0001252 3300037068 Bacteria 22412
173 Ga0395899_0001441 3300037312 Bacteria 20309
174 Ga0395900_0008632 3300037418 Bacteria 10471
175 Ga0395900_0047211 3300037418 Bacteria 4434
176 Ga0395905_0324677 3300037471 Bacteria 1429
177 Ga0395901_0001859 3300038443 Bacteria 21826
178 Ga0395901_0164454 3300038443 Bacteria 2330
179 Ga0395901_0560939 3300038443 Bacteria 1156
180 Ga0395901_1137124 3300038443 Bacteria 749
181 Ga0436365_0926935 3300039437 Bacteria 1459
182 Ga0451793_0599232 3300041452 Bacteria 2656
183 Ga0451833_0867190 3300041491 Bacteria 2364
184 Ga0451837_0348643 3300041494 Bacteria 2463
185 Ga0451839_0663409 3300041496 Bacteria 1981
186 Ga0451841_0010491 3300041498 Bacteria 1347
187 Ga0451841_1019386 3300041498 Bacteria 1706
188 Ga0439463_149178 3300042016 Bacteria 606
189 Ga0450900_013575 3300042136 Bacteria 1078
190 Ga0466972_0318417 3300044658 Bacteria 727
191 Ga0466965_0177945 3300044683 Bacteria 1121
192 Ga0466970_0004975 3300044765 Bacteria 6567
193 Ga0466970_0302575 3300044765 Bacteria 902
194 Ga0466957_0024546 3300044842 Bacteria 3568
195 Ga0466957_0064731 3300044842 Bacteria 2250
196 Ga0466957_0117090 3300044842 Bacteria 1696
197 Ga0466957_0337229 3300044842 Bacteria 1020
198 Ga0466960_0026584 3300044901 Bacteria 2631
199 Ga0466960_0085346 3300044901 Bacteria 1599
200 Ga0466958_0076386 3300045836 Bacteria 2056
201 Ga0466967_0149858 3300045976 Bacteria 2179
202 Ga0466967_0235837 3300045976 Bacteria 1743
203 Ga0466967_0264787 3300045976 Bacteria 1645
204 Ga0495603_0133408 3300046455 Bacteria 1446
205 Ga0495641_0077320 3300046461 Bacteria 1492
206 Ga0495639_0142267 3300046475 Bacteria 1154
207 Ga0495664_0060721 3300046477 Bacteria 2251
208 Ga0495608_0192057 3300046511 Bacteria 1289
209 Ga0495621_0251042 3300046539 Bacteria 723
210 Ga0495667_0234222 3300046559 Bacteria 1170
211 Ga0495635_0043696 3300046663 Bacteria 3092
212 Ga0495635_0251476 3300046663 Bacteria 1191
213 Ga0495624_0287751 3300046690 Bacteria 992
214 Ga0495680_0182849 3300047322 Bacteria 1512
215 Ga0495675_0149214 3300047444 Bacteria 1445
216 Ga0496100_0087196 3300048903 Bacteria 2122
217 Ga0496101_0100033 3300048904 Bacteria 2169
218 Ga0496102_0125045 3300048905 Bacteria 2403
219 Ga0496102_0170768 3300048905 Bacteria 2047
220 Ga0496102_0234349 3300048905 Bacteria 1731
221 Ga0496102_0442057 3300048905 Bacteria 1220
222 Ga0496103_0055264 3300048906 Bacteria 2462
223 Ga0496104_0081848 3300048907 Bacteria 3079
224 Ga0496104_0216636 3300048907 Bacteria 1826
225 Ga0496104_0295652 3300048907 Bacteria 1532
226 Ga0496104_0407784 3300048907 Bacteria 1271
227 Ga0496105_0114360 3300048908 Bacteria 2226
228 Ga0496105_0198311 3300048908 Bacteria 1639
229 Ga0496105_0316592 3300048908 Bacteria 1251
230 Ga0496105_0359543 3300048908 Bacteria 1162
231 Ga0496106_0020875 3300048909 Bacteria 4860
232 Ga0496106_0032866 3300048909 Bacteria 3869
233 Ga0496106_0196288 3300048909 Bacteria 1606
234 Ga0496107_0035013 3300048910 Bacteria 3599
235 Ga0496108_0027715 3300048911 Bacteria 4682
236 Ga0496108_0133838 3300048911 Bacteria 2131
237 Ga0496108_0157459 3300048911 Bacteria 1962
238 Ga0496108_0380233 3300048911 Bacteria 1233
239 Ga0496109_0029073 3300048912 Bacteria 4947
240 Ga0496109_0056934 3300048912 Bacteria 3567
241 Ga0496109_0155970 3300048912 Bacteria 2138
242 Ga0496109_0487831 3300048912 Bacteria 1163
243 Ga0496109_0666454 3300048912 Bacteria 977
244 Ga0496110_0110628 3300048913 Bacteria 2468
245 Ga0496110_0178634 3300048913 Bacteria 1927
246 Ga0496110_0367617 3300048913 Bacteria 1310
247 Ga0496110_0448973 3300048913 Bacteria 1175
248 Ga0496111_0035659 3300048914 Bacteria 3556
249 Ga0496111_0186836 3300048914 Bacteria 1540
250 Ga0496111_0229244 3300048914 Bacteria 1380
251 Ga0496112_0486320 3300048915 Bacteria 1170
252 Ga0496112_0591628 3300048915 Bacteria 1042
253 Ga0496113_0094525 3300048916 Bacteria 2309
254 Ga0496113_0109654 3300048916 Bacteria 2147
255 Ga0496114_0007108 3300048917 Bacteria 8832
256 Ga0496114_0027212 3300048917 Bacteria 4682
257 Ga0496114_0042355 3300048917 Bacteria 3774
