F422198
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 361 | 206 | 350 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10097632|Ga0105243_100976323 |
| Length | 231 |
| Sequence | MTNVEGEPMTTTANVPARGQRLPKSARRAQLLEAAQATFVEYGYHSAAMDEIADRAGVSKPVLYQHFPGKLDLYLALIDHHRGLLEQAVRDALASTTDNKQRVIACIDAYFEFVSRQGAPFRLIFESDLTNEPAVAERVEGVALTCGEALAEVIAGDTDLSDADAHLLGMALTGMAQVSARYWLSRGDWGPGEAGEVPREEAARIVGQLAWRGIGGFPKSEQVEQAALSRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 2 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 3 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 4 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 5 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 6 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 7 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 8 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 9 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 10 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 100 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 101 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 102 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 103 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 104 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 105 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 106 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 107 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 108 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 109 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 110 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 111 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 112 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 113 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 114 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 115 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 116 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 117 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 119 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 120 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 121 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 123 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 124 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 125 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 126 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 127 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 128 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 129 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 130 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 131 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 132 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 133 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 134 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 135 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 136 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 137 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 138 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 139 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 140 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 141 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 155 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 156 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 157 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 158 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 159 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 160 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 163 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 164 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 165 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 166 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 167 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 168 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 169 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 170 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 193 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 196 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 200 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 206 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.57 |
| Metatranscriptomes | 1.39 |
| Isolates | 3.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.66 |
| Nodule | 0 |
| Rhizoplane | 13.85 |
| Rhizosphere | 79.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10003829 | 3300002075 | Bacteria | 3759 |
| 2 | Ga0070658_10194385 | 3300005327 | Bacteria | 1711 |
| 3 | Ga0070683_100034545 | 3300005329 | Bacteria | 4620 |
| 4 | Ga0070683_100121117 | 3300005329 | Bacteria | 2472 |
| 5 | Ga0070683_100236393 | 3300005329 | Bacteria | 1737 |
| 6 | Ga0070683_100569212 | 3300005329 | Bacteria | 1084 |
| 7 | Ga0070690_100317737 | 3300005330 | Bacteria | 1121 |
| 8 | Ga0070670_100327116 | 3300005331 | Bacteria | 1344 |
| 9 | Ga0070670_100624729 | 3300005331 | Bacteria | 965 |
| 10 | Ga0070682_100022521 | 3300005337 | Bacteria | 3733 |
| 11 | Ga0070682_100055009 | 3300005337 | Bacteria | 2498 |
| 12 | Ga0070682_100363778 | 3300005337 | Bacteria | 1082 |
| 13 | Ga0068868_100088102 | 3300005338 | Bacteria | 2498 |
| 14 | Ga0068868_100209675 | 3300005338 | Bacteria | 1628 |
| 15 | Ga0068868_100349622 | 3300005338 | Bacteria | 1266 |
| 16 | Ga0070660_100167749 | 3300005339 | Bacteria | 1772 |
| 17 | Ga0070689_100140653 | 3300005340 | Bacteria | 1941 |
| 18 | Ga0070691_10053624 | 3300005341 | Bacteria | 1929 |
| 19 | Ga0070692_10010777 | 3300005345 | Bacteria | 4176 |
| 20 | Ga0070675_100063505 | 3300005354 | Bacteria | 3053 |
| 21 | Ga0070674_100109361 | 3300005356 | Bacteria | 2027 |
| 22 | Ga0070673_100049531 | 3300005364 | Bacteria | 3280 |
| 23 | Ga0070659_100569835 | 3300005366 | Bacteria | 971 |
| 24 | Ga0070667_100971250 | 3300005367 | Bacteria | 792 |
| 25 | Ga0070663_100099277 | 3300005455 | Bacteria | 2170 |
| 26 | Ga0070663_100614621 | 3300005455 | Bacteria | 915 |
| 27 | Ga0070678_100138766 | 3300005456 | Bacteria | 1942 |
| 28 | Ga0070662_100180398 | 3300005457 | Bacteria | 1664 |
| 29 | Ga0068867_100005197 | 3300005459 | Bacteria | 9186 |
| 30 | Ga0070685_10282512 | 3300005466 | Bacteria | 1112 |
| 31 | Ga0070698_100007036 | 3300005471 | Bacteria | 12186 |
| 32 | Ga0070684_100042445 | 3300005535 | Bacteria | 3926 |
| 33 | Ga0070684_100721714 | 3300005535 | Bacteria | 930 |
| 34 | Ga0070672_100007939 | 3300005543 | Bacteria | 7249 |
| 35 | Ga0070686_100040392 | 3300005544 | Bacteria | 2911 |
| 36 | Ga0070664_100505669 | 3300005564 | Bacteria | 1114 |
