F422117

General Info

Members Datasets Scaffolds Average Seq Length
361 153 722 124

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100288260|Ga0070661_1002882603
Length 149
Sequence MAEGRLAPPGGLLLACRPRETYRRPMKIKGGCHCGAVRFDAETADPPVEALHCNCSICRMTGFVHIMVPHERFELVTGRDALASYRFGTGAAEHLFCRHCGVKSFYQPRSHPSAWSVNANCLDEPVEVALERFDGRNWEAAKADLDAQE

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
125 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
146 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
147 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
148 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
149 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
150 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
151 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.16
Rhizosphere 95.29
Stem 0
Stem Tuber 0
Unclassified 11.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100288260 3300005344 Bacteria 1275
2 JGI24740J21852_10073861 3300001979 Bacteria 907
3 JGI24735J21928_10040981 3300002067 Bacteria 1350
4 Ga0070658_10021009 3300005327 Bacteria 5229
5 Ga0070658_10035554 3300005327 Bacteria 4013
6 Ga0070658_10036962 3300005327 Bacteria 3935
7 Ga0070658_10565943 3300005327 Unclassified 984
8 Ga0070658_11355730 3300005327 Bacteria 617
9 Ga0070683_100165834 3300005329 Bacteria 2096
10 Ga0070683_100449563 3300005329 Bacteria 1229
11 Ga0070670_101052068 3300005331 Bacteria 741
12 Ga0070677_10181483 3300005333 Bacteria 1003
13 Ga0070680_100003297 3300005336 Bacteria 12045
14 Ga0070680_100006388 3300005336 Bacteria 8955
15 Ga0070680_100008596 3300005336 Bacteria 7824
16 Ga0070680_100129623 3300005336 Bacteria 2109
17 Ga0070680_100676287 3300005336 Bacteria 888
18 Ga0070680_100788735 3300005336 Bacteria 818
19 Ga0070680_101814703 3300005336 Unclassified 528
20 Ga0070682_100036983 3300005337 Bacteria 2986
21 Ga0070682_100203599 3300005337 Bacteria 1398
22 Ga0070682_100607147 3300005337 Unclassified 865
23 Ga0070682_100973836 3300005337 Bacteria 702
24 Ga0070660_100103396 3300005339 Bacteria 2259
25 Ga0070660_100304336 3300005339 Bacteria 1307
26 Ga0070660_100351186 3300005339 Bacteria 1214
27 Ga0070660_100359171 3300005339 Bacteria 1200
28 Ga0070660_100632960 3300005339 Bacteria 895
29 Ga0070660_100768552 3300005339 Bacteria 809
30 Ga0070691_10265432 3300005341 Bacteria 926
31 Ga0070661_100144559 3300005344 Bacteria 1794
32 Ga0070661_100186740 3300005344 Unclassified 1579
33 Ga0070661_100461088 3300005344 Bacteria 1012
34 Ga0070661_100586004 3300005344 Bacteria 900
35 Ga0070661_101372599 3300005344 Bacteria 594
36 Ga0070661_101829978 3300005344 Bacteria 515
37 Ga0070692_10024981 3300005345 Bacteria 2941
38 Ga0070692_10119973 3300005345 Bacteria 1466
39 Ga0070692_10303792 3300005345 Bacteria 975
40 Ga0070675_100101426 3300005354 Bacteria 2425
41 Ga0070671_100122761 3300005355 Bacteria 2186
42 Ga0070671_100156468 3300005355 Bacteria 1925
43 Ga0070673_100041011 3300005364 Bacteria 3555
44 Ga0070673_100538158 3300005364 Bacteria 1060
45 Ga0070659_100024378 3300005366 Bacteria 4638
46 Ga0070659_100091216 3300005366 Bacteria 2442
47 Ga0070659_100152629 3300005366 Bacteria 1885
48 Ga0070659_100524610 3300005366 Bacteria 1011
49 Ga0070659_100628601 3300005366 Bacteria 924
50 Ga0070659_100820813 3300005366 Bacteria 809
51 Ga0070714_100113361 3300005435 Bacteria 2404
52 Ga0070714_100296403 3300005435 Bacteria 1506
53 Ga0070713_100021887 3300005436 Bacteria 4929
54 Ga0070713_100110429 3300005436 Bacteria 2397