258 Ga0496114_0048912 3300048917 Bacteria 3518
259 Ga0496114_0118965 3300048917 Bacteria 2270
260 Ga0496114_0450601 3300048917 Bacteria 1140
261 Ga0496114_0514627 3300048917 Bacteria 1058
262 Ga0496114_0681498 3300048917 Bacteria 902
263 Ga0496115_0166481 3300048918 Bacteria 1823
264 Ga0496115_0220797 3300048918 Bacteria 1564
265 Ga0501298_038140 3300049521 Bacteria 967
266 Ga0501299_017332 3300049522 Bacteria 1284
267 Ga0501031_0101803 3300049568 Bacteria 1874
268 Ga0501031_0288777 3300049568 Bacteria 1063
269 Ga0501033_0000762 3300049570 Bacteria 29642
270 Ga0501034_0036804 3300049571 Bacteria 4956
271 Ga0501034_0078437 3300049571 Bacteria 3307
272 Ga0501034_0121857 3300049571 Bacteria 2594
273 Ga0501034_0281381 3300049571 Bacteria 1603
274 Ga0501034_0295225 3300049571 Bacteria 1558
275 Ga0501034_0381289 3300049571 Bacteria 1335
276 Ga0501034_0524087 3300049571 Bacteria 1097
277 Ga0501036_0023382 3300049572 Bacteria 5206
278 Ga0501036_0025494 3300049572 Bacteria 4988
279 Ga0501036_0059725 3300049572 Bacteria 3231
280 Ga0501036_0107254 3300049572 Bacteria 2362
281 Ga0501036_0150376 3300049572 Bacteria 1964
282 Ga0501037_0004314 3300049573 Bacteria 10313
283 Ga0501037_0017986 3300049573 Bacteria 5203
284 Ga0501037_0130598 3300049573 Bacteria 1801
285 Ga0501038_0004526 3300049574 Bacteria 12939
286 Ga0501038_0009814 3300049574 Bacteria 8766
287 Ga0501038_0012745 3300049574 Bacteria 7680
288 Ga0501039_0010783 3300049575 Bacteria 6960
289 Ga0501039_0033221 3300049575 Bacteria 3979
290 Ga0501040_0037759 3300049576 Bacteria 3282
291 Ga0501040_0210036 3300049576 Bacteria 1384
292 Ga0501041_0048708 3300049577 Bacteria 2581
293 Ga0501041_0338772 3300049577 Bacteria 950
294 Ga0501042_0008489 3300049578 Bacteria 6784
295 Ga0501042_0014783 3300049578 Bacteria 5330
296 Ga0501042_0037700 3300049578 Bacteria 3431
297 Ga0501042_0119916 3300049578 Bacteria 1894
298 Ga0501043_0050847 3300049579 Bacteria 3257
299 Ga0501043_0096307 3300049579 Bacteria 2326
300 Ga0501043_0255970 3300049579 Bacteria 1347
301 Ga0501043_0586684 3300049579 Bacteria 825
302 Ga0501046_0001557 3300049580 Bacteria 21892
303 Ga0501046_0001888 3300049580 Bacteria 19916
304 Ga0501046_0028318 3300049580 Bacteria 4564
305 Ga0501047_0093704 3300049581 Bacteria 2882
306 Ga0501048_0003141 3300049582 Bacteria 12608
307 Ga0501048_0007729 3300049582 Bacteria 8151
308 Ga0501048_0092854 3300049582 Bacteria 2129
309 Ga0501048_0291618 3300049582 Bacteria 1160
310 Ga0501067_0010093 3300049583 Bacteria 5224
311 Ga0501067_0042543 3300049583 Bacteria 2522
312 Ga0501068_0106273 3300049584 Bacteria 1742
313 Ga0501069_0054111 3300049585 Bacteria 2236
314 Ga0501069_0081343 3300049585 Bacteria 1825
315 Ga0501069_0099857 3300049585 Bacteria 1647
316 Ga0501069_0246605 3300049585 Bacteria 1041
317 Ga0501070_0086807 3300049586 Bacteria 2590
318 Ga0501070_0351967 3300049586 Bacteria 1195
319 Ga0501072_0026612 3300049588 Bacteria 4510
320 Ga0501072_0034221 3300049588 Bacteria 3981
321 Ga0501074_0046315 3300049590 Bacteria 3144
322 Ga0501074_0054970 3300049590 Bacteria 2870
323 Ga0501074_0055308 3300049590 Bacteria 2861
324 Ga0501076_0006795 3300049592 Bacteria 8301
325 Ga0501077_0045823 3300049593 Bacteria 2778
326 Ga0501209_059291 3300049656 Bacteria 1064
327 Ga0501080_0011955 3300049742 Bacteria 7952
328 Ga0501080_0136235 3300049742 Bacteria 2272
329 Ga0501083_0088758 3300049744 Bacteria 2044
330 Ga0501271_005558 3300049768 Bacteria 1230
331 Ga0501035_0017281 3300049822 Bacteria 6650
332 Ga0501035_0108666 3300049822 Bacteria 2431
333 Ga0501035_0901256 3300049822 Bacteria 700
334 Ga0501044_0048612 3300049823 Bacteria 4380
335 Ga0501044_0643803 3300049823 Bacteria 949
336 Ga0501045_0008792 3300049824 Bacteria 7050
337 Ga0501045_0124022 3300049824 Bacteria 1918
338 nmdc:mga0yw44_108819_c1 3300050492 Bacteria 1774
339 nmdc:mga0yw44_65533_c1 3300050492 Bacteria 2239
340 nmdc:mga0yw44_76368_c1 3300050492 Bacteria 2091
341 nmdc:mga0yw44_769842_c1 3300050492 Bacteria 654
342 nmdc:mga08y16_1144867_c1 3300050511 Bacteria 751