| 37 | Ga0070702_100001326 | 3300005615 | Bacteria | 10037 |
| 38 | Ga0068852_100014642 | 3300005616 | Bacteria | 6047 |
| 39 | Ga0068852_100054261 | 3300005616 | Bacteria | 3454 |
| 40 | Ga0068866_10114143 | 3300005718 | Bacteria | 1512 |
| 41 | Ga0068861_100046229 | 3300005719 | Bacteria | 3281 |
| 42 | Ga0068861_100574541 | 3300005719 | Bacteria | 1031 |
| 43 | Ga0068870_10003690 | 3300005840 | Bacteria | 6508 |
| 44 | Ga0068862_100215416 | 3300005844 | Bacteria | 1737 |
| 45 | Ga0075365_10282749 | 3300006038 | Bacteria | 1167 |
| 46 | Ga0075365_10514933 | 3300006038 | Bacteria | 846 |
| 47 | Ga0070716_100111220 | 3300006173 | Bacteria | 1698 |
| 48 | Ga0068865_100319867 | 3300006881 | Bacteria | 1248 |
| 49 | Ga0068865_100583250 | 3300006881 | Bacteria | 943 |
| 50 | Ga0111539_10121164 | 3300009094 | Bacteria | 3065 |
| 51 | Ga0111539_10789209 | 3300009094 | Bacteria | 1105 |
| 52 | Ga0105245_10157041 | 3300009098 | Bacteria | 2155 |
| 53 | Ga0105245_10469564 | 3300009098 | Bacteria | 1270 |
| 54 | Ga0105245_10631231 | 3300009098 | Bacteria | 1100 |
| 55 | Ga0105245_11433159 | 3300009098 | Bacteria | 741 |
| 56 | Ga0105247_10237131 | 3300009101 | Bacteria | 1241 |
| 57 | Ga0114129_10106836 | 3300009147 | Bacteria | 3866 |
| 58 | Ga0105243_10001391 | 3300009148 | Bacteria | 21405 |
| 59 | Ga0105243_10097632 | 3300009148 | Bacteria | 2432 |
| 60 | Ga0105242_10241685 | 3300009176 | Bacteria | 1623 |
| 61 | Ga0105242_10478904 | 3300009176 | Bacteria | 1179 |
| 62 | Ga0105242_10932003 | 3300009176 | Bacteria | 871 |
| 63 | Ga0105248_10025357 | 3300009177 | Bacteria | 6591 |
| 64 | Ga0105248_10972678 | 3300009177 | Bacteria | 959 |
| 65 | Ga0105238_10141549 | 3300009551 | Bacteria | 2382 |
| 66 | Ga0105238_10953697 | 3300009551 | Bacteria | 878 |
| 67 | Ga0105249_10002076 | 3300009553 | Bacteria | 17368 |
| 68 | Ga0105249_10251044 | 3300009553 | Bacteria | 1754 |
| 69 | Ga0105249_11537318 | 3300009553 | Bacteria | 738 |
| 70 | Ga0105239_10406142 | 3300010375 | Bacteria | 1542 |
| 71 | Ga0105239_10512189 | 3300010375 | Bacteria | 1365 |
| 72 | Ga0105246_10058265 | 3300011119 | Bacteria | 2675 |
| 73 | Ga0105246_10590523 | 3300011119 | Bacteria | 958 |
| 74 | Ga0157370_10450056 | 3300013104 | Bacteria | 1184 |
| 75 | Ga0157369_10382821 | 3300013105 | Bacteria | 1460 |
| 76 | Ga0157374_10290029 | 3300013296 | Bacteria | 1617 |
| 77 | Ga0163162_10379482 | 3300013306 | Bacteria | 1547 |
| 78 | Ga0163162_10781011 | 3300013306 | Bacteria | 1073 |
| 79 | Ga0157372_10128746 | 3300013307 | Bacteria | 2911 |
| 80 | Ga0157372_11535245 | 3300013307 | Bacteria | 767 |
| 81 | Ga0157375_11026492 | 3300013308 | Bacteria | 963 |
| 82 | Ga0163163_10086482 | 3300014325 | Bacteria | 3144 |
| 83 | Ga0163163_10175818 | 3300014325 | Bacteria | 2187 |
| 84 | Ga0157380_10270036 | 3300014326 | Bacteria | 1550 |
| 85 | Ga0157380_10349885 | 3300014326 | Bacteria | 1382 |
| 86 | Ga0157380_10494826 | 3300014326 | Bacteria | 1186 |
| 87 | Ga0157377_10002878 | 3300014745 | Bacteria | 7691 |
| 88 | Ga0157377_10089155 | 3300014745 | Bacteria | 1818 |
| 89 | Ga0157377_10215675 | 3300014745 | Bacteria | 1226 |
| 90 | Ga0163161_10177862 | 3300017792 | Bacteria | 1630 |
| 91 | Ga0206353_10112771 | 3300020082 | Bacteria | 1115 |
| 92 | Ga0206353_10134077 | 3300020082 | Bacteria | 9223 |
| 93 | Ga0206353_10839062 | 3300020082 | Bacteria | 809 |
| 94 | Ga0206353_11176613 | 3300020082 | Bacteria | 3065 |
| 95 | Ga0207682_10277133 | 3300025893 | Bacteria | 784 |
| 96 | Ga0207688_10003906 | 3300025901 | Bacteria | 8129 |
| 97 | Ga0207688_10223864 | 3300025901 | Bacteria | 1134 |
| 98 | Ga0207643_10002935 | 3300025908 | Bacteria | 9206 |
| 99 | Ga0207705_10311771 | 3300025909 | Bacteria | 1208 |
| 100 | Ga0207684_10365908 | 3300025910 | Bacteria | 1241 |
| 101 | Ga0207657_10209218 | 3300025919 | Bacteria | 1566 |
| 102 | Ga0207646_10216518 | 3300025922 | Bacteria | 1730 |
| 103 | Ga0207681_10227581 | 3300025923 | Bacteria | 1446 |
| 104 | Ga0207650_10245265 | 3300025925 | Bacteria | 1449 |
| 105 | Ga0207659_10530390 | 3300025926 | Bacteria | 999 |
| 106 | Ga0207687_10067354 | 3300025927 | Bacteria | 2547 |
| 107 | Ga0207687_10640183 | 3300025927 | Bacteria | 899 |
| 108 | Ga0207690_10241973 | 3300025932 | Bacteria | 1390 |
| 109 | Ga0207706_10421678 | 3300025933 | Bacteria | 1156 |
| 110 | Ga0207686_10144068 | 3300025934 | Bacteria | 1650 |
| 111 | Ga0207686_10328208 | 3300025934 | Bacteria | 1146 |
| 112 | Ga0207670_10276521 | 3300025936 | Bacteria | 1307 |
| 113 | Ga0207669_10098482 | 3300025937 | Bacteria | 1926 |
| 114 | Ga0207669_10254668 | 3300025937 | Bacteria | 1309 |
| 115 | Ga0207704_10312277 | 3300025938 | Bacteria | 1209 |
| 116 | Ga0207665_10599483 | 3300025939 | Bacteria | 860 |
| 117 | Ga0207691_10004297 | 3300025940 | Bacteria | 13840 |
| 118 | Ga0207691_10353813 | 3300025940 | Bacteria | 1256 |
| 119 | Ga0207711_10110575 | 3300025941 | Bacteria | 2443 |
| 120 | Ga0207661_10132422 | 3300025944 | Bacteria | 2138 |
| 121 | Ga0207679_10241955 | 3300025945 | Bacteria | 1529 |
| 122 | Ga0207651_10034874 | 3300025960 | Bacteria | 3264 |
| 123 | Ga0207712_10209700 | 3300025961 | Bacteria | 1551 |
| 124 | Ga0207677_10229522 | 3300026023 | Bacteria | 1494 |
| 125 | Ga0207677_10537294 | 3300026023 | Bacteria | 1017 |
| 126 | Ga0207678_10154741 | 3300026067 | Bacteria | 1957 |
| 127 | Ga0207678_10715936 | 3300026067 | Bacteria | 881 |
| 128 | Ga0207708_10004360 | 3300026075 | Bacteria | 10429 |
| 129 | Ga0207648_10000657 | 3300026089 | Bacteria | 38679 |
| 130 | Ga0207675_100004832 | 3300026118 | Bacteria | 12978 |
| 131 | Ga0207683_10024174 | 3300026121 | Bacteria | 5229 |
| 132 | Ga0207683_10132899 | 3300026121 | Bacteria | 2238 |
| 133 | Ga0207698_10017359 | 3300026142 | Bacteria | 4879 |
| 134 | Ga0207698_10088157 | 3300026142 | Bacteria | 2530 |
| 135 | Ga0316181_1270130 | 3300030744 | Bacteria | 3461 |
| 136 | Ga0316575_10000402 | 3300031665 | Bacteria | 12338 |
| 137 | Ga0316579_10004938 | 3300031691 | Bacteria | 5342 |
| 138 | Ga0316579_10008693 | 3300031691 | Bacteria | 4243 |
| 139 | Ga0316579_10117623 | 3300031691 | Bacteria | 1276 |
| 140 | Ga0316576_10013670 | 3300031727 | Bacteria | 5405 |
| 141 | Ga0316576_10041888 | 3300031727 | Bacteria | 3298 |
| 142 | Ga0316576_10123583 | 3300031727 | Bacteria | 1944 |
| 143 | Ga0316578_10002423 | 3300031728 | Bacteria | 8174 |
| 144 | Ga0316578_10005181 | 3300031728 | Bacteria | 6284 |
| 145 | Ga0316578_10009335 | 3300031728 | Bacteria | 5042 |
| 146 | Ga0316577_10043992 | 3300031733 | Bacteria | 2497 |
| 147 | Ga0307413_10018518 | 3300031824 | Bacteria | 3657 |
| 148 | Ga0307407_10010966 | 3300031903 | Bacteria | 4294 |