55 Ga0070663_100151679 3300005455 Bacteria 1777
56 Ga0070678_100097765 3300005456 Bacteria 2268
57 Ga0070662_100098919 3300005457 Bacteria 2204
58 Ga0070662_100148396 3300005457 Bacteria 1823
59 Ga0070681_10452894 3300005458 Bacteria 1195
60 Ga0070681_10490345 3300005458 Bacteria 1142
61 Ga0070681_10768055 3300005458 Bacteria 880
62 Ga0070681_10906419 3300005458 Bacteria 800
63 Ga0068867_101861029 3300005459 Bacteria 567
64 Ga0070679_100189570 3300005530 Bacteria 2026
65 Ga0070679_100405749 3300005530 Bacteria 1308
66 Ga0070679_100734050 3300005530 Bacteria 930
67 Ga0070679_100735359 3300005530 Bacteria 929
68 Ga0070679_100774554 3300005530 Bacteria 902
69 Ga0070679_101055020 3300005530 Bacteria 757
70 Ga0070684_100032126 3300005535 Bacteria 4472
71 Ga0070684_100158947 3300005535 Bacteria 2049
72 Ga0068853_100054007 3300005539 Bacteria 3462
73 Ga0068853_100133759 3300005539 Bacteria 2222
74 Ga0068853_100473982 3300005539 Bacteria 1179
75 Ga0070672_100226103 3300005543 Bacteria 1571
76 Ga0070696_100086253 3300005546 Bacteria 2229
77 Ga0070693_100089417 3300005547 Bacteria 1854
78 Ga0068855_100050642 3300005563 Bacteria 4893
79 Ga0068855_100060730 3300005563 Bacteria 4419
80 Ga0068855_100622032 3300005563 Bacteria 1162
81 Ga0070664_100221641 3300005564 Bacteria 1692
82 Ga0070664_100293906 3300005564 Unclassified 1467
83 Ga0070664_101156110 3300005564 Unclassified 729
84 Ga0070664_101248173 3300005564 Bacteria 701
85 Ga0068857_100019132 3300005577 Bacteria 6010
86 Ga0068857_100265182 3300005577 Bacteria 1577
87 Ga0068854_100007102 3300005578 Bacteria 7150
88 Ga0068854_100015332 3300005578 Bacteria 5074
89 Ga0068854_101298328 3300005578 Unclassified 655
90 Ga0068854_101820360 3300005578 Bacteria 558
91 Ga0068854_102098033 3300005578 Unclassified 522
92 Ga0068856_100142685 3300005614 Bacteria 2402
93 Ga0068856_100156188 3300005614 Bacteria 2291
94 Ga0068852_100007274 3300005616 Bacteria 8072
95 Ga0068852_100394536 3300005616 Bacteria 1360
96 Ga0068852_100796872 3300005616 Unclassified 959
97 Ga0068852_101736097 3300005616 Unclassified 647
98 Ga0068852_101774040 3300005616 Unclassified 639
99 Ga0068852_102164750 3300005616 Bacteria 578
100 Ga0068864_100091107 3300005618 Bacteria 2689
101 Ga0068861_101375680 3300005719 Bacteria 689
102 Ga0068851_10003930 3300005834 Bacteria 6651
103 Ga0068851_10039142 3300005834 Bacteria 2381
104 Ga0068863_100574806 3300005841 Bacteria 1114
105 Ga0097621_100177448 3300006237 Bacteria 1839
106 Ga0068871_100178930 3300006358 Bacteria 1822
107 Ga0068865_101213914 3300006881 Unclassified 668
108 Ga0105240_10021344 3300009093 Bacteria 8614
109 Ga0105240_10176345 3300009093 Bacteria 2527
110 Ga0105240_11432764 3300009093 Bacteria 725
111 Ga0105241_10049965 3300009174 Bacteria 3187
112 Ga0105242_10478970 3300009176 Bacteria 1179
113 Ga0105248_10021512 3300009177 Bacteria 7145
114 Ga0105237_10062010 3300009545 Bacteria 3738
115 Ga0105237_12594822 3300009545 Bacteria 517
116 Ga0105238_10156683 3300009551 Bacteria 2253
117 Ga0157373_10021223 3300013100 Bacteria 4715
118 Ga0157373_10043456 3300013100 Bacteria 3209
119 Ga0157373_10054899 3300013100 Bacteria 2830
120 Ga0157373_10213566 3300013100 Bacteria 1360
121 Ga0157373_10242518 3300013100 Unclassified 1274
122 Ga0157373_10553546 3300013100 Bacteria 834
123 Ga0157371_10034093 3300013102 Bacteria 3654
124 Ga0157371_10074252 3300013102 Bacteria 2408
125 Ga0157371_10281682 3300013102 Bacteria 1201
126 Ga0157371_10331695 3300013102 Unclassified 1105