343 nmdc:mga08y16_217606_c1 3300050511 Bacteria 1978
344 Ga0495601_0045834 3300053077 Bacteria 2751
345 Ga0495619_0514547 3300053085 Bacteria 823
346 Ga0501084_0007526 3300054114 Bacteria 8979
347 Ga0501084_0102479 3300054114 Bacteria 2404
348 Ga0501082_0139471 3300060353 Bacteria 2104
349 Ga0530510_0088299 3300061734 Bacteria 2259
350 Ga0530510_0328528 3300061734 Bacteria 1147

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030744 Ga0316181_1270130 Ga0316181_12701303 166
2 3300031903 Ga0307407_10356416 Ga0307407_103564161 166
3 3300031691 Ga0316579_10117623 Ga0316579_101176231 168
4 3300031727 Ga0316576_10013670 Ga0316576_100136705 168
5 3300031728 Ga0316578_10002423 Ga0316578_1000242310 168
6 3300035398 Ga0316574_0000472 Ga0316574_0000472_15539_16165 168
7 3300036712 Ga0316584_0031778 Ga0316584_0031778_2322_2948 168
8 3300033541 Ga0316596_1030704 Ga0316596_10307042 174
9 3300044683 Ga0466965_0177945 Ga0466965_0177945_173_730 185
10 3300044842 Ga0466957_0337229 Ga0466957_0337229_31_597 185
11 3300045976 Ga0466967_0149858 Ga0466967_0149858_23_589 185
12 3300048917 Ga0496114_0450601 Ga0496114_0450601_392_955 185
13 3300049578 Ga0501042_0014783 Ga0501042_0014783_1925_2491 185
14 3300042016 Ga0439463_149178 Ga0439463_149178_18_578 186
15 3300042136 Ga0450900_013575 Ga0450900_013575_448_1014 186
16 3300009553 Ga0105249_10002076 Ga0105249_100020765 187
17 3300049577 Ga0501041_0338772 Ga0501041_0338772_187_756 187
18 3300026121 Ga0207683_10132899 Ga0207683_101328994 188
19 iso_pu_bacteria 2643221561 2643823801 189
20 iso_pu_bacteria 2643221696 2644533076 189
21 3300049571 Ga0501034_0121857 Ga0501034_0121857_1693_2265 190
22 3300049588 Ga0501072_0026612 Ga0501072_0026612_855_1427 190
23 iso_pu_bacteria 2643221615 2644092399 191
24 iso_pu_bacteria 2643221657 2644323341 191
25 3300009553 Ga0105249_11537318 Ga0105249_115373181 192
26 3300013308 Ga0157375_11026492 Ga0157375_110264922 193
27 3300037312 Ga0395899_0001441 Ga0395899_0001441_18038_18619 193
28 3300037418 Ga0395900_0008632 Ga0395900_0008632_3192_3773 193
29 3300037471 Ga0395905_0324677 Ga0395905_0324677_475_1056 193
30 3300038443 Ga0395901_1137124 Ga0395901_1137124_23_604 193
31 3300048914 Ga0496111_0229244 Ga0496111_0229244_271_852 193
32 3300050492 nmdc:mga0yw44_769842_c1 nmdc:mga0yw44_769842_c1_13_594 193
33 3300005329 Ga0070683_100569212 Ga0070683_1005692121 194
34 3300005330 Ga0070690_100317737 Ga0070690_1003177371 194
35 3300005338 Ga0068868_100349622 Ga0068868_1003496222 194
36 3300005455 Ga0070663_100614621 Ga0070663_1006146212 194
37 3300005564 Ga0070664_100505669 Ga0070664_1005056691 194
38 3300009176 Ga0105242_10241685 Ga0105242_102416852 194
39 3300009551 Ga0105238_10141549 Ga0105238_101415494 194
40 3300013306 Ga0163162_10379482 Ga0163162_103794822 194
41 3300014325 Ga0163163_10175818 Ga0163163_101758183 194
42 3300025934 Ga0207686_10144068 Ga0207686_101440682 194
43 3300025945 Ga0207679_10241955 Ga0207679_102419553 194
44 3300026023 Ga0207677_10537294 Ga0207677_105372942 194
45 3300026067 Ga0207678_10715936 Ga0207678_107159361 194
46 3300048905 Ga0496102_0170768 Ga0496102_0170768_209_838 194
47 3300048907 Ga0496104_0216636 Ga0496104_0216636_707_1336 194
48 3300048908 Ga0496105_0316592 Ga0496105_0316592_301_930 194
49 3300048911 Ga0496108_0133838 Ga0496108_0133838_1151_1780 194
50 3300048912 Ga0496109_0029073 Ga0496109_0029073_3779_4408 194
51 3300048913 Ga0496110_0110628 Ga0496110_0110628_1279_1908 194
52 3300048914 Ga0496111_0035659 Ga0496111_0035659_160_789 194
53 3300048915 Ga0496112_0486320 Ga0496112_0486320_393_1022 194
54 3300048917 Ga0496114_0007108 Ga0496114_0007108_1143_1772 194
55 3300009147 Ga0114129_10106836 Ga0114129_101068364 195
56 3300009176 Ga0105242_10478904 Ga0105242_104789041 195
57 3300037418 Ga0395900_0047211 Ga0395900_0047211_2889_3488 195
58 3300038443 Ga0395901_0001859 Ga0395901_0001859_19428_20027 195
59 3300041498 Ga0451841_0010491 Ga0451841_0010491_693_1286 195
60 3300044658 Ga0466972_0318417 Ga0466972_0318417_110_697 195
61 3300044842 Ga0466957_0117090 Ga0466957_0117090_1083_1670 195