| 149 | Ga0307407_10353724 | 3300031903 | Bacteria | 1041 |
| 150 | Ga0307407_10356416 | 3300031903 | Bacteria | 1037 |
| 151 | Ga0307412_10213475 | 3300031911 | Bacteria | 1474 |
| 152 | Ga0307409_100008760 | 3300031995 | Bacteria | 6167 |
| 153 | Ga0307416_100025327 | 3300032002 | Bacteria | 4347 |
| 154 | Ga0307414_10412440 | 3300032004 | Bacteria | 1176 |
| 155 | Ga0307411_10354876 | 3300032005 | Bacteria | 1197 |
| 156 | Ga0307415_100016620 | 3300032126 | Bacteria | 4391 |
| 157 | Ga0316583_10008427 | 3300032133 | Bacteria | 3719 |
| 158 | Ga0316583_10049846 | 3300032133 | Bacteria | 1474 |
| 159 | Ga0316585_10010572 | 3300032137 | Bacteria | 2710 |
| 160 | Ga0316580_10002795 | 3300032139 | Bacteria | 4864 |
| 161 | Ga0307507_10000020 | 3300033179 | Bacteria | 220880 |
| 162 | Ga0316596_1030704 | 3300033541 | Bacteria | 1394 |
| 163 | Ga0316574_0000472 | 3300035398 | Bacteria | 16265 |
| 164 | Ga0316574_0002491 | 3300035398 | Bacteria | 9252 |
| 165 | Ga0316574_0019204 | 3300035398 | Bacteria | 4029 |
| 166 | Ga0316574_0021558 | 3300035398 | Bacteria | 3827 |
| 167 | Ga0316582_0005888 | 3300036647 | Bacteria | 6374 |
| 168 | Ga0316582_0012104 | 3300036647 | Bacteria | 4802 |
| 169 | Ga0316584_0000855 | 3300036712 | Bacteria | 17288 |
| 170 | Ga0316584_0010405 | 3300036712 | Bacteria | 6498 |
| 171 | Ga0316584_0031778 | 3300036712 | Bacteria | 3903 |
| 172 | Ga0373925_0001252 | 3300037068 | Bacteria | 22412 |
| 173 | Ga0395899_0001441 | 3300037312 | Bacteria | 20309 |
| 174 | Ga0395900_0008632 | 3300037418 | Bacteria | 10471 |
| 175 | Ga0395900_0047211 | 3300037418 | Bacteria | 4434 |
| 176 | Ga0395905_0324677 | 3300037471 | Bacteria | 1429 |
| 177 | Ga0395901_0001859 | 3300038443 | Bacteria | 21826 |
| 178 | Ga0395901_0164454 | 3300038443 | Bacteria | 2330 |
| 179 | Ga0395901_0560939 | 3300038443 | Bacteria | 1156 |
| 180 | Ga0395901_1137124 | 3300038443 | Bacteria | 749 |
| 181 | Ga0436365_0926935 | 3300039437 | Bacteria | 1459 |
| 182 | Ga0451793_0599232 | 3300041452 | Bacteria | 2656 |
| 183 | Ga0451833_0867190 | 3300041491 | Bacteria | 2364 |
| 184 | Ga0451837_0348643 | 3300041494 | Bacteria | 2463 |
| 185 | Ga0451839_0663409 | 3300041496 | Bacteria | 1981 |
| 186 | Ga0451841_0010491 | 3300041498 | Bacteria | 1347 |
| 187 | Ga0451841_1019386 | 3300041498 | Bacteria | 1706 |
| 188 | Ga0439463_149178 | 3300042016 | Bacteria | 606 |
| 189 | Ga0450900_013575 | 3300042136 | Bacteria | 1078 |
| 190 | Ga0466972_0318417 | 3300044658 | Bacteria | 727 |
| 191 | Ga0466965_0177945 | 3300044683 | Bacteria | 1121 |
| 192 | Ga0466970_0004975 | 3300044765 | Bacteria | 6567 |
| 193 | Ga0466970_0302575 | 3300044765 | Bacteria | 902 |
| 194 | Ga0466957_0024546 | 3300044842 | Bacteria | 3568 |
| 195 | Ga0466957_0064731 | 3300044842 | Bacteria | 2250 |
| 196 | Ga0466957_0117090 | 3300044842 | Bacteria | 1696 |
| 197 | Ga0466957_0337229 | 3300044842 | Bacteria | 1020 |
| 198 | Ga0466960_0026584 | 3300044901 | Bacteria | 2631 |
| 199 | Ga0466960_0085346 | 3300044901 | Bacteria | 1599 |
| 200 | Ga0466958_0076386 | 3300045836 | Bacteria | 2056 |
| 201 | Ga0466967_0149858 | 3300045976 | Bacteria | 2179 |
| 202 | Ga0466967_0235837 | 3300045976 | Bacteria | 1743 |
| 203 | Ga0466967_0264787 | 3300045976 | Bacteria | 1645 |
| 204 | Ga0495603_0133408 | 3300046455 | Bacteria | 1446 |
| 205 | Ga0495641_0077320 | 3300046461 | Bacteria | 1492 |
| 206 | Ga0495639_0142267 | 3300046475 | Bacteria | 1154 |
| 207 | Ga0495664_0060721 | 3300046477 | Bacteria | 2251 |
| 208 | Ga0495608_0192057 | 3300046511 | Bacteria | 1289 |
| 209 | Ga0495621_0251042 | 3300046539 | Bacteria | 723 |
| 210 | Ga0495667_0234222 | 3300046559 | Bacteria | 1170 |
| 211 | Ga0495635_0043696 | 3300046663 | Bacteria | 3092 |
| 212 | Ga0495635_0251476 | 3300046663 | Bacteria | 1191 |
| 213 | Ga0495624_0287751 | 3300046690 | Bacteria | 992 |
| 214 | Ga0495680_0182849 | 3300047322 | Bacteria | 1512 |
| 215 | Ga0495675_0149214 | 3300047444 | Bacteria | 1445 |
| 216 | Ga0496100_0087196 | 3300048903 | Bacteria | 2122 |
| 217 | Ga0496101_0100033 | 3300048904 | Bacteria | 2169 |
| 218 | Ga0496102_0125045 | 3300048905 | Bacteria | 2403 |
| 219 | Ga0496102_0170768 | 3300048905 | Bacteria | 2047 |
| 220 | Ga0496102_0234349 | 3300048905 | Bacteria | 1731 |
| 221 | Ga0496102_0442057 | 3300048905 | Bacteria | 1220 |
| 222 | Ga0496103_0055264 | 3300048906 | Bacteria | 2462 |
| 223 | Ga0496104_0081848 | 3300048907 | Bacteria | 3079 |
| 224 | Ga0496104_0216636 | 3300048907 | Bacteria | 1826 |
| 225 | Ga0496104_0295652 | 3300048907 | Bacteria | 1532 |
| 226 | Ga0496104_0407784 | 3300048907 | Bacteria | 1271 |
| 227 | Ga0496105_0114360 | 3300048908 | Bacteria | 2226 |
| 228 | Ga0496105_0198311 | 3300048908 | Bacteria | 1639 |
| 229 | Ga0496105_0316592 | 3300048908 | Bacteria | 1251 |
| 230 | Ga0496105_0359543 | 3300048908 | Bacteria | 1162 |
| 231 | Ga0496106_0020875 | 3300048909 | Bacteria | 4860 |
| 232 | Ga0496106_0032866 | 3300048909 | Bacteria | 3869 |
| 233 | Ga0496106_0196288 | 3300048909 | Bacteria | 1606 |
| 234 | Ga0496107_0035013 | 3300048910 | Bacteria | 3599 |
| 235 | Ga0496108_0027715 | 3300048911 | Bacteria | 4682 |
| 236 | Ga0496108_0133838 | 3300048911 | Bacteria | 2131 |
| 237 | Ga0496108_0157459 | 3300048911 | Bacteria | 1962 |
| 238 | Ga0496108_0380233 | 3300048911 | Bacteria | 1233 |
| 239 | Ga0496109_0029073 | 3300048912 | Bacteria | 4947 |
| 240 | Ga0496109_0056934 | 3300048912 | Bacteria | 3567 |
| 241 | Ga0496109_0155970 | 3300048912 | Bacteria | 2138 |
| 242 | Ga0496109_0487831 | 3300048912 | Bacteria | 1163 |
| 243 | Ga0496109_0666454 | 3300048912 | Bacteria | 977 |
| 244 | Ga0496110_0110628 | 3300048913 | Bacteria | 2468 |
| 245 | Ga0496110_0178634 | 3300048913 | Bacteria | 1927 |
| 246 | Ga0496110_0367617 | 3300048913 | Bacteria | 1310 |
| 247 | Ga0496110_0448973 | 3300048913 | Bacteria | 1175 |
| 248 | Ga0496111_0035659 | 3300048914 | Bacteria | 3556 |
| 249 | Ga0496111_0186836 | 3300048914 | Bacteria | 1540 |
| 250 | Ga0496111_0229244 | 3300048914 | Bacteria | 1380 |
| 251 | Ga0496112_0486320 | 3300048915 | Bacteria | 1170 |
| 252 | Ga0496112_0591628 | 3300048915 | Bacteria | 1042 |
| 253 | Ga0496113_0094525 | 3300048916 | Bacteria | 2309 |
| 254 | Ga0496113_0109654 | 3300048916 | Bacteria | 2147 |
| 255 | Ga0496114_0007108 | 3300048917 | Bacteria | 8832 |
| 256 | Ga0496114_0027212 | 3300048917 | Bacteria | 4682 |
| 257 | Ga0496114_0042355 | 3300048917 | Bacteria | 3774 |
| 258 | Ga0496114_0048912 | 3300048917 | Bacteria | 3518 |
| 259 | Ga0496114_0118965 | 3300048917 | Bacteria | 2270 |
| 260 | Ga0496114_0450601 | 3300048917 | Bacteria | 1140 |
| 261 | Ga0496114_0514627 | 3300048917 | Bacteria | 1058 |
| 262 | Ga0496114_0681498 | 3300048917 | Bacteria | 902 |