127 Ga0157371_10428636 3300013102 Bacteria 970
128 Ga0157371_10436158 3300013102 Bacteria 962
129 Ga0157371_10635692 3300013102 Bacteria 796
130 Ga0157370_10007112 3300013104 Bacteria 12214
131 Ga0157370_10066828 3300013104 Bacteria 3399
132 Ga0157370_10304110 3300013104 Bacteria 1472
133 Ga0157370_10632856 3300013104 Bacteria 978
134 Ga0157369_10030548 3300013105 Bacteria 5942
135 Ga0157369_10146601 3300013105 Bacteria 2496
136 Ga0157369_10174457 3300013105 Bacteria 2264
137 Ga0157369_10523671 3300013105 Bacteria 1226
138 Ga0157369_10667542 3300013105 Bacteria 1071
139 Ga0157378_13317965 3300013297 Bacteria 500
140 Ga0163162_10307462 3300013306 Bacteria 1718
141 Ga0157372_10360311 3300013307 Bacteria 1694
142 Ga0157372_10533382 3300013307 Bacteria 1368
143 Ga0157372_11616525 3300013307 Bacteria 746
144 Ga0157372_11702988 3300013307 Bacteria 725
145 Ga0157372_11875355 3300013307 Unclassified 689
146 Ga0157372_12220626 3300013307 Unclassified 630
147 Ga0157372_12647837 3300013307 Bacteria 575
148 Ga0157375_10038050 3300013308 Bacteria 4616
149 Ga0163163_11798520 3300014325 Bacteria 673
150 Ga0157380_12074573 3300014326 Unclassified 631
151 Ga0157379_12316869 3300014968 Unclassified 535
152 Ga0163161_10035265 3300017792 Bacteria 3581
153 Ga0206355_1668081 3300020076 Bacteria 1048
154 Ga0207697_10337606 3300025315 Unclassified 669
155 Ga0207656_10157599 3300025321 Bacteria 1078
156 Ga0207656_10261915 3300025321 Bacteria 849
157 Ga0207647_10016577 3300025904 Bacteria 5025
158 Ga0207647_10025489 3300025904 Bacteria 3884
159 Ga0207647_10037393 3300025904 Bacteria 3078
160 Ga0207705_10000169 3300025909 Bacteria 69941
161 Ga0207705_10008203 3300025909 Bacteria 7641
162 Ga0207705_10095338 3300025909 Bacteria 2183
163 Ga0207705_10096552 3300025909 Bacteria 2170
164 Ga0207705_10108348 3300025909 Bacteria 2050
165 Ga0207705_10156259 3300025909 Bacteria 1711
166 Ga0207705_10269145 3300025909 Bacteria 1303
167 Ga0207705_10346302 3300025909 Bacteria 1144
168 Ga0207705_10737736 3300025909 Bacteria 765
169 Ga0207654_10540411 3300025911 Bacteria 827
170 Ga0207707_10272052 3300025912 Bacteria 1468
171 Ga0207707_10406334 3300025912 Bacteria 1168
172 Ga0207707_11116085 3300025912 Bacteria 642
173 Ga0207695_10020564 3300025913 Bacteria 7556
174 Ga0207671_10037020 3300025914 Bacteria 3618
175 Ga0207660_10001169 3300025917 Bacteria 17546
176 Ga0207660_10196955 3300025917 Bacteria 1572
177 Ga0207660_10755672 3300025917 Bacteria 793
178 Ga0207657_10001497 3300025919 Bacteria 24993
179 Ga0207657_10029097 3300025919 Bacteria 5033
180 Ga0207657_10121324 3300025919 Bacteria 2151
181 Ga0207657_10178287 3300025919 Unclassified 1719
182 Ga0207657_10607037 3300025919 Bacteria 853
183 Ga0207657_10608068 3300025919 Bacteria 853
184 Ga0207657_10803018 3300025919 Unclassified 727
185 Ga0207649_10005659 3300025920 Bacteria 6768
186 Ga0207649_11518488 3300025920 Unclassified 530
187 Ga0207652_10066362 3300025921 Bacteria 3127
188 Ga0207652_10132727 3300025921 Bacteria 2222
189 Ga0207652_10283656 3300025921 Bacteria 1494
190 Ga0207652_10948414 3300025921 Bacteria 758
191 Ga0207652_11286316 3300025921 Bacteria 634
192 Ga0207652_11881720 3300025921 Bacteria 504
193 Ga0207694_10160550 3300025924 Bacteria 1815
194 Ga0207650_10108205 3300025925 Bacteria 2148
195 Ga0207650_10684427 3300025925 Bacteria 866
196 Ga0207659_10193001 3300025926 Archaea 1622
197 Ga0207664_10030972 3300025929 Bacteria 4089
198 Ga0207644_10106442 3300025931 Bacteria 2114