62 3300049571 Ga0501034_0281381 Ga0501034_0281381_233_820 195
63 3300049823 Ga0501044_0643803 Ga0501044_0643803_336_923 195
64 3300050492 nmdc:mga0yw44_108819_c1 nmdc:mga0yw44_108819_c1_1074_1661 195
65 3300009094 Ga0111539_10789209 Ga0111539_107892092 196
66 3300009098 Ga0105245_10469564 Ga0105245_104695641 196
67 3300009098 Ga0105245_11433159 Ga0105245_114331591 196
68 3300009101 Ga0105247_10237131 Ga0105247_102371312 196
69 3300009551 Ga0105238_10953697 Ga0105238_109536971 196
70 3300010375 Ga0105239_10406142 Ga0105239_104061422 196
71 3300013307 Ga0157372_10128746 Ga0157372_101287462 196
72 3300014326 Ga0157380_10494826 Ga0157380_104948261 196
73 3300014745 Ga0157377_10215675 Ga0157377_102156751 196
74 3300025901 Ga0207688_10223864 Ga0207688_102238642 196
75 3300031824 Ga0307413_10018518 Ga0307413_100185183 196
76 3300031903 Ga0307407_10010966 Ga0307407_100109662 196
77 3300031911 Ga0307412_10213475 Ga0307412_102134751 196
78 3300031995 Ga0307409_100008760 Ga0307409_1000087605 196
79 3300032002 Ga0307416_100025327 Ga0307416_1000253273 196
80 3300032004 Ga0307414_10412440 Ga0307414_104124402 196
81 3300032126 Ga0307415_100016620 Ga0307415_1000166205 196
82 3300038443 Ga0395901_0164454 Ga0395901_0164454_990_1592 196
83 3300044765 Ga0466970_0302575 Ga0466970_0302575_255_845 196
84 3300044842 Ga0466957_0024546 Ga0466957_0024546_418_1008 196
85 3300044901 Ga0466960_0026584 Ga0466960_0026584_1126_1716 196
86 3300045976 Ga0466967_0264787 Ga0466967_0264787_575_1165 196
87 3300046539 Ga0495621_0251042 Ga0495621_0251042_30_620 196
88 3300048904 Ga0496101_0100033 Ga0496101_0100033_666_1256 196
89 3300048905 Ga0496102_0125045 Ga0496102_0125045_274_864 196
90 3300048906 Ga0496103_0055264 Ga0496103_0055264_1256_1846 196
91 3300048907 Ga0496104_0081848 Ga0496104_0081848_76_666 196
92 3300048907 Ga0496104_0407784 Ga0496104_0407784_190_780 196
93 3300048908 Ga0496105_0198311 Ga0496105_0198311_923_1513 196
94 3300048908 Ga0496105_0359543 Ga0496105_0359543_458_1048 196
95 3300048909 Ga0496106_0020875 Ga0496106_0020875_1898_2488 196
96 3300048910 Ga0496107_0035013 Ga0496107_0035013_2389_2979 196
97 3300048911 Ga0496108_0380233 Ga0496108_0380233_507_1097 196
98 3300048912 Ga0496109_0487831 Ga0496109_0487831_414_1004 196
99 3300048912 Ga0496109_0666454 Ga0496109_0666454_129_719 196
100 3300048913 Ga0496110_0178634 Ga0496110_0178634_620_1210 196
101 3300048913 Ga0496110_0367617 Ga0496110_0367617_217_807 196
102 3300048914 Ga0496111_0186836 Ga0496111_0186836_843_1433 196
103 3300048916 Ga0496113_0094525 Ga0496113_0094525_361_951 196
104 3300048917 Ga0496114_0048912 Ga0496114_0048912_174_764 196
105 3300048917 Ga0496114_0681498 Ga0496114_0681498_142_732 196
106 3300048918 Ga0496115_0220797 Ga0496115_0220797_648_1238 196
107 3300049521 Ga0501298_038140 Ga0501298_038140_20_610 196
108 3300049522 Ga0501299_017332 Ga0501299_017332_496_1086 196
109 3300049572 Ga0501036_0059725 Ga0501036_0059725_2596_3198 196
110 3300049576 Ga0501040_0210036 Ga0501040_0210036_650_1252 196
111 3300049578 Ga0501042_0119916 Ga0501042_0119916_398_1000 196
112 3300049579 Ga0501043_0586684 Ga0501043_0586684_152_754 196
113 3300049582 Ga0501048_0291618 Ga0501048_0291618_44_646 196
114 3300049583 Ga0501067_0010093 Ga0501067_0010093_2726_3316 196
115 3300049584 Ga0501068_0106273 Ga0501068_0106273_926_1516 196
116 3300049585 Ga0501069_0099857 Ga0501069_0099857_128_718 196
117 3300049585 Ga0501069_0246605 Ga0501069_0246605_182_772 196
118 3300049590 Ga0501074_0055308 Ga0501074_0055308_651_1253 196
119 3300049656 Ga0501209_059291 Ga0501209_059291_133_723 196
120 3300049768 Ga0501271_005558 Ga0501271_005558_284_874 196
121 3300049822 Ga0501035_0901256 Ga0501035_0901256_75_665 196
122 3300049824 Ga0501045_0124022 Ga0501045_0124022_29_631 196
123 3300050511 nmdc:mga08y16_1144867_c1 nmdc:mga08y16_1144867_c1_33_623 196
124 3300054114 Ga0501084_0102479 Ga0501084_0102479_34_636 196
125 3300041452 Ga0451793_0599232 Ga0451793_0599232_1544_2176 197
126 3300041491 Ga0451833_0867190 Ga0451833_0867190_228_860 197