| 263 | Ga0496115_0166481 | 3300048918 | Bacteria | 1823 |
| 264 | Ga0496115_0220797 | 3300048918 | Bacteria | 1564 |
| 265 | Ga0501298_038140 | 3300049521 | Bacteria | 967 |
| 266 | Ga0501299_017332 | 3300049522 | Bacteria | 1284 |
| 267 | Ga0501031_0101803 | 3300049568 | Bacteria | 1874 |
| 268 | Ga0501031_0288777 | 3300049568 | Bacteria | 1063 |
| 269 | Ga0501033_0000762 | 3300049570 | Bacteria | 29642 |
| 270 | Ga0501034_0036804 | 3300049571 | Bacteria | 4956 |
| 271 | Ga0501034_0078437 | 3300049571 | Bacteria | 3307 |
| 272 | Ga0501034_0121857 | 3300049571 | Bacteria | 2594 |
| 273 | Ga0501034_0281381 | 3300049571 | Bacteria | 1603 |
| 274 | Ga0501034_0295225 | 3300049571 | Bacteria | 1558 |
| 275 | Ga0501034_0381289 | 3300049571 | Bacteria | 1335 |
| 276 | Ga0501034_0524087 | 3300049571 | Bacteria | 1097 |
| 277 | Ga0501036_0023382 | 3300049572 | Bacteria | 5206 |
| 278 | Ga0501036_0025494 | 3300049572 | Bacteria | 4988 |
| 279 | Ga0501036_0059725 | 3300049572 | Bacteria | 3231 |
| 280 | Ga0501036_0107254 | 3300049572 | Bacteria | 2362 |
| 281 | Ga0501036_0150376 | 3300049572 | Bacteria | 1964 |
| 282 | Ga0501037_0004314 | 3300049573 | Bacteria | 10313 |
| 283 | Ga0501037_0017986 | 3300049573 | Bacteria | 5203 |
| 284 | Ga0501037_0130598 | 3300049573 | Bacteria | 1801 |
| 285 | Ga0501038_0004526 | 3300049574 | Bacteria | 12939 |
| 286 | Ga0501038_0009814 | 3300049574 | Bacteria | 8766 |
| 287 | Ga0501038_0012745 | 3300049574 | Bacteria | 7680 |
| 288 | Ga0501039_0010783 | 3300049575 | Bacteria | 6960 |
| 289 | Ga0501039_0033221 | 3300049575 | Bacteria | 3979 |
| 290 | Ga0501040_0037759 | 3300049576 | Bacteria | 3282 |
| 291 | Ga0501040_0210036 | 3300049576 | Bacteria | 1384 |
| 292 | Ga0501041_0048708 | 3300049577 | Bacteria | 2581 |
| 293 | Ga0501041_0338772 | 3300049577 | Bacteria | 950 |
| 294 | Ga0501042_0008489 | 3300049578 | Bacteria | 6784 |
| 295 | Ga0501042_0014783 | 3300049578 | Bacteria | 5330 |
| 296 | Ga0501042_0037700 | 3300049578 | Bacteria | 3431 |
| 297 | Ga0501042_0119916 | 3300049578 | Bacteria | 1894 |
| 298 | Ga0501043_0050847 | 3300049579 | Bacteria | 3257 |
| 299 | Ga0501043_0096307 | 3300049579 | Bacteria | 2326 |
| 300 | Ga0501043_0255970 | 3300049579 | Bacteria | 1347 |
| 301 | Ga0501043_0586684 | 3300049579 | Bacteria | 825 |
| 302 | Ga0501046_0001557 | 3300049580 | Bacteria | 21892 |
| 303 | Ga0501046_0001888 | 3300049580 | Bacteria | 19916 |
| 304 | Ga0501046_0028318 | 3300049580 | Bacteria | 4564 |
| 305 | Ga0501047_0093704 | 3300049581 | Bacteria | 2882 |
| 306 | Ga0501048_0003141 | 3300049582 | Bacteria | 12608 |
| 307 | Ga0501048_0007729 | 3300049582 | Bacteria | 8151 |
| 308 | Ga0501048_0092854 | 3300049582 | Bacteria | 2129 |
| 309 | Ga0501048_0291618 | 3300049582 | Bacteria | 1160 |
| 310 | Ga0501067_0010093 | 3300049583 | Bacteria | 5224 |
| 311 | Ga0501067_0042543 | 3300049583 | Bacteria | 2522 |
| 312 | Ga0501068_0106273 | 3300049584 | Bacteria | 1742 |
| 313 | Ga0501069_0054111 | 3300049585 | Bacteria | 2236 |
| 314 | Ga0501069_0081343 | 3300049585 | Bacteria | 1825 |
| 315 | Ga0501069_0099857 | 3300049585 | Bacteria | 1647 |
| 316 | Ga0501069_0246605 | 3300049585 | Bacteria | 1041 |
| 317 | Ga0501070_0086807 | 3300049586 | Bacteria | 2590 |
| 318 | Ga0501070_0351967 | 3300049586 | Bacteria | 1195 |
| 319 | Ga0501072_0026612 | 3300049588 | Bacteria | 4510 |
| 320 | Ga0501072_0034221 | 3300049588 | Bacteria | 3981 |
| 321 | Ga0501074_0046315 | 3300049590 | Bacteria | 3144 |
| 322 | Ga0501074_0054970 | 3300049590 | Bacteria | 2870 |
| 323 | Ga0501074_0055308 | 3300049590 | Bacteria | 2861 |
| 324 | Ga0501076_0006795 | 3300049592 | Bacteria | 8301 |
| 325 | Ga0501077_0045823 | 3300049593 | Bacteria | 2778 |
| 326 | Ga0501209_059291 | 3300049656 | Bacteria | 1064 |
| 327 | Ga0501080_0011955 | 3300049742 | Bacteria | 7952 |
| 328 | Ga0501080_0136235 | 3300049742 | Bacteria | 2272 |
| 329 | Ga0501083_0088758 | 3300049744 | Bacteria | 2044 |
| 330 | Ga0501271_005558 | 3300049768 | Bacteria | 1230 |
| 331 | Ga0501035_0017281 | 3300049822 | Bacteria | 6650 |
| 332 | Ga0501035_0108666 | 3300049822 | Bacteria | 2431 |
| 333 | Ga0501035_0901256 | 3300049822 | Bacteria | 700 |
| 334 | Ga0501044_0048612 | 3300049823 | Bacteria | 4380 |
| 335 | Ga0501044_0643803 | 3300049823 | Bacteria | 949 |
| 336 | Ga0501045_0008792 | 3300049824 | Bacteria | 7050 |
| 337 | Ga0501045_0124022 | 3300049824 | Bacteria | 1918 |
| 338 | nmdc:mga0yw44_108819_c1 | 3300050492 | Bacteria | 1774 |
| 339 | nmdc:mga0yw44_65533_c1 | 3300050492 | Bacteria | 2239 |
| 340 | nmdc:mga0yw44_76368_c1 | 3300050492 | Bacteria | 2091 |
| 341 | nmdc:mga0yw44_769842_c1 | 3300050492 | Bacteria | 654 |
| 342 | nmdc:mga08y16_1144867_c1 | 3300050511 | Bacteria | 751 |
| 343 | nmdc:mga08y16_217606_c1 | 3300050511 | Bacteria | 1978 |
| 344 | Ga0495601_0045834 | 3300053077 | Bacteria | 2751 |
| 345 | Ga0495619_0514547 | 3300053085 | Bacteria | 823 |
| 346 | Ga0501084_0007526 | 3300054114 | Bacteria | 8979 |
| 347 | Ga0501084_0102479 | 3300054114 | Bacteria | 2404 |
| 348 | Ga0501082_0139471 | 3300060353 | Bacteria | 2104 |
| 349 | Ga0530510_0088299 | 3300061734 | Bacteria | 2259 |
| 350 | Ga0530510_0328528 | 3300061734 | Bacteria | 1147 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300030744 | Ga0316181_1270130 | Ga0316181_12701303 | 166 |
| 2 | 3300031903 | Ga0307407_10356416 | Ga0307407_103564161 | 166 |
| 3 | 3300031691 | Ga0316579_10117623 | Ga0316579_101176231 | 168 |
| 4 | 3300031727 | Ga0316576_10013670 | Ga0316576_100136705 | 168 |
| 5 | 3300031728 | Ga0316578_10002423 | Ga0316578_1000242310 | 168 |
| 6 | 3300035398 | Ga0316574_0000472 | Ga0316574_0000472_15539_16165 | 168 |
| 7 | 3300036712 | Ga0316584_0031778 | Ga0316584_0031778_2322_2948 | 168 |
| 8 | 3300033541 | Ga0316596_1030704 | Ga0316596_10307042 | 174 |
| 9 | 3300044683 | Ga0466965_0177945 | Ga0466965_0177945_173_730 | 185 |
| 10 | 3300044842 | Ga0466957_0337229 | Ga0466957_0337229_31_597 | 185 |
| 11 | 3300045976 | Ga0466967_0149858 | Ga0466967_0149858_23_589 | 185 |
| 12 | 3300048917 | Ga0496114_0450601 | Ga0496114_0450601_392_955 | 185 |
| 13 | 3300049578 | Ga0501042_0014783 | Ga0501042_0014783_1925_2491 | 185 |
| 14 | 3300042016 | Ga0439463_149178 | Ga0439463_149178_18_578 | 186 |
| 15 | 3300042136 | Ga0450900_013575 | Ga0450900_013575_448_1014 | 186 |
| 16 | 3300009553 | Ga0105249_10002076 | Ga0105249_100020765 | 187 |
| 17 | 3300049577 | Ga0501041_0338772 | Ga0501041_0338772_187_756 | 187 |
| 18 | 3300026121 | Ga0207683_10132899 | Ga0207683_101328994 | 188 |
| 19 | iso_pu_bacteria | 2643221561 | 2643823801 | 189 |
| 20 | iso_pu_bacteria | 2643221696 | 2644533076 | 189 |