199 Ga0207644_10114706 3300025931 Bacteria 2042
200 Ga0207690_10003663 3300025932 Bacteria 9146
201 Ga0207690_10038287 3300025932 Bacteria 3119
202 Ga0207690_10061932 3300025932 Bacteria 2545
203 Ga0207690_10113636 3300025932 Bacteria 1954
204 Ga0207706_10008069 3300025933 Bacteria 9718
205 Ga0207706_10046977 3300025933 Bacteria 3821
206 Ga0207706_10268675 3300025933 Bacteria 1488
207 Ga0207686_10428081 3300025934 Bacteria 1014
208 Ga0207691_10025059 3300025940 Bacteria 5604
209 Ga0207711_10278355 3300025941 Bacteria 1540
210 Ga0207661_10085369 3300025944 Bacteria 2616
211 Ga0207661_10581704 3300025944 Bacteria 1027
212 Ga0207661_11742759 3300025944 Unclassified 568
213 Ga0207679_10049006 3300025945 Bacteria 3079
214 Ga0207679_10151360 3300025945 Unclassified 1889
215 Ga0207679_11535750 3300025945 Bacteria 610
216 Ga0207667_10002705 3300025949 Bacteria 21934
217 Ga0207667_10061714 3300025949 Bacteria 3921
218 Ga0207667_10572143 3300025949 Bacteria 1141
219 Ga0207667_10643783 3300025949 Bacteria 1066
220 Ga0207651_10539448 3300025960 Bacteria 1013
221 Ga0207712_10440181 3300025961 Bacteria 1103
222 Ga0207640_10012499 3300025981 Bacteria 4838
223 Ga0207640_10419145 3300025981 Unclassified 1095
224 Ga0207640_10991974 3300025981 Unclassified 738
225 Ga0207640_11119278 3300025981 Bacteria 697
226 Ga0207640_11296375 3300025981 Bacteria 650
227 Ga0207639_10075884 3300026041 Bacteria 2645
228 Ga0207639_10107836 3300026041 Bacteria 2263
229 Ga0207639_10128051 3300026041 Bacteria 2097
230 Ga0207639_10442991 3300026041 Bacteria 1178
231 Ga0207639_11547408 3300026041 Unclassified 622
232 Ga0207678_10226829 3300026067 Bacteria 1599
233 Ga0207678_11298413 3300026067 Unclassified 644
234 Ga0207702_10003195 3300026078 Bacteria 15141
235 Ga0207702_10009212 3300026078 Bacteria 8301
236 Ga0207702_10271673 3300026078 Bacteria 1599
237 Ga0207702_10842764 3300026078 Bacteria 907
238 Ga0207641_10512308 3300026088 Bacteria 1166
239 Ga0207641_12214007 3300026088 Unclassified 550
240 Ga0207648_11934407 3300026089 Bacteria 551
241 Ga0207676_10053638 3300026095 Bacteria 3156
242 Ga0207676_10302565 3300026095 Bacteria 1461
243 Ga0207674_10005725 3300026116 Bacteria 14735
244 Ga0207674_10008283 3300026116 Bacteria 12040
245 Ga0207674_10014471 3300026116 Bacteria 8712
246 Ga0207675_101164533 3300026118 Unclassified 791
247 Ga0207683_11161811 3300026121 Bacteria 716
248 Ga0207698_10063117 3300026142 Bacteria 2897
249 Ga0207698_10106610 3300026142 Bacteria 2337
250 Ga0207698_10295892 3300026142 Unclassified 1504
251 Ga0207698_10879584 3300026142 Bacteria 902
252 Ga0207698_12603626 3300026142 Unclassified 515
253 Ga0316178_1072229 3300030735 Bacteria 1024
254 Ga0307408_100177679 3300031548 Bacteria 1704
255 Ga0307408_101585842 3300031548 Unclassified 621
256 Ga0307405_10285058 3300031731 Bacteria 1245
257 Ga0307405_10666161 3300031731 Bacteria 858
258 Ga0307413_10227321 3300031824 Bacteria 1367
259 Ga0307413_10271850 3300031824 Bacteria 1269
260 Ga0307413_10653772 3300031824 Bacteria 867
261 Ga0307410_10433735 3300031852 Bacteria 1068
262 Ga0307410_10448796 3300031852 Bacteria 1052
263 Ga0307406_10044230 3300031901 Bacteria 2790
264 Ga0307406_10299671 3300031901 Bacteria 1234
265 Ga0307412_10078884 3300031911 Bacteria 2269
266 Ga0307412_10222535 3300031911 Bacteria 1447
267 Ga0307409_100003478 3300031995 Bacteria 8561
268 Ga0307409_100176280 3300031995 Bacteria 1887
269 Ga0307409_100393825 3300031995 Unclassified 1321
270 Ga0307409_101240043 3300031995 Unclassified 770