127 3300041494 Ga0451837_0348643 Ga0451837_0348643_1395_2027 197
128 3300041496 Ga0451839_0663409 Ga0451839_0663409_1035_1667 197
129 3300041498 Ga0451841_1019386 Ga0451841_1019386_708_1340 197
130 3300037068 Ga0373925_0001252 Ga0373925_0001252_20565_21161 198
131 3300033179 Ga0307507_10000020 Ga0307507_10000020187 201
132 3300010375 Ga0105239_10512189 Ga0105239_105121892 202
133 3300031665 Ga0316575_10000402 Ga0316575_1000040213 202
134 3300031691 Ga0316579_10004938 Ga0316579_100049384 202
135 3300031728 Ga0316578_10009335 Ga0316578_100093354 202
136 3300035398 Ga0316574_0019204 Ga0316574_0019204_2028_2645 202
137 3300036647 Ga0316582_0005888 Ga0316582_0005888_4127_4744 202
138 3300036712 Ga0316584_0000855 Ga0316584_0000855_4338_4955 202
139 3300020082 Ga0206353_10112771 Ga0206353_101127711 203
140 3300031691 Ga0316579_10008693 Ga0316579_100086932 203
141 3300031727 Ga0316576_10041888 Ga0316576_100418881 203
142 3300031727 Ga0316576_10123583 Ga0316576_101235834 203
143 3300031728 Ga0316578_10005181 Ga0316578_100051811 203
144 3300031733 Ga0316577_10043992 Ga0316577_100439924 203
145 3300032133 Ga0316583_10008427 Ga0316583_100084272 203
146 3300032133 Ga0316583_10049846 Ga0316583_100498461 203
147 3300032137 Ga0316585_10010572 Ga0316585_100105722 203
148 3300032139 Ga0316580_10002795 Ga0316580_100027952 203
149 3300035398 Ga0316574_0002491 Ga0316574_0002491_6160_6780 203
150 3300035398 Ga0316574_0021558 Ga0316574_0021558_140_760 203
151 3300036647 Ga0316582_0012104 Ga0316582_0012104_436_1056 203
152 3300036712 Ga0316584_0010405 Ga0316584_0010405_3689_4309 203
153 3300039437 Ga0436365_0926935 Ga0436365_0926935_44_670 203
154 iso_pu_bacteria 2784132109 2784471608 203
155 iso_pu_bacteria 2867369537 2867373665 203
156 3300049568 Ga0501031_0288777 Ga0501031_0288777_388_1002 204
157 3300049571 Ga0501034_0381289 Ga0501034_0381289_513_1127 204
158 3300049572 Ga0501036_0150376 Ga0501036_0150376_618_1232 204
159 3300049573 Ga0501037_0130598 Ga0501037_0130598_404_1018 204
160 3300049574 Ga0501038_0012745 Ga0501038_0012745_6809_7423 204
161 3300049575 Ga0501039_0033221 Ga0501039_0033221_1168_1782 204
162 3300049576 Ga0501040_0037759 Ga0501040_0037759_935_1549 204
163 3300049577 Ga0501041_0048708 Ga0501041_0048708_891_1505 204
164 3300049578 Ga0501042_0008489 Ga0501042_0008489_5683_6297 204
165 3300049582 Ga0501048_0007729 Ga0501048_0007729_6741_7355 204
166 3300049586 Ga0501070_0086807 Ga0501070_0086807_1339_1953 204
167 3300049588 Ga0501072_0034221 Ga0501072_0034221_2955_3569 204
168 3300049590 Ga0501074_0046315 Ga0501074_0046315_2002_2616 204
169 3300049592 Ga0501076_0006795 Ga0501076_0006795_6797_7411 204
170 3300049593 Ga0501077_0045823 Ga0501077_0045823_416_1030 204
171 3300049742 Ga0501080_0136235 Ga0501080_0136235_962_1576 204
172 3300049744 Ga0501083_0088758 Ga0501083_0088758_1301_1915 204
173 3300049824 Ga0501045_0008792 Ga0501045_0008792_2321_2935 204
174 3300054114 Ga0501084_0007526 Ga0501084_0007526_2602_3216 204
175 3300060353 Ga0501082_0139471 Ga0501082_0139471_307_921 204
176 3300061734 Ga0530510_0088299 Ga0530510_0088299_849_1463 204
177 3300025910 Ga0207684_10365908 Ga0207684_103659082 205
178 3300044901 Ga0466960_0085346 Ga0466960_0085346_843_1472 206
179 3300048917 Ga0496114_0027212 Ga0496114_0027212_1713_2351 206
180 3300061734 Ga0530510_0328528 Ga0530510_0328528_251_871 206
181 iso_pu_bacteria 2773857762 2774396599 206
182 iso_pu_bacteria 2808606439 2809198263 206
183 iso_pu_bacteria 2811994878 2812353066 206
184 iso_pu_bacteria 2891968417 2891969307 206
185 iso_pu_bacteria 8025478263 8025481073 206
186 3300013105 Ga0157369_10382821 Ga0157369_103828212 207
187 3300013306 Ga0163162_10781011 Ga0163162_107810112 207
188 3300038443 Ga0395901_0560939 Ga0395901_0560939_483_1106 207
189 3300046559 Ga0495667_0234222 Ga0495667_0234222_429_1100 207
190 3300047444 Ga0495675_0149214 Ga0495675_0149214_513_1184 207
191 3300048903 Ga0496100_0087196 Ga0496100_0087196_781_1452 207
192 3300048905 Ga0496102_0442057 Ga0496102_0442057_397_1068 207