| 21 | 3300049571 | Ga0501034_0121857 | Ga0501034_0121857_1693_2265 | 190 |
| 22 | 3300049588 | Ga0501072_0026612 | Ga0501072_0026612_855_1427 | 190 |
| 23 | iso_pu_bacteria | 2643221615 | 2644092399 | 191 |
| 24 | iso_pu_bacteria | 2643221657 | 2644323341 | 191 |
| 25 | 3300009553 | Ga0105249_11537318 | Ga0105249_115373181 | 192 |
| 26 | 3300013308 | Ga0157375_11026492 | Ga0157375_110264922 | 193 |
| 27 | 3300037312 | Ga0395899_0001441 | Ga0395899_0001441_18038_18619 | 193 |
| 28 | 3300037418 | Ga0395900_0008632 | Ga0395900_0008632_3192_3773 | 193 |
| 29 | 3300037471 | Ga0395905_0324677 | Ga0395905_0324677_475_1056 | 193 |
| 30 | 3300038443 | Ga0395901_1137124 | Ga0395901_1137124_23_604 | 193 |
| 31 | 3300048914 | Ga0496111_0229244 | Ga0496111_0229244_271_852 | 193 |
| 32 | 3300050492 | nmdc:mga0yw44_769842_c1 | nmdc:mga0yw44_769842_c1_13_594 | 193 |
| 33 | 3300005329 | Ga0070683_100569212 | Ga0070683_1005692121 | 194 |
| 34 | 3300005330 | Ga0070690_100317737 | Ga0070690_1003177371 | 194 |
| 35 | 3300005338 | Ga0068868_100349622 | Ga0068868_1003496222 | 194 |
| 36 | 3300005455 | Ga0070663_100614621 | Ga0070663_1006146212 | 194 |
| 37 | 3300005564 | Ga0070664_100505669 | Ga0070664_1005056691 | 194 |
| 38 | 3300009176 | Ga0105242_10241685 | Ga0105242_102416852 | 194 |
| 39 | 3300009551 | Ga0105238_10141549 | Ga0105238_101415494 | 194 |
| 40 | 3300013306 | Ga0163162_10379482 | Ga0163162_103794822 | 194 |
| 41 | 3300014325 | Ga0163163_10175818 | Ga0163163_101758183 | 194 |
| 42 | 3300025934 | Ga0207686_10144068 | Ga0207686_101440682 | 194 |
| 43 | 3300025945 | Ga0207679_10241955 | Ga0207679_102419553 | 194 |
| 44 | 3300026023 | Ga0207677_10537294 | Ga0207677_105372942 | 194 |
| 45 | 3300026067 | Ga0207678_10715936 | Ga0207678_107159361 | 194 |
| 46 | 3300048905 | Ga0496102_0170768 | Ga0496102_0170768_209_838 | 194 |
| 47 | 3300048907 | Ga0496104_0216636 | Ga0496104_0216636_707_1336 | 194 |
| 48 | 3300048908 | Ga0496105_0316592 | Ga0496105_0316592_301_930 | 194 |
| 49 | 3300048911 | Ga0496108_0133838 | Ga0496108_0133838_1151_1780 | 194 |
| 50 | 3300048912 | Ga0496109_0029073 | Ga0496109_0029073_3779_4408 | 194 |
| 51 | 3300048913 | Ga0496110_0110628 | Ga0496110_0110628_1279_1908 | 194 |
| 52 | 3300048914 | Ga0496111_0035659 | Ga0496111_0035659_160_789 | 194 |
| 53 | 3300048915 | Ga0496112_0486320 | Ga0496112_0486320_393_1022 | 194 |
| 54 | 3300048917 | Ga0496114_0007108 | Ga0496114_0007108_1143_1772 | 194 |
| 55 | 3300009147 | Ga0114129_10106836 | Ga0114129_101068364 | 195 |
| 56 | 3300009176 | Ga0105242_10478904 | Ga0105242_104789041 | 195 |
| 57 | 3300037418 | Ga0395900_0047211 | Ga0395900_0047211_2889_3488 | 195 |
| 58 | 3300038443 | Ga0395901_0001859 | Ga0395901_0001859_19428_20027 | 195 |
| 59 | 3300041498 | Ga0451841_0010491 | Ga0451841_0010491_693_1286 | 195 |
| 60 | 3300044658 | Ga0466972_0318417 | Ga0466972_0318417_110_697 | 195 |
| 61 | 3300044842 | Ga0466957_0117090 | Ga0466957_0117090_1083_1670 | 195 |
| 62 | 3300049571 | Ga0501034_0281381 | Ga0501034_0281381_233_820 | 195 |
| 63 | 3300049823 | Ga0501044_0643803 | Ga0501044_0643803_336_923 | 195 |
| 64 | 3300050492 | nmdc:mga0yw44_108819_c1 | nmdc:mga0yw44_108819_c1_1074_1661 | 195 |
| 65 | 3300009094 | Ga0111539_10789209 | Ga0111539_107892092 | 196 |
| 66 | 3300009098 | Ga0105245_10469564 | Ga0105245_104695641 | 196 |
| 67 | 3300009098 | Ga0105245_11433159 | Ga0105245_114331591 | 196 |
| 68 | 3300009101 | Ga0105247_10237131 | Ga0105247_102371312 | 196 |
| 69 | 3300009551 | Ga0105238_10953697 | Ga0105238_109536971 | 196 |
| 70 | 3300010375 | Ga0105239_10406142 | Ga0105239_104061422 | 196 |
| 71 | 3300013307 | Ga0157372_10128746 | Ga0157372_101287462 | 196 |
| 72 | 3300014326 | Ga0157380_10494826 | Ga0157380_104948261 | 196 |
| 73 | 3300014745 | Ga0157377_10215675 | Ga0157377_102156751 | 196 |
| 74 | 3300025901 | Ga0207688_10223864 | Ga0207688_102238642 | 196 |
| 75 | 3300031824 | Ga0307413_10018518 | Ga0307413_100185183 | 196 |
| 76 | 3300031903 | Ga0307407_10010966 | Ga0307407_100109662 | 196 |
| 77 | 3300031911 | Ga0307412_10213475 | Ga0307412_102134751 | 196 |
| 78 | 3300031995 | Ga0307409_100008760 | Ga0307409_1000087605 | 196 |
| 79 | 3300032002 | Ga0307416_100025327 | Ga0307416_1000253273 | 196 |
| 80 | 3300032004 | Ga0307414_10412440 | Ga0307414_104124402 | 196 |
| 81 | 3300032126 | Ga0307415_100016620 | Ga0307415_1000166205 | 196 |
| 82 | 3300038443 | Ga0395901_0164454 | Ga0395901_0164454_990_1592 | 196 |
| 83 | 3300044765 | Ga0466970_0302575 | Ga0466970_0302575_255_845 | 196 |
| 84 | 3300044842 | Ga0466957_0024546 | Ga0466957_0024546_418_1008 | 196 |
| 85 | 3300044901 | Ga0466960_0026584 | Ga0466960_0026584_1126_1716 | 196 |
| 86 | 3300045976 | Ga0466967_0264787 | Ga0466967_0264787_575_1165 | 196 |
| 87 | 3300046539 | Ga0495621_0251042 | Ga0495621_0251042_30_620 | 196 |
| 88 | 3300048904 | Ga0496101_0100033 | Ga0496101_0100033_666_1256 | 196 |
| 89 | 3300048905 | Ga0496102_0125045 | Ga0496102_0125045_274_864 | 196 |
| 90 | 3300048906 | Ga0496103_0055264 | Ga0496103_0055264_1256_1846 | 196 |
| 91 | 3300048907 | Ga0496104_0081848 | Ga0496104_0081848_76_666 | 196 |
| 92 | 3300048907 | Ga0496104_0407784 | Ga0496104_0407784_190_780 | 196 |
| 93 | 3300048908 | Ga0496105_0198311 | Ga0496105_0198311_923_1513 | 196 |
| 94 | 3300048908 | Ga0496105_0359543 | Ga0496105_0359543_458_1048 | 196 |
| 95 | 3300048909 | Ga0496106_0020875 | Ga0496106_0020875_1898_2488 | 196 |
| 96 | 3300048910 | Ga0496107_0035013 | Ga0496107_0035013_2389_2979 | 196 |
| 97 | 3300048911 | Ga0496108_0380233 | Ga0496108_0380233_507_1097 | 196 |
| 98 | 3300048912 | Ga0496109_0487831 | Ga0496109_0487831_414_1004 | 196 |
| 99 | 3300048912 | Ga0496109_0666454 | Ga0496109_0666454_129_719 | 196 |
| 100 | 3300048913 | Ga0496110_0178634 | Ga0496110_0178634_620_1210 | 196 |
| 101 | 3300048913 | Ga0496110_0367617 | Ga0496110_0367617_217_807 | 196 |
| 102 | 3300048914 | Ga0496111_0186836 | Ga0496111_0186836_843_1433 | 196 |
| 103 | 3300048916 | Ga0496113_0094525 | Ga0496113_0094525_361_951 | 196 |
| 104 | 3300048917 | Ga0496114_0048912 | Ga0496114_0048912_174_764 | 196 |
| 105 | 3300048917 | Ga0496114_0681498 | Ga0496114_0681498_142_732 | 196 |
| 106 | 3300048918 | Ga0496115_0220797 | Ga0496115_0220797_648_1238 | 196 |
| 107 | 3300049521 | Ga0501298_038140 | Ga0501298_038140_20_610 | 196 |
| 108 | 3300049522 | Ga0501299_017332 | Ga0501299_017332_496_1086 | 196 |
| 109 | 3300049572 | Ga0501036_0059725 | Ga0501036_0059725_2596_3198 | 196 |
| 110 | 3300049576 | Ga0501040_0210036 | Ga0501040_0210036_650_1252 | 196 |
| 111 | 3300049578 | Ga0501042_0119916 | Ga0501042_0119916_398_1000 | 196 |
| 112 | 3300049579 | Ga0501043_0586684 | Ga0501043_0586684_152_754 | 196 |