271 Ga0307416_100396250 3300032002 Bacteria 1416
272 Ga0307414_11807271 3300032004 Bacteria 570
273 Ga0307411_10144745 3300032005 Bacteria 1757
274 Ga0307411_10155642 3300032005 Bacteria 1704
275 Ga0307415_100223363 3300032126 Bacteria 1511
276 Ga0307415_100770046 3300032126 Unclassified 875
277 Ga0373923_0003869 3300035111 Bacteria 4879
278 Ga0373955_0107634 3300035172 Bacteria 1609
279 Ga0373933_0034989 3300035724 Bacteria 2931
280 Ga0373937_0426743 3300036401 Bacteria 1258
281 Ga0395899_0018049 3300037312 Bacteria 5370
282 Ga0395899_0034700 3300037312 Bacteria 3788
283 Ga0395899_0165803 3300037312 Bacteria 1558
284 Ga0395899_0186208 3300037312 Bacteria 1455
285 Ga0395899_0295246 3300037312 Bacteria 1098
286 Ga0395899_0314949 3300037312 Bacteria 1055
287 Ga0395899_0399295 3300037312 Bacteria 910
288 Ga0395900_0000803 3300037418 Bacteria 41506
289 Ga0395900_0036528 3300037418 Bacteria 5065
290 Ga0395900_0147469 3300037418 Bacteria 2406
291 Ga0395900_0207005 3300037418 Bacteria 1982
292 Ga0395900_0262630 3300037418 Unclassified 1723
293 Ga0395900_0262633 3300037418 Bacteria 1723
294 Ga0395900_0401087 3300037418 Bacteria 1335
295 Ga0395900_0889385 3300037418 Bacteria 814
296 Ga0395900_1014922 3300037418 Bacteria 749
297 Ga0395900_1258204 3300037418 Bacteria 654
298 Ga0395898_0025366 3300037466 Bacteria 5974
299 Ga0395898_0045260 3300037466 Bacteria 4326
300 Ga0395898_0057795 3300037466 Bacteria 3778
301 Ga0395898_0425385 3300037466 Bacteria 1265
302 Ga0395898_1802717 3300037466 Unclassified 533
303 Ga0395905_0004444 3300037471 Bacteria 14575
304 Ga0395905_0029985 3300037471 Bacteria 5127
305 Ga0395905_0096106 3300037471 Bacteria 2781
306 Ga0395905_0099347 3300037471 Bacteria 2733
307 Ga0395905_0130443 3300037471 Bacteria 2364
308 Ga0395905_0197508 3300037471 Bacteria 1886
309 Ga0395905_0203857 3300037471 Bacteria 1854
310 Ga0395905_0576565 3300037471 Bacteria 1026
311 Ga0395905_0899944 3300037471 Unclassified 788
312 Ga0395905_1174138 3300037471 Bacteria 671
313 Ga0436364_0527735 3300037853 Bacteria 613
314 Ga0395901_0001141 3300038443 Bacteria 28157
315 Ga0395901_0022483 3300038443 Bacteria 6464
316 Ga0395901_0058425 3300038443 Bacteria 4011
317 Ga0395901_0076569 3300038443 Bacteria 3490
318 Ga0395901_0133233 3300038443 Bacteria 2611
319 Ga0395901_0223948 3300038443 Bacteria 1965
320 Ga0395901_0274569 3300038443 Bacteria 1752
321 Ga0395901_0484660 3300038443 Bacteria 1261
322 Ga0395901_1084321 3300038443 Bacteria 772
323 Ga0395901_1201210 3300038443 Bacteria 724
324 Ga0395901_1460140 3300038443 Bacteria 641
325 Ga0395901_1773165 3300038443 Unclassified 567
326 Ga0436365_0145461 3300039437 Bacteria 990
327 Ga0436362_0124016 3300039453 Bacteria 915
328 Ga0439465_0229841 3300041413 Bacteria 682
329 Ga0439464_0102949 3300042439 Bacteria 869
330 Ga0466963_0028602 3300044694 Bacteria 3581
331 Ga0466964_0653569 3300044706 Unclassified 582
332 Ga0466959_0444352 3300045049 Bacteria 879
333 Ga0466958_0439519 3300045836 Bacteria 844
334 Ga0466967_0083834 3300045976 Bacteria 2883
335 Ga0466967_1688632 3300045976 Bacteria 631
336 Ga0495602_0309479 3300048088 Bacteria 1153
337 Ga0496101_0269030 3300048904 Bacteria 1330
338 Ga0496102_1668483 3300048905 Bacteria 555
339 Ga0496104_0067367 3300048907 Bacteria 3401
340 Ga0496105_0100233 3300048908 Bacteria 2392
341 Ga0496107_0037658 3300048910 Bacteria 3471
342 Ga0496108_0007326 3300048911 Bacteria 8943
343 Ga0496109_0159701 3300048912 Bacteria 2112