193 3300048909 Ga0496106_0032866 Ga0496106_0032866_1175_1846 207
194 3300048918 Ga0496115_0166481 Ga0496115_0166481_302_973 207
195 3300049572 Ga0501036_0107254 Ga0501036_0107254_1491_2114 207
196 3300020082 Ga0206353_11176613 Ga0206353_111766134 208
197 3300025927 Ga0207687_10640183 Ga0207687_106401831 208
198 3300005329 Ga0070683_100121117 Ga0070683_1001211172 209
199 3300005337 Ga0070682_100363778 Ga0070682_1003637781 209
200 3300005338 Ga0068868_100088102 Ga0068868_1000881021 209
201 3300005535 Ga0070684_100721714 Ga0070684_1007217142 209
202 3300006038 Ga0075365_10514933 Ga0075365_105149332 209
203 3300006173 Ga0070716_100111220 Ga0070716_1001112201 209
204 3300025939 Ga0207665_10599483 Ga0207665_105994831 209
205 3300026023 Ga0207677_10229522 Ga0207677_102295222 209
206 3300044842 Ga0466957_0064731 Ga0466957_0064731_1431_2060 209
207 3300045836 Ga0466958_0076386 Ga0466958_0076386_953_1582 209
208 3300046477 Ga0495664_0060721 Ga0495664_0060721_261_890 209
209 3300046663 Ga0495635_0251476 Ga0495635_0251476_165_794 209
210 3300053077 Ga0495601_0045834 Ga0495601_0045834_1136_1765 209
211 3300025922 Ga0207646_10216518 Ga0207646_102165182 210
212 3300031903 Ga0307407_10353724 Ga0307407_103537242 210
213 3300005331 Ga0070670_100624729 Ga0070670_1006247291 211
214 3300005337 Ga0070682_100022521 Ga0070682_1000225215 211
215 3300005367 Ga0070667_100971250 Ga0070667_1009712501 211
216 3300005455 Ga0070663_100099277 Ga0070663_1000992772 211
217 3300005456 Ga0070678_100138766 Ga0070678_1001387663 211
218 3300005457 Ga0070662_100180398 Ga0070662_1001803983 211
219 3300005471 Ga0070698_100007036 Ga0070698_1000070364 211
220 3300006881 Ga0068865_100583250 Ga0068865_1005832502 211
221 3300014745 Ga0157377_10089155 Ga0157377_100891552 211
222 3300020082 Ga0206353_10839062 Ga0206353_108390621 211
223 3300025893 Ga0207682_10277133 Ga0207682_102771331 211
224 3300025926 Ga0207659_10530390 Ga0207659_105303901 211
225 3300025937 Ga0207669_10098482 Ga0207669_100984822 211
226 3300025944 Ga0207661_10132422 Ga0207661_101324222 211
227 3300026067 Ga0207678_10154741 Ga0207678_101547412 211
228 3300026121 Ga0207683_10024174 Ga0207683_100241744 211
229 3300044765 Ga0466970_0004975 Ga0466970_0004975_4040_4690 211
230 3300046455 Ga0495603_0133408 Ga0495603_0133408_104_769 211
231 3300046475 Ga0495639_0142267 Ga0495639_0142267_155_826 211
232 3300046511 Ga0495608_0192057 Ga0495608_0192057_362_1033 211
233 3300046663 Ga0495635_0043696 Ga0495635_0043696_1214_1885 211
234 3300047322 Ga0495680_0182849 Ga0495680_0182849_828_1499 211
235 3300048907 Ga0496104_0295652 Ga0496104_0295652_51_722 211
236 3300049586 Ga0501070_0351967 Ga0501070_0351967_529_1164 211
237 3300053085 Ga0495619_0514547 Ga0495619_0514547_73_744 211
238 3300020082 Ga0206353_10134077 Ga0206353_101340773 212
239 3300032005 Ga0307411_10354876 Ga0307411_103548762 212
240 3300045976 Ga0466967_0235837 Ga0466967_0235837_809_1447 212
241 3300049568 Ga0501031_0101803 Ga0501031_0101803_607_1245 212
242 3300049570 Ga0501033_0000762 Ga0501033_0000762_12981_13619 212
243 3300049571 Ga0501034_0036804 Ga0501034_0036804_3343_3981 212
244 3300049571 Ga0501034_0078437 Ga0501034_0078437_1505_2143 212
245 3300049571 Ga0501034_0295225 Ga0501034_0295225_510_1148 212
246 3300049571 Ga0501034_0524087 Ga0501034_0524087_335_985 212
247 3300049572 Ga0501036_0023382 Ga0501036_0023382_2781_3419 212
248 3300049572 Ga0501036_0025494 Ga0501036_0025494_973_1611 212
249 3300049573 Ga0501037_0004314 Ga0501037_0004314_1191_1829 212
250 3300049573 Ga0501037_0017986 Ga0501037_0017986_3145_3783 212
251 3300049574 Ga0501038_0004526 Ga0501038_0004526_3189_3827 212
252 3300049574 Ga0501038_0009814 Ga0501038_0009814_5140_5778 212
253 3300049575 Ga0501039_0010783 Ga0501039_0010783_4061_4699 212
254 3300049578 Ga0501042_0037700 Ga0501042_0037700_232_870 212
255 3300049579 Ga0501043_0050847 Ga0501043_0050847_1114_1752 212
256 3300049579 Ga0501043_0096307 Ga0501043_0096307_427_1065 212
257 3300049579 Ga0501043_0255970 Ga0501043_0255970_428_1066 212