| 113 | 3300049582 | Ga0501048_0291618 | Ga0501048_0291618_44_646 | 196 |
| 114 | 3300049583 | Ga0501067_0010093 | Ga0501067_0010093_2726_3316 | 196 |
| 115 | 3300049584 | Ga0501068_0106273 | Ga0501068_0106273_926_1516 | 196 |
| 116 | 3300049585 | Ga0501069_0099857 | Ga0501069_0099857_128_718 | 196 |
| 117 | 3300049585 | Ga0501069_0246605 | Ga0501069_0246605_182_772 | 196 |
| 118 | 3300049590 | Ga0501074_0055308 | Ga0501074_0055308_651_1253 | 196 |
| 119 | 3300049656 | Ga0501209_059291 | Ga0501209_059291_133_723 | 196 |
| 120 | 3300049768 | Ga0501271_005558 | Ga0501271_005558_284_874 | 196 |
| 121 | 3300049822 | Ga0501035_0901256 | Ga0501035_0901256_75_665 | 196 |
| 122 | 3300049824 | Ga0501045_0124022 | Ga0501045_0124022_29_631 | 196 |
| 123 | 3300050511 | nmdc:mga08y16_1144867_c1 | nmdc:mga08y16_1144867_c1_33_623 | 196 |
| 124 | 3300054114 | Ga0501084_0102479 | Ga0501084_0102479_34_636 | 196 |
| 125 | 3300041452 | Ga0451793_0599232 | Ga0451793_0599232_1544_2176 | 197 |
| 126 | 3300041491 | Ga0451833_0867190 | Ga0451833_0867190_228_860 | 197 |
| 127 | 3300041494 | Ga0451837_0348643 | Ga0451837_0348643_1395_2027 | 197 |
| 128 | 3300041496 | Ga0451839_0663409 | Ga0451839_0663409_1035_1667 | 197 |
| 129 | 3300041498 | Ga0451841_1019386 | Ga0451841_1019386_708_1340 | 197 |
| 130 | 3300037068 | Ga0373925_0001252 | Ga0373925_0001252_20565_21161 | 198 |
| 131 | 3300033179 | Ga0307507_10000020 | Ga0307507_10000020187 | 201 |
| 132 | 3300010375 | Ga0105239_10512189 | Ga0105239_105121892 | 202 |
| 133 | 3300031665 | Ga0316575_10000402 | Ga0316575_1000040213 | 202 |
| 134 | 3300031691 | Ga0316579_10004938 | Ga0316579_100049384 | 202 |
| 135 | 3300031728 | Ga0316578_10009335 | Ga0316578_100093354 | 202 |
| 136 | 3300035398 | Ga0316574_0019204 | Ga0316574_0019204_2028_2645 | 202 |
| 137 | 3300036647 | Ga0316582_0005888 | Ga0316582_0005888_4127_4744 | 202 |
| 138 | 3300036712 | Ga0316584_0000855 | Ga0316584_0000855_4338_4955 | 202 |
| 139 | 3300020082 | Ga0206353_10112771 | Ga0206353_101127711 | 203 |
| 140 | 3300031691 | Ga0316579_10008693 | Ga0316579_100086932 | 203 |
| 141 | 3300031727 | Ga0316576_10041888 | Ga0316576_100418881 | 203 |
| 142 | 3300031727 | Ga0316576_10123583 | Ga0316576_101235834 | 203 |
| 143 | 3300031728 | Ga0316578_10005181 | Ga0316578_100051811 | 203 |
| 144 | 3300031733 | Ga0316577_10043992 | Ga0316577_100439924 | 203 |
| 145 | 3300032133 | Ga0316583_10008427 | Ga0316583_100084272 | 203 |
| 146 | 3300032133 | Ga0316583_10049846 | Ga0316583_100498461 | 203 |
| 147 | 3300032137 | Ga0316585_10010572 | Ga0316585_100105722 | 203 |
| 148 | 3300032139 | Ga0316580_10002795 | Ga0316580_100027952 | 203 |
| 149 | 3300035398 | Ga0316574_0002491 | Ga0316574_0002491_6160_6780 | 203 |
| 150 | 3300035398 | Ga0316574_0021558 | Ga0316574_0021558_140_760 | 203 |
| 151 | 3300036647 | Ga0316582_0012104 | Ga0316582_0012104_436_1056 | 203 |
| 152 | 3300036712 | Ga0316584_0010405 | Ga0316584_0010405_3689_4309 | 203 |
| 153 | 3300039437 | Ga0436365_0926935 | Ga0436365_0926935_44_670 | 203 |
| 154 | iso_pu_bacteria | 2784132109 | 2784471608 | 203 |
| 155 | iso_pu_bacteria | 2867369537 | 2867373665 | 203 |
| 156 | 3300049568 | Ga0501031_0288777 | Ga0501031_0288777_388_1002 | 204 |
| 157 | 3300049571 | Ga0501034_0381289 | Ga0501034_0381289_513_1127 | 204 |
| 158 | 3300049572 | Ga0501036_0150376 | Ga0501036_0150376_618_1232 | 204 |
| 159 | 3300049573 | Ga0501037_0130598 | Ga0501037_0130598_404_1018 | 204 |
| 160 | 3300049574 | Ga0501038_0012745 | Ga0501038_0012745_6809_7423 | 204 |
| 161 | 3300049575 | Ga0501039_0033221 | Ga0501039_0033221_1168_1782 | 204 |
| 162 | 3300049576 | Ga0501040_0037759 | Ga0501040_0037759_935_1549 | 204 |
| 163 | 3300049577 | Ga0501041_0048708 | Ga0501041_0048708_891_1505 | 204 |
| 164 | 3300049578 | Ga0501042_0008489 | Ga0501042_0008489_5683_6297 | 204 |
| 165 | 3300049582 | Ga0501048_0007729 | Ga0501048_0007729_6741_7355 | 204 |
| 166 | 3300049586 | Ga0501070_0086807 | Ga0501070_0086807_1339_1953 | 204 |
| 167 | 3300049588 | Ga0501072_0034221 | Ga0501072_0034221_2955_3569 | 204 |
| 168 | 3300049590 | Ga0501074_0046315 | Ga0501074_0046315_2002_2616 | 204 |
| 169 | 3300049592 | Ga0501076_0006795 | Ga0501076_0006795_6797_7411 | 204 |
| 170 | 3300049593 | Ga0501077_0045823 | Ga0501077_0045823_416_1030 | 204 |
| 171 | 3300049742 | Ga0501080_0136235 | Ga0501080_0136235_962_1576 | 204 |
| 172 | 3300049744 | Ga0501083_0088758 | Ga0501083_0088758_1301_1915 | 204 |
| 173 | 3300049824 | Ga0501045_0008792 | Ga0501045_0008792_2321_2935 | 204 |
| 174 | 3300054114 | Ga0501084_0007526 | Ga0501084_0007526_2602_3216 | 204 |
| 175 | 3300060353 | Ga0501082_0139471 | Ga0501082_0139471_307_921 | 204 |
| 176 | 3300061734 | Ga0530510_0088299 | Ga0530510_0088299_849_1463 | 204 |
| 177 | 3300025910 | Ga0207684_10365908 | Ga0207684_103659082 | 205 |
| 178 | 3300044901 | Ga0466960_0085346 | Ga0466960_0085346_843_1472 | 206 |
| 179 | 3300048917 | Ga0496114_0027212 | Ga0496114_0027212_1713_2351 | 206 |
| 180 | 3300061734 | Ga0530510_0328528 | Ga0530510_0328528_251_871 | 206 |
| 181 | iso_pu_bacteria | 2773857762 | 2774396599 | 206 |
| 182 | iso_pu_bacteria | 2808606439 | 2809198263 | 206 |
| 183 | iso_pu_bacteria | 2811994878 | 2812353066 | 206 |
| 184 | iso_pu_bacteria | 2891968417 | 2891969307 | 206 |
| 185 | iso_pu_bacteria | 8025478263 | 8025481073 | 206 |
| 186 | 3300013105 | Ga0157369_10382821 | Ga0157369_103828212 | 207 |
| 187 | 3300013306 | Ga0163162_10781011 | Ga0163162_107810112 | 207 |
| 188 | 3300038443 | Ga0395901_0560939 | Ga0395901_0560939_483_1106 | 207 |
| 189 | 3300046559 | Ga0495667_0234222 | Ga0495667_0234222_429_1100 | 207 |
| 190 | 3300047444 | Ga0495675_0149214 | Ga0495675_0149214_513_1184 | 207 |
| 191 | 3300048903 | Ga0496100_0087196 | Ga0496100_0087196_781_1452 | 207 |
| 192 | 3300048905 | Ga0496102_0442057 | Ga0496102_0442057_397_1068 | 207 |
| 193 | 3300048909 | Ga0496106_0032866 | Ga0496106_0032866_1175_1846 | 207 |
| 194 | 3300048918 | Ga0496115_0166481 | Ga0496115_0166481_302_973 | 207 |
| 195 | 3300049572 | Ga0501036_0107254 | Ga0501036_0107254_1491_2114 | 207 |
| 196 | 3300020082 | Ga0206353_11176613 | Ga0206353_111766134 | 208 |
| 197 | 3300025927 | Ga0207687_10640183 | Ga0207687_106401831 | 208 |
| 198 | 3300005329 | Ga0070683_100121117 | Ga0070683_1001211172 | 209 |
| 199 | 3300005337 | Ga0070682_100363778 | Ga0070682_1003637781 | 209 |
| 200 | 3300005338 | Ga0068868_100088102 | Ga0068868_1000881021 | 209 |
| 201 | 3300005535 | Ga0070684_100721714 | Ga0070684_1007217142 | 209 |
| 202 | 3300006038 | Ga0075365_10514933 | Ga0075365_105149332 | 209 |
| 203 | 3300006173 | Ga0070716_100111220 | Ga0070716_1001112201 | 209 |