344 Ga0496110_1332228 3300048913 Unclassified 627
345 Ga0496111_0013499 3300048914 Bacteria 5562
346 Ga0496111_0092071 3300048914 Bacteria 2222
347 Ga0496112_0475781 3300048915 Bacteria 1186
348 Ga0496112_0816950 3300048915 Bacteria 856
349 Ga0496113_1324865 3300048916 Bacteria 559
350 Ga0496114_0120469 3300048917 Bacteria 2256
351 Ga0496115_0411257 3300048918 Bacteria 1097
352 Ga0501292_049884 3300049515 Bacteria 740
353 Ga0501202_026748 3300049652 Bacteria 1182
354 Ga0501202_212728 3300049652 Unclassified 533
355 Ga0501206_074596 3300049653 Bacteria 580
356 Ga0501256_034002 3300049685 Bacteria 585
357 Ga0501221_030985 3300049704 Bacteria 1115
358 Ga0501225_0134250 3300049705 Bacteria 744
359 Ga0501270_032081 3300049767 Bacteria 872
360 nmdc:mga09592_499734_c1 3300050508 Bacteria 1047
361 Ga0587090_139590 3300059510 Bacteria 541
362 Ga0070661_100288260
363 JGI24740J21852_10073861
364 JGI24735J21928_10040981
365 Ga0070658_10021009
366 Ga0070658_10035554
367 Ga0070658_10036962
368 Ga0070658_10565943
369 Ga0070658_11355730
370 Ga0070683_100165834
371 Ga0070683_100449563
372 Ga0070670_101052068
373 Ga0070677_10181483
374 Ga0070680_100003297
375 Ga0070680_100006388
376 Ga0070680_100008596
377 Ga0070680_100129623
378 Ga0070680_100676287
379 Ga0070680_100788735
380 Ga0070680_101814703
381 Ga0070682_100036983
382 Ga0070682_100203599
383 Ga0070682_100607147
384 Ga0070682_100973836
385 Ga0070660_100103396
386 Ga0070660_100304336
387 Ga0070660_100351186
388 Ga0070660_100359171
389 Ga0070660_100632960
390 Ga0070660_100768552
391 Ga0070691_10265432
392 Ga0070661_100144559
393 Ga0070661_100186740
394 Ga0070661_100461088
395 Ga0070661_100586004
396 Ga0070661_101372599
397 Ga0070661_101829978
398 Ga0070692_10024981
399 Ga0070692_10119973
400 Ga0070692_10303792
401 Ga0070675_100101426
402 Ga0070671_100122761
403 Ga0070671_100156468
404 Ga0070673_100041011
405 Ga0070673_100538158
406 Ga0070659_100024378
407 Ga0070659_100091216
408 Ga0070659_100152629
409 Ga0070659_100524610
410 Ga0070659_100628601
411 Ga0070659_100820813
412 Ga0070714_100113361
413 Ga0070714_100296403
414 Ga0070713_100021887
415 Ga0070713_100110429
416 Ga0070663_100151679
417 Ga0070678_100097765
418 Ga0070662_100098919
419 Ga0070662_100148396
420 Ga0070681_10452894
421 Ga0070681_10490345
422 Ga0070681_10768055
423 Ga0070681_10906419
424 Ga0068867_101861029
425 Ga0070679_100189570
426 Ga0070679_100405749
427 Ga0070679_100734050
428 Ga0070679_100735359
429 Ga0070679_100774554
430 Ga0070679_101055020
431 Ga0070684_100032126
432 Ga0070684_100158947
433 Ga0068853_100054007
434 Ga0068853_100133759
435 Ga0068853_100473982
436 Ga0070672_100226103
437 Ga0070696_100086253
438 Ga0070693_100089417
439 Ga0068855_100050642
440 Ga0068855_100060730
441 Ga0068855_100622032
442 Ga0070664_100221641
443 Ga0070664_100293906
444 Ga0070664_101156110
445 Ga0070664_101248173
446 Ga0068857_100019132
447 Ga0068857_100265182
448 Ga0068854_100007102
449 Ga0068854_100015332
450 Ga0068854_101298328
451 Ga0068854_101820360
452 Ga0068854_102098033
453 Ga0068856_100142685
454 Ga0068856_100156188
455 Ga0068852_100007274
456 Ga0068852_100394536
457 Ga0068852_100796872
458 Ga0068852_101736097
459 Ga0068852_101774040
460 Ga0068852_102164750
461 Ga0068864_100091107
462 Ga0068861_101375680
463 Ga0068851_10003930
464 Ga0068851_10039142
465 Ga0068863_100574806
466 Ga0097621_100177448
467 Ga0068871_100178930
468 Ga0068865_101213914
469 Ga0105240_10021344
470 Ga0105240_10176345
471 Ga0105240_11432764