258 3300049580 Ga0501046_0001557 Ga0501046_0001557_1468_2106 212
259 3300049580 Ga0501046_0001888 Ga0501046_0001888_14082_14720 212
260 3300049580 Ga0501046_0028318 Ga0501046_0028318_2409_3047 212
261 3300049581 Ga0501047_0093704 Ga0501047_0093704_1974_2612 212
262 3300049582 Ga0501048_0003141 Ga0501048_0003141_9958_10596 212
263 3300049582 Ga0501048_0092854 Ga0501048_0092854_803_1441 212
264 3300049585 Ga0501069_0081343 Ga0501069_0081343_498_1136 212
265 3300049590 Ga0501074_0054970 Ga0501074_0054970_1031_1669 212
266 3300049742 Ga0501080_0011955 Ga0501080_0011955_1425_2063 212
267 3300049822 Ga0501035_0017281 Ga0501035_0017281_2691_3329 212
268 3300049822 Ga0501035_0108666 Ga0501035_0108666_1531_2169 212
269 3300049823 Ga0501044_0048612 Ga0501044_0048612_1520_2158 212
270 3300005466 Ga0070685_10282512 Ga0070685_102825122 213
271 3300013307 Ga0157372_11535245 Ga0157372_115352451 213
272 3300050492 nmdc:mga0yw44_76368_c1 nmdc:mga0yw44_76368_c1_919_1584 215
273 3300005327 Ga0070658_10194385 Ga0070658_101943852 217
274 3300005616 Ga0068852_100054261 Ga0068852_1000542613 217
275 3300005719 Ga0068861_100574541 Ga0068861_1005745412 217
276 3300009098 Ga0105245_10631231 Ga0105245_106312312 217
277 3300011119 Ga0105246_10590523 Ga0105246_105905231 217
278 3300025909 Ga0207705_10311771 Ga0207705_103117712 217
279 3300025940 Ga0207691_10353813 Ga0207691_103538133 217
280 3300026142 Ga0207698_10088157 Ga0207698_100881571 217
281 3300048911 Ga0496108_0157459 Ga0496108_0157459_238_909 217
282 3300048917 Ga0496114_0514627 Ga0496114_0514627_73_744 217
283 3300009148 Ga0105243_10097632 Ga0105243_100976323 219
284 3300009176 Ga0105242_10932003 Ga0105242_109320031 219
285 3300009177 Ga0105248_10972678 Ga0105248_109726781 219
286 3300011119 Ga0105246_10058265 Ga0105246_100582655 219
287 3300014326 Ga0157380_10349885 Ga0157380_103498852 219
288 3300046461 Ga0495641_0077320 Ga0495641_0077320_328_1023 219
289 3300046690 Ga0495624_0287751 Ga0495624_0287751_276_971 219
290 3300048905 Ga0496102_0234349 Ga0496102_0234349_643_1338 219
291 3300048908 Ga0496105_0114360 Ga0496105_0114360_1224_1919 219
292 3300048912 Ga0496109_0155970 Ga0496109_0155970_629_1324 219
293 3300048913 Ga0496110_0448973 Ga0496110_0448973_79_774 219
294 3300048915 Ga0496112_0591628 Ga0496112_0591628_16_711 219
295 3300048916 Ga0496113_0109654 Ga0496113_0109654_1065_1760 219
296 3300048917 Ga0496114_0042355 Ga0496114_0042355_537_1232 219
297 3300005329 Ga0070683_100236393 Ga0070683_1002363932 221
298 3300006038 Ga0075365_10282749 Ga0075365_102827491 221
299 3300009094 Ga0111539_10121164 Ga0111539_101211642 221
300 3300049583 Ga0501067_0042543 Ga0501067_0042543_419_1084 221
301 3300049585 Ga0501069_0054111 Ga0501069_0054111_1425_2090 221
302 3300050492 nmdc:mga0yw44_65533_c1 nmdc:mga0yw44_65533_c1_581_1246 221
303 3300050511 nmdc:mga08y16_217606_c1 nmdc:mga08y16_217606_c1_340_1005 221
304 3300002075 JGI24738J21930_10003829 JGI24738J21930_100038292 222
305 3300005329 Ga0070683_100034545 Ga0070683_1000345455 222
306 3300005331 Ga0070670_100327116 Ga0070670_1003271162 222
307 3300005337 Ga0070682_100055009 Ga0070682_1000550094 222
308 3300005338 Ga0068868_100209675 Ga0068868_1002096752 222
309 3300005339 Ga0070660_100167749 Ga0070660_1001677493 222
310 3300005340 Ga0070689_100140653 Ga0070689_1001406532 222
311 3300005341 Ga0070691_10053624 Ga0070691_100536242 222
312 3300005345 Ga0070692_10010777 Ga0070692_100107775 222
313 3300005354 Ga0070675_100063505 Ga0070675_1000635052 222
314 3300005356 Ga0070674_100109361 Ga0070674_1001093614 222
315 3300005364 Ga0070673_100049531 Ga0070673_1000495312 222
316 3300005366 Ga0070659_100569835 Ga0070659_1005698352 222
317 3300005459 Ga0068867_100005197 Ga0068867_1000051975 222
318 3300005535 Ga0070684_100042445 Ga0070684_1000424452 222
319 3300005543 Ga0070672_100007939 Ga0070672_1000079392 222
320 3300005544 Ga0070686_100040392 Ga0070686_1000403922 222
321 3300005615 Ga0070702_100001326 Ga0070702_1000013262 222
322 3300005616 Ga0068852_100014642 Ga0068852_1000146425 222