| 204 | 3300025939 | Ga0207665_10599483 | Ga0207665_105994831 | 209 |
| 205 | 3300026023 | Ga0207677_10229522 | Ga0207677_102295222 | 209 |
| 206 | 3300044842 | Ga0466957_0064731 | Ga0466957_0064731_1431_2060 | 209 |
| 207 | 3300045836 | Ga0466958_0076386 | Ga0466958_0076386_953_1582 | 209 |
| 208 | 3300046477 | Ga0495664_0060721 | Ga0495664_0060721_261_890 | 209 |
| 209 | 3300046663 | Ga0495635_0251476 | Ga0495635_0251476_165_794 | 209 |
| 210 | 3300053077 | Ga0495601_0045834 | Ga0495601_0045834_1136_1765 | 209 |
| 211 | 3300025922 | Ga0207646_10216518 | Ga0207646_102165182 | 210 |
| 212 | 3300031903 | Ga0307407_10353724 | Ga0307407_103537242 | 210 |
| 213 | 3300005331 | Ga0070670_100624729 | Ga0070670_1006247291 | 211 |
| 214 | 3300005337 | Ga0070682_100022521 | Ga0070682_1000225215 | 211 |
| 215 | 3300005367 | Ga0070667_100971250 | Ga0070667_1009712501 | 211 |
| 216 | 3300005455 | Ga0070663_100099277 | Ga0070663_1000992772 | 211 |
| 217 | 3300005456 | Ga0070678_100138766 | Ga0070678_1001387663 | 211 |
| 218 | 3300005457 | Ga0070662_100180398 | Ga0070662_1001803983 | 211 |
| 219 | 3300005471 | Ga0070698_100007036 | Ga0070698_1000070364 | 211 |
| 220 | 3300006881 | Ga0068865_100583250 | Ga0068865_1005832502 | 211 |
| 221 | 3300014745 | Ga0157377_10089155 | Ga0157377_100891552 | 211 |
| 222 | 3300020082 | Ga0206353_10839062 | Ga0206353_108390621 | 211 |
| 223 | 3300025893 | Ga0207682_10277133 | Ga0207682_102771331 | 211 |
| 224 | 3300025926 | Ga0207659_10530390 | Ga0207659_105303901 | 211 |
| 225 | 3300025937 | Ga0207669_10098482 | Ga0207669_100984822 | 211 |
| 226 | 3300025944 | Ga0207661_10132422 | Ga0207661_101324222 | 211 |
| 227 | 3300026067 | Ga0207678_10154741 | Ga0207678_101547412 | 211 |
| 228 | 3300026121 | Ga0207683_10024174 | Ga0207683_100241744 | 211 |
| 229 | 3300044765 | Ga0466970_0004975 | Ga0466970_0004975_4040_4690 | 211 |
| 230 | 3300046455 | Ga0495603_0133408 | Ga0495603_0133408_104_769 | 211 |
| 231 | 3300046475 | Ga0495639_0142267 | Ga0495639_0142267_155_826 | 211 |
| 232 | 3300046511 | Ga0495608_0192057 | Ga0495608_0192057_362_1033 | 211 |
| 233 | 3300046663 | Ga0495635_0043696 | Ga0495635_0043696_1214_1885 | 211 |
| 234 | 3300047322 | Ga0495680_0182849 | Ga0495680_0182849_828_1499 | 211 |
| 235 | 3300048907 | Ga0496104_0295652 | Ga0496104_0295652_51_722 | 211 |
| 236 | 3300049586 | Ga0501070_0351967 | Ga0501070_0351967_529_1164 | 211 |
| 237 | 3300053085 | Ga0495619_0514547 | Ga0495619_0514547_73_744 | 211 |
| 238 | 3300020082 | Ga0206353_10134077 | Ga0206353_101340773 | 212 |
| 239 | 3300032005 | Ga0307411_10354876 | Ga0307411_103548762 | 212 |
| 240 | 3300045976 | Ga0466967_0235837 | Ga0466967_0235837_809_1447 | 212 |
| 241 | 3300049568 | Ga0501031_0101803 | Ga0501031_0101803_607_1245 | 212 |
| 242 | 3300049570 | Ga0501033_0000762 | Ga0501033_0000762_12981_13619 | 212 |
| 243 | 3300049571 | Ga0501034_0036804 | Ga0501034_0036804_3343_3981 | 212 |
| 244 | 3300049571 | Ga0501034_0078437 | Ga0501034_0078437_1505_2143 | 212 |
| 245 | 3300049571 | Ga0501034_0295225 | Ga0501034_0295225_510_1148 | 212 |
| 246 | 3300049571 | Ga0501034_0524087 | Ga0501034_0524087_335_985 | 212 |
| 247 | 3300049572 | Ga0501036_0023382 | Ga0501036_0023382_2781_3419 | 212 |
| 248 | 3300049572 | Ga0501036_0025494 | Ga0501036_0025494_973_1611 | 212 |
| 249 | 3300049573 | Ga0501037_0004314 | Ga0501037_0004314_1191_1829 | 212 |
| 250 | 3300049573 | Ga0501037_0017986 | Ga0501037_0017986_3145_3783 | 212 |
| 251 | 3300049574 | Ga0501038_0004526 | Ga0501038_0004526_3189_3827 | 212 |
| 252 | 3300049574 | Ga0501038_0009814 | Ga0501038_0009814_5140_5778 | 212 |
| 253 | 3300049575 | Ga0501039_0010783 | Ga0501039_0010783_4061_4699 | 212 |
| 254 | 3300049578 | Ga0501042_0037700 | Ga0501042_0037700_232_870 | 212 |
| 255 | 3300049579 | Ga0501043_0050847 | Ga0501043_0050847_1114_1752 | 212 |
| 256 | 3300049579 | Ga0501043_0096307 | Ga0501043_0096307_427_1065 | 212 |
| 257 | 3300049579 | Ga0501043_0255970 | Ga0501043_0255970_428_1066 | 212 |
| 258 | 3300049580 | Ga0501046_0001557 | Ga0501046_0001557_1468_2106 | 212 |
| 259 | 3300049580 | Ga0501046_0001888 | Ga0501046_0001888_14082_14720 | 212 |
| 260 | 3300049580 | Ga0501046_0028318 | Ga0501046_0028318_2409_3047 | 212 |
| 261 | 3300049581 | Ga0501047_0093704 | Ga0501047_0093704_1974_2612 | 212 |
| 262 | 3300049582 | Ga0501048_0003141 | Ga0501048_0003141_9958_10596 | 212 |
| 263 | 3300049582 | Ga0501048_0092854 | Ga0501048_0092854_803_1441 | 212 |
| 264 | 3300049585 | Ga0501069_0081343 | Ga0501069_0081343_498_1136 | 212 |
| 265 | 3300049590 | Ga0501074_0054970 | Ga0501074_0054970_1031_1669 | 212 |
| 266 | 3300049742 | Ga0501080_0011955 | Ga0501080_0011955_1425_2063 | 212 |
| 267 | 3300049822 | Ga0501035_0017281 | Ga0501035_0017281_2691_3329 | 212 |
| 268 | 3300049822 | Ga0501035_0108666 | Ga0501035_0108666_1531_2169 | 212 |
| 269 | 3300049823 | Ga0501044_0048612 | Ga0501044_0048612_1520_2158 | 212 |
| 270 | 3300005466 | Ga0070685_10282512 | Ga0070685_102825122 | 213 |
| 271 | 3300013307 | Ga0157372_11535245 | Ga0157372_115352451 | 213 |
| 272 | 3300050492 | nmdc:mga0yw44_76368_c1 | nmdc:mga0yw44_76368_c1_919_1584 | 215 |
| 273 | 3300005327 | Ga0070658_10194385 | Ga0070658_101943852 | 217 |
| 274 | 3300005616 | Ga0068852_100054261 | Ga0068852_1000542613 | 217 |
| 275 | 3300005719 | Ga0068861_100574541 | Ga0068861_1005745412 | 217 |
| 276 | 3300009098 | Ga0105245_10631231 | Ga0105245_106312312 | 217 |
| 277 | 3300011119 | Ga0105246_10590523 | Ga0105246_105905231 | 217 |
| 278 | 3300025909 | Ga0207705_10311771 | Ga0207705_103117712 | 217 |
| 279 | 3300025940 | Ga0207691_10353813 | Ga0207691_103538133 | 217 |
| 280 | 3300026142 | Ga0207698_10088157 | Ga0207698_100881571 | 217 |
| 281 | 3300048911 | Ga0496108_0157459 | Ga0496108_0157459_238_909 | 217 |
| 282 | 3300048917 | Ga0496114_0514627 | Ga0496114_0514627_73_744 | 217 |
| 283 | 3300009148 | Ga0105243_10097632 | Ga0105243_100976323 | 219 |
| 284 | 3300009176 | Ga0105242_10932003 | Ga0105242_109320031 | 219 |
| 285 | 3300009177 | Ga0105248_10972678 | Ga0105248_109726781 | 219 |
| 286 | 3300011119 | Ga0105246_10058265 | Ga0105246_100582655 | 219 |
| 287 | 3300014326 | Ga0157380_10349885 | Ga0157380_103498852 | 219 |
| 288 | 3300046461 | Ga0495641_0077320 | Ga0495641_0077320_328_1023 | 219 |
| 289 | 3300046690 | Ga0495624_0287751 | Ga0495624_0287751_276_971 | 219 |
| 290 | 3300048905 | Ga0496102_0234349 | Ga0496102_0234349_643_1338 | 219 |
| 291 | 3300048908 | Ga0496105_0114360 | Ga0496105_0114360_1224_1919 | 219 |
| 292 | 3300048912 | Ga0496109_0155970 | Ga0496109_0155970_629_1324 | 219 |
| 293 | 3300048913 | Ga0496110_0448973 | Ga0496110_0448973_79_774 | 219 |