472 Ga0105241_10049965
473 Ga0105242_10478970
474 Ga0105248_10021512
475 Ga0105237_10062010
476 Ga0105237_12594822
477 Ga0105238_10156683
478 Ga0157373_10021223
479 Ga0157373_10043456
480 Ga0157373_10054899
481 Ga0157373_10213566
482 Ga0157373_10242518
483 Ga0157373_10553546
484 Ga0157371_10034093
485 Ga0157371_10074252
486 Ga0157371_10281682
487 Ga0157371_10331695
488 Ga0157371_10428636
489 Ga0157371_10436158
490 Ga0157371_10635692
491 Ga0157370_10007112
492 Ga0157370_10066828
493 Ga0157370_10304110
494 Ga0157370_10632856
495 Ga0157369_10030548
496 Ga0157369_10146601
497 Ga0157369_10174457
498 Ga0157369_10523671
499 Ga0157369_10667542
500 Ga0157378_13317965
501 Ga0163162_10307462
502 Ga0157372_10360311
503 Ga0157372_10533382
504 Ga0157372_11616525
505 Ga0157372_11702988
506 Ga0157372_11875355
507 Ga0157372_12220626
508 Ga0157372_12647837
509 Ga0157375_10038050
510 Ga0163163_11798520
511 Ga0157380_12074573
512 Ga0157379_12316869
513 Ga0163161_10035265
514 Ga0206355_1668081
515 Ga0207697_10337606
516 Ga0207656_10157599
517 Ga0207656_10261915
518 Ga0207647_10016577
519 Ga0207647_10025489
520 Ga0207647_10037393
521 Ga0207705_10000169
522 Ga0207705_10008203
523 Ga0207705_10095338
524 Ga0207705_10096552
525 Ga0207705_10108348
526 Ga0207705_10156259
527 Ga0207705_10269145
528 Ga0207705_10346302
529 Ga0207705_10737736
530 Ga0207654_10540411
531 Ga0207707_10272052
532 Ga0207707_10406334
533 Ga0207707_11116085
534 Ga0207695_10020564
535 Ga0207671_10037020
536 Ga0207660_10001169
537 Ga0207660_10196955
538 Ga0207660_10755672
539 Ga0207657_10001497
540 Ga0207657_10029097
541 Ga0207657_10121324
542 Ga0207657_10178287
543 Ga0207657_10607037
544 Ga0207657_10608068
545 Ga0207657_10803018
546 Ga0207649_10005659
547 Ga0207649_11518488
548 Ga0207652_10066362
549 Ga0207652_10132727
550 Ga0207652_10283656
551 Ga0207652_10948414
552 Ga0207652_11286316
553 Ga0207652_11881720
554 Ga0207694_10160550
555 Ga0207650_10108205
556 Ga0207650_10684427
557 Ga0207659_10193001
558 Ga0207664_10030972
559 Ga0207644_10106442
560 Ga0207644_10114706
561 Ga0207690_10003663
562 Ga0207690_10038287
563 Ga0207690_10061932
564 Ga0207690_10113636
565 Ga0207706_10008069
566 Ga0207706_10046977
567 Ga0207706_10268675
568 Ga0207686_10428081
569 Ga0207691_10025059
570 Ga0207711_10278355
571 Ga0207661_10085369
572 Ga0207661_10581704
573 Ga0207661_11742759
574 Ga0207679_10049006
575 Ga0207679_10151360
576 Ga0207679_11535750
577 Ga0207667_10002705
578 Ga0207667_10061714
579 Ga0207667_10572143
580 Ga0207667_10643783
581 Ga0207651_10539448
582 Ga0207712_10440181
583 Ga0207640_10012499
584 Ga0207640_10419145
585 Ga0207640_10991974
586 Ga0207640_11119278
587 Ga0207640_11296375
588 Ga0207639_10075884
589 Ga0207639_10107836
590 Ga0207639_10128051
591 Ga0207639_10442991
592 Ga0207639_11547408
593 Ga0207678_10226829
594 Ga0207678_11298413
595 Ga0207702_10003195
596 Ga0207702_10009212
597 Ga0207702_10271673
598 Ga0207702_10842764
599 Ga0207641_10512308
600 Ga0207641_12214007
601 Ga0207648_11934407
602 Ga0207676_10053638
603 Ga0207676_10302565
604 Ga0207674_10005725
605 Ga0207674_10008283
606 Ga0207674_10014471
607 Ga0207675_101164533
608 Ga0207683_11161811
609 Ga0207698_10063117
610 Ga0207698_10106610
611 Ga0207698_10295892
612 Ga0207698_10879584
613 Ga0207698_12603626
614 Ga0316178_1072229
615 Ga0307408_100177679
616 Ga0307408_101585842
617 Ga0307405_10285058
618 Ga0307405_10666161
619 Ga0307413_10227321
620 Ga0307413_10271850
621 Ga0307413_10653772
622 Ga0307410_10433735
623 Ga0307410_10448796
624 Ga0307406_10044230
625 Ga0307406_10299671
626 Ga0307412_10078884
627 Ga0307412_10222535
628 Ga0307409_100003478
629 Ga0307409_100176280
630 Ga0307409_100393825
631 Ga0307409_101240043
632 Ga0307416_100396250
633 Ga0307414_11807271
634 Ga0307411_10144745
635 Ga0307411_10155642
636 Ga0307415_100223363
637 Ga0307415_100770046
638 Ga0373923_0003869
639 Ga0373955_0107634
640 Ga0373933_0034989
641 Ga0373937_0426743
642 Ga0395899_0018049
643 Ga0395899_0034700
644 Ga0395899_0165803
645 Ga0395899_0186208
646 Ga0395899_0295246
647 Ga0395899_0314949
648 Ga0395899_0399295
649 Ga0395900_0000803
650 Ga0395900_0036528
651 Ga0395900_0147469
652 Ga0395900_0207005
653 Ga0395900_0262630
654 Ga0395900_0262633
655 Ga0395900_0401087
656 Ga0395900_0889385
657 Ga0395900_1014922
658 Ga0395900_1258204
659 Ga0395898_0025366
660 Ga0395898_0045260
661 Ga0395898_0057795
662 Ga0395898_0425385
663 Ga0395898_1802717
664 Ga0395905_0004444
665 Ga0395905_0029985
666 Ga0395905_0096106
667 Ga0395905_0099347
668 Ga0395905_0130443
669 Ga0395905_0197508
670 Ga0395905_0203857
671 Ga0395905_0576565
672 Ga0395905_0899944
673 Ga0395905_1174138
674 Ga0436364_0527735
675 Ga0395901_0001141
676 Ga0395901_0022483
677 Ga0395901_0058425
678 Ga0395901_0076569
679 Ga0395901_0133233
680 Ga0395901_0223948
681 Ga0395901_0274569
682 Ga0395901_0484660
683 Ga0395901_1084321
684 Ga0395901_1201210
685 Ga0395901_1460140
686 Ga0395901_1773165
687 Ga0436365_0145461
688 Ga0436362_0124016
689 Ga0439465_0229841
690 Ga0439464_0102949
691 Ga0466963_0028602
692 Ga0466964_0653569
693 Ga0466959_0444352
694 Ga0466958_0439519
695 Ga0466967_0083834
696 Ga0466967_1688632
697 Ga0495602_0309479
698 Ga0496101_0269030
699 Ga0496102_1668483
700 Ga0496104_0067367
701 Ga0496105_0100233
702 Ga0496107_0037658
703 Ga0496108_0007326
704 Ga0496109_0159701
705 Ga0496110_1332228
706 Ga0496111_0013499
707 Ga0496111_0092071
708 Ga0496112_0475781
709 Ga0496112_0816950
710 Ga0496113_1324865
711 Ga0496114_0120469
712 Ga0496115_0411257
713 Ga0501292_049884
714 Ga0501202_026748
715 Ga0501202_212728
716 Ga0501206_074596
717 Ga0501256_034002
718 Ga0501221_030985
719 Ga0501225_0134250
720 Ga0501270_032081
721 nmdc:mga09592_499734_c1
722 Ga0587090_139590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

51

138

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8737 4 98
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7713 4 98
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7641 1 108
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.6469 2 108
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.6194 1 108
ID Description Score Start End Superfamily
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8925 4 99 2.170.150.70
af_K7MPT9_9_124_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8803 5 116 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8705 4 98 2.170.150.70
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8702 5 111 2.170.150.70
af_K7MPT9_9_124_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8456 5 116 2.170.150.70
ID Description Score Start End GO Terms
AF-A0A2U1G371-F1-model_v4 deleted 0.9477 1 124
AF-A0A7G9SEE4-F1-model_v4 GFA family protein 0.9365 1 123 GO:0016846
GO:0046872
AF-A0A4P9Z3Q6-F1-model_v4 Mss4-like protein 0.9343 1 99 GO:0016846
GO:0046872
AF-A0A433DK08-F1-model_v4 Glutathione-dependent formaldehyde-activating 0.9314 1 110 GO:0016846
GO:0046872
AF-A0A520N2A1-F1-model_v4 GFA family protein 0.9312 1 119 GO:0016846
GO:0046872

Map