323 3300005718 Ga0068866_10114143 Ga0068866_101141432 222
324 3300005719 Ga0068861_100046229 Ga0068861_1000462292 222
325 3300005840 Ga0068870_10003690 Ga0068870_100036905 222
326 3300005844 Ga0068862_100215416 Ga0068862_1002154163 222
327 3300006881 Ga0068865_100319867 Ga0068865_1003198673 222
328 3300009098 Ga0105245_10157041 Ga0105245_101570412 222
329 3300009148 Ga0105243_10001391 Ga0105243_1000139121 222
330 3300009177 Ga0105248_10025357 Ga0105248_100253575 222
331 3300009553 Ga0105249_10251044 Ga0105249_102510442 222
332 3300013104 Ga0157370_10450056 Ga0157370_104500561 222
333 3300013296 Ga0157374_10290029 Ga0157374_102900292 222
334 3300014325 Ga0163163_10086482 Ga0163163_100864825 222
335 3300014326 Ga0157380_10270036 Ga0157380_102700364 222
336 3300014745 Ga0157377_10002878 Ga0157377_100028783 222
337 3300017792 Ga0163161_10177862 Ga0163161_101778622 222
338 3300025901 Ga0207688_10003906 Ga0207688_100039067 222
339 3300025908 Ga0207643_10002935 Ga0207643_100029358 222
340 3300025919 Ga0207657_10209218 Ga0207657_102092183 222
341 3300025923 Ga0207681_10227581 Ga0207681_102275812 222
342 3300025925 Ga0207650_10245265 Ga0207650_102452652 222
343 3300025927 Ga0207687_10067354 Ga0207687_100673544 222
344 3300025932 Ga0207690_10241973 Ga0207690_102419732 222
345 3300025933 Ga0207706_10421678 Ga0207706_104216782 222
346 3300025934 Ga0207686_10328208 Ga0207686_103282082 222
347 3300025936 Ga0207670_10276521 Ga0207670_102765213 222
348 3300025937 Ga0207669_10254668 Ga0207669_102546682 222
349 3300025938 Ga0207704_10312277 Ga0207704_103122772 222
350 3300025940 Ga0207691_10004297 Ga0207691_1000429718 222
351 3300025941 Ga0207711_10110575 Ga0207711_101105754 222
352 3300025960 Ga0207651_10034874 Ga0207651_100348742 222
353 3300025961 Ga0207712_10209700 Ga0207712_102097003 222
354 3300026075 Ga0207708_10004360 Ga0207708_100043602 222
355 3300026089 Ga0207648_10000657 Ga0207648_100006578 222
356 3300026118 Ga0207675_100004832 Ga0207675_1000048328 222
357 3300026142 Ga0207698_10017359 Ga0207698_100173595 222
358 3300048909 Ga0496106_0196288 Ga0496106_0196288_809_1477 222
359 3300048911 Ga0496108_0027715 Ga0496108_0027715_2983_3651 222
360 3300048912 Ga0496109_0056934 Ga0496109_0056934_64_732 222
361 3300048917 Ga0496114_0118965 Ga0496114_0118965_1330_1998 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

31

77

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6o6o-assembly1.cif.gz_B structure of the regulator fasr from mycobacterium tuberculosis 0.9218 29 216
6o6o-assembly1.cif.gz_B structure of the regulator fasr from mycobacterium tuberculosis 0.9074 29 216
6o6n-assembly1.cif.gz_A structure of the regulator fasr from mycobacterium tuberculosis in complex with c20-coa 0.8838 22 216
6o6n-assembly1.cif.gz_A structure of the regulator fasr from mycobacterium tuberculosis in complex with c20-coa 0.8626 22 216
3f1b-assembly1.cif.gz_A-2 the crystal structure of a tetr-like transcriptional regulator from rhodococcus sp. rha1. 0.8453 22 214
ID Description Score Start End Superfamily
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 1.006 31 77 1.10.10.60
1pb6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 1.002 26 77 1.10.10.60
4xk4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.996 27 77 1.10.10.60
4xk4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9958 27 77 1.10.10.60
4xk4D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9955 27 77 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2E8LC52-F1-model_v4 TetR family transcriptional regulator 0.9409 22 155 GO:0000976
GO:0003700
AF-D3Q9K5-F1-model_v4 Transcriptional regulator, TetR family 0.9215 19 212 GO:0000976
GO:0003700
AF-A0A6J7T888-F1-model_v4 Unannotated protein 0.9042 24 219 GO:0000976
GO:0003700
AF-A0A1I1DPN5-F1-model_v4 Transcriptional regulator, TetR family 0.9025 23 221 GO:0000976
GO:0003700
AF-A0A1I1DPN5-F1-model_v4 Transcriptional regulator, TetR family 0.898 23 221 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
86.2 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map