| 294 | 3300048915 | Ga0496112_0591628 | Ga0496112_0591628_16_711 | 219 |
| 295 | 3300048916 | Ga0496113_0109654 | Ga0496113_0109654_1065_1760 | 219 |
| 296 | 3300048917 | Ga0496114_0042355 | Ga0496114_0042355_537_1232 | 219 |
| 297 | 3300005329 | Ga0070683_100236393 | Ga0070683_1002363932 | 221 |
| 298 | 3300006038 | Ga0075365_10282749 | Ga0075365_102827491 | 221 |
| 299 | 3300009094 | Ga0111539_10121164 | Ga0111539_101211642 | 221 |
| 300 | 3300049583 | Ga0501067_0042543 | Ga0501067_0042543_419_1084 | 221 |
| 301 | 3300049585 | Ga0501069_0054111 | Ga0501069_0054111_1425_2090 | 221 |
| 302 | 3300050492 | nmdc:mga0yw44_65533_c1 | nmdc:mga0yw44_65533_c1_581_1246 | 221 |
| 303 | 3300050511 | nmdc:mga08y16_217606_c1 | nmdc:mga08y16_217606_c1_340_1005 | 221 |
| 304 | 3300002075 | JGI24738J21930_10003829 | JGI24738J21930_100038292 | 222 |
| 305 | 3300005329 | Ga0070683_100034545 | Ga0070683_1000345455 | 222 |
| 306 | 3300005331 | Ga0070670_100327116 | Ga0070670_1003271162 | 222 |
| 307 | 3300005337 | Ga0070682_100055009 | Ga0070682_1000550094 | 222 |
| 308 | 3300005338 | Ga0068868_100209675 | Ga0068868_1002096752 | 222 |
| 309 | 3300005339 | Ga0070660_100167749 | Ga0070660_1001677493 | 222 |
| 310 | 3300005340 | Ga0070689_100140653 | Ga0070689_1001406532 | 222 |
| 311 | 3300005341 | Ga0070691_10053624 | Ga0070691_100536242 | 222 |
| 312 | 3300005345 | Ga0070692_10010777 | Ga0070692_100107775 | 222 |
| 313 | 3300005354 | Ga0070675_100063505 | Ga0070675_1000635052 | 222 |
| 314 | 3300005356 | Ga0070674_100109361 | Ga0070674_1001093614 | 222 |
| 315 | 3300005364 | Ga0070673_100049531 | Ga0070673_1000495312 | 222 |
| 316 | 3300005366 | Ga0070659_100569835 | Ga0070659_1005698352 | 222 |
| 317 | 3300005459 | Ga0068867_100005197 | Ga0068867_1000051975 | 222 |
| 318 | 3300005535 | Ga0070684_100042445 | Ga0070684_1000424452 | 222 |
| 319 | 3300005543 | Ga0070672_100007939 | Ga0070672_1000079392 | 222 |
| 320 | 3300005544 | Ga0070686_100040392 | Ga0070686_1000403922 | 222 |
| 321 | 3300005615 | Ga0070702_100001326 | Ga0070702_1000013262 | 222 |
| 322 | 3300005616 | Ga0068852_100014642 | Ga0068852_1000146425 | 222 |
| 323 | 3300005718 | Ga0068866_10114143 | Ga0068866_101141432 | 222 |
| 324 | 3300005719 | Ga0068861_100046229 | Ga0068861_1000462292 | 222 |
| 325 | 3300005840 | Ga0068870_10003690 | Ga0068870_100036905 | 222 |
| 326 | 3300005844 | Ga0068862_100215416 | Ga0068862_1002154163 | 222 |
| 327 | 3300006881 | Ga0068865_100319867 | Ga0068865_1003198673 | 222 |
| 328 | 3300009098 | Ga0105245_10157041 | Ga0105245_101570412 | 222 |
| 329 | 3300009148 | Ga0105243_10001391 | Ga0105243_1000139121 | 222 |
| 330 | 3300009177 | Ga0105248_10025357 | Ga0105248_100253575 | 222 |
| 331 | 3300009553 | Ga0105249_10251044 | Ga0105249_102510442 | 222 |
| 332 | 3300013104 | Ga0157370_10450056 | Ga0157370_104500561 | 222 |
| 333 | 3300013296 | Ga0157374_10290029 | Ga0157374_102900292 | 222 |
| 334 | 3300014325 | Ga0163163_10086482 | Ga0163163_100864825 | 222 |
| 335 | 3300014326 | Ga0157380_10270036 | Ga0157380_102700364 | 222 |
| 336 | 3300014745 | Ga0157377_10002878 | Ga0157377_100028783 | 222 |
| 337 | 3300017792 | Ga0163161_10177862 | Ga0163161_101778622 | 222 |
| 338 | 3300025901 | Ga0207688_10003906 | Ga0207688_100039067 | 222 |
| 339 | 3300025908 | Ga0207643_10002935 | Ga0207643_100029358 | 222 |
| 340 | 3300025919 | Ga0207657_10209218 | Ga0207657_102092183 | 222 |
| 341 | 3300025923 | Ga0207681_10227581 | Ga0207681_102275812 | 222 |
| 342 | 3300025925 | Ga0207650_10245265 | Ga0207650_102452652 | 222 |
| 343 | 3300025927 | Ga0207687_10067354 | Ga0207687_100673544 | 222 |
| 344 | 3300025932 | Ga0207690_10241973 | Ga0207690_102419732 | 222 |
| 345 | 3300025933 | Ga0207706_10421678 | Ga0207706_104216782 | 222 |
| 346 | 3300025934 | Ga0207686_10328208 | Ga0207686_103282082 | 222 |
| 347 | 3300025936 | Ga0207670_10276521 | Ga0207670_102765213 | 222 |
| 348 | 3300025937 | Ga0207669_10254668 | Ga0207669_102546682 | 222 |
| 349 | 3300025938 | Ga0207704_10312277 | Ga0207704_103122772 | 222 |
| 350 | 3300025940 | Ga0207691_10004297 | Ga0207691_1000429718 | 222 |
| 351 | 3300025941 | Ga0207711_10110575 | Ga0207711_101105754 | 222 |
| 352 | 3300025960 | Ga0207651_10034874 | Ga0207651_100348742 | 222 |
| 353 | 3300025961 | Ga0207712_10209700 | Ga0207712_102097003 | 222 |
| 354 | 3300026075 | Ga0207708_10004360 | Ga0207708_100043602 | 222 |
| 355 | 3300026089 | Ga0207648_10000657 | Ga0207648_100006578 | 222 |
| 356 | 3300026118 | Ga0207675_100004832 | Ga0207675_1000048328 | 222 |
| 357 | 3300026142 | Ga0207698_10017359 | Ga0207698_100173595 | 222 |
| 358 | 3300048909 | Ga0496106_0196288 | Ga0496106_0196288_809_1477 | 222 |
| 359 | 3300048911 | Ga0496108_0027715 | Ga0496108_0027715_2983_3651 | 222 |
| 360 | 3300048912 | Ga0496109_0056934 | Ga0496109_0056934_64_732 | 222 |
| 361 | 3300048917 | Ga0496114_0118965 | Ga0496114_0118965_1330_1998 | 222 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6o6o-assembly1.cif.gz_B | structure of the regulator fasr from mycobacterium tuberculosis | 0.9218 | 29 | 216 |
| 6o6o-assembly1.cif.gz_B | structure of the regulator fasr from mycobacterium tuberculosis | 0.9074 | 29 | 216 |
| 6o6n-assembly1.cif.gz_A | structure of the regulator fasr from mycobacterium tuberculosis in complex with c20-coa | 0.8838 | 22 | 216 |
| 6o6n-assembly1.cif.gz_A | structure of the regulator fasr from mycobacterium tuberculosis in complex with c20-coa | 0.8626 | 22 | 216 |
| 3f1b-assembly1.cif.gz_A-2 | the crystal structure of a tetr-like transcriptional regulator from rhodococcus sp. rha1. | 0.8453 | 22 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x1eB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 1.006 | 31 | 77 | 1.10.10.60 |
| 1pb6B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 1.002 | 26 | 77 | 1.10.10.60 |
| 4xk4A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.996 | 27 | 77 | 1.10.10.60 |
| 4xk4B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9958 | 27 | 77 | 1.10.10.60 |
| 4xk4D01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9955 | 27 | 77 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E8LC52-F1-model_v4 | TetR family transcriptional regulator | 0.9409 | 22 | 155 |
GO:0000976
GO:0003700 |
| AF-D3Q9K5-F1-model_v4 | Transcriptional regulator, TetR family | 0.9215 | 19 | 212 |
GO:0000976
GO:0003700 |
| AF-A0A6J7T888-F1-model_v4 | Unannotated protein | 0.9042 | 24 | 219 |
GO:0000976
GO:0003700 |
| AF-A0A1I1DPN5-F1-model_v4 | Transcriptional regulator, TetR family | 0.9025 | 23 | 221 |
GO:0000976
GO:0003700 |
| AF-A0A1I1DPN5-F1-model_v4 | Transcriptional regulator, TetR family | 0.898 | 23 | 221 |
GO:0000976
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar