F421984

General Info

Members Datasets Scaffolds Average Seq Length
360 206 358 250

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0265633|Ga0496100_0265633_13_924
Length 303
Sequence MTDGDEGGGPEQQXXGDGCDGQPRTIGQRHPASLGIATDSHARVSDLASGGRTGGMMDGMRVALMVTCVNDVMFPDTGRAVVELLTRLGVEVDFPQVQTCCGQPMVNTGYLDEALPAVRTFVSAFEGYDAVVTPSGSCAASARHQHRMVAERADDPGLVGAVTELGPKVHELSVFLVDVLGVTDVGASFPRRVTYHPTCHSLRLLGVGDRPRRLLEAVRGLTLVDLPGAEECCGFGGTFAMKNADVSVAMGADKARHVRETDAEVLVAGDNSCLLHIGGVLSRQRSGVRVMHLAEILASTEGA

Samples

Sample ID Description Type Environment
1 2506783011 Frankia datiscae Dg1 Isolate Nodule
2 2773857933 Frankia sp. BMG5.30 Isolate Nodule
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
105 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
106 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
107 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
115 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
116 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
117 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
118 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
119 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
120 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 0.83
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.78
Nodule 0.56
Rhizoplane 18.89
Rhizosphere 76.94
Stem 0
Stem Tuber 0
Unclassified 0.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10076248 3300002067 Bacteria 960
2 Ga0070658_10010726 3300005327 Bacteria 7342
3 Ga0070683_100001445 3300005329 Bacteria 18257
4 Ga0070683_100167372 3300005329 Bacteria 2086
5 Ga0070680_100165038 3300005336 Bacteria 1862
6 Ga0068868_100073820 3300005338 Bacteria 2724
7 Ga0068868_100125831 3300005338 Bacteria 2094
8 Ga0068868_100407288 3300005338 Bacteria 1175
9 Ga0070660_100042748 3300005339 Bacteria 3460
10 Ga0070660_100223721 3300005339 Bacteria 1530
11 Ga0070691_10046601 3300005341 Bacteria 2060
12 Ga0070659_100154230 3300005366 Bacteria 1875
13 Ga0070667_100045369 3300005367 Bacteria 3695
14 Ga0070667_100106105 3300005367 Bacteria 2432
15 Ga0070709_10156989 3300005434 Bacteria 1578
16 Ga0070714_100245507 3300005435 Bacteria 1654
17 Ga0070705_100347527 3300005440 Bacteria 1080
18 Ga0070678_100372376 3300005456 Bacteria 1233
19 Ga0070662_100216503 3300005457 Bacteria 1526
20 Ga0068867_100327242 3300005459 Bacteria 1272
21 Ga0070679_100000778 3300005530 Bacteria 27739
22 Ga0070679_100128974 3300005530 Bacteria 2510
23 Ga0070679_100908629 3300005530 Bacteria 824
24 Ga0070684_100005022 3300005535 Bacteria 10103
25 Ga0068853_100362179 3300005539 Bacteria 1351
26 Ga0070686_100065284 3300005544 Bacteria 2364
27 Ga0070665_100001385 3300005548 Bacteria 28573
28 Ga0070704_100097847 3300005549 Bacteria 2203
29 Ga0070664_100006459 3300005564 Bacteria 9450
30 Ga0068857_100001052 3300005577 Bacteria 21360
31 Ga0068856_100026900 3300005614 Bacteria 5611
32 Ga0068856_100039128 3300005614 Bacteria 4656
33 Ga0068856_100330438 3300005614 Bacteria 1542
34 Ga0070702_100006466 3300005615 Bacteria 5548
35 Ga0070702_100036973 3300005615 Bacteria 2709
36 Ga0070702_100150298 3300005615 Bacteria 1494
37 Ga0068852_100408113 3300005616 Bacteria 1338
38 Ga0068852_100480963 3300005616 Bacteria 1234
39 Ga0068866_10120903 3300005718 Bacteria 1475
40 Ga0068861_100055283 3300005719 Bacteria 3026
41 Ga0068870_10036837 3300005840 Bacteria 2518
42 Ga0068863_100131964 3300005841 Bacteria 2385
43 Ga0068858_100050640 3300005842 Bacteria 3844
44 Ga0068860_100427398 3300005843 Bacteria 1314
45 Ga0068862_100330203 3300005844 Bacteria 1410
46 Ga0075365_10009691 3300006038 Bacteria 5558
47 Ga0075365_10032319 3300006038 Bacteria 3362
48 Ga0075368_10003313 3300006042 Bacteria 5364
49 Ga0075363_100000053 3300006048 Bacteria 22667
50 Ga0070716_100180601 3300006173 Bacteria 1385
51 Ga0070712_100096320 3300006175 Bacteria 2179
52 Ga0075367_10002805 3300006178 Bacteria 8085
53 Ga0075428_100728122 3300006844 Bacteria 1056
54 Ga0068865_100107785 3300006881 Bacteria 2050
55 Ga0111539_10088653 3300009094 Bacteria 3635
56 Ga0105245_10006078 3300009098 Bacteria 10611
57 Ga0105245_10023170 3300009098 Bacteria 5449
58 Ga0105245_10239062 3300009098 Bacteria 1759
59 Ga0105245_10336330 3300009098 Bacteria 1492
60 Ga0105245_10361044 3300009098 Bacteria 1442
61 Ga0105243_10071553 3300009148 Bacteria 2804
62 Ga0105243_10145024 3300009148 Bacteria 2030
63 Ga0105242_10006464 3300009176 Bacteria 9027
64 Ga0105248_10049376 3300009177 Bacteria 4719
65 Ga0105237_10838037 3300009545 Bacteria 926
66 Ga0105238_10029063 3300009551 Bacteria 5632
67 Ga0105238_10227331 3300009551 Bacteria 1842
68 Ga0105249_10090028 3300009553 Bacteria 2868
69 Ga0105249_10104931 3300009553 Bacteria 2664
70 Ga0105249_10386042 3300009553 Bacteria 1427
71 Ga0105249_10770709 3300009553 Bacteria 1025
72 Ga0105239_10001993 3300010375 Bacteria 26536
73 Ga0105239_10403449 3300010375 Bacteria 1547
74 Ga0105246_10000815 3300011119 Bacteria 17721
75 Ga0105246_11330823 3300011119 Bacteria 667
76 Ga0157371_10576514 3300013102 Bacteria 835
77 Ga0157369_10002826 3300013105 Bacteria 20718
78 Ga0157369_10089148 3300013105 Bacteria 3293
79 Ga0157374_10483740 3300013296 Bacteria 1241
80 Ga0157378_10032796 3300013297 Bacteria 4590
81 Ga0163162_10081704 3300013306 Bacteria 3302
82 Ga0163162_10266555 3300013306 Bacteria 1844
83 Ga0163162_10867827 3300013306 Bacteria 1017
84 Ga0157372_10002613 3300013307 Bacteria 19489
85 Ga0157372_10152184 3300013307 Bacteria 2671
86 Ga0157372_10389899 3300013307 Bacteria 1623
87 Ga0157372_10480331 3300013307 Bacteria 1449
88 Ga0157372_10588920 3300013307 Bacteria 1296
89 Ga0157375_10031147 3300013308 Bacteria 5036
90 Ga0157375_10042393 3300013308 Bacteria 4405
91 Ga0157375_10657052 3300013308 Bacteria 1204
92 Ga0157380_10011186 3300014326 Bacteria 6476
93 Ga0157380_10319777 3300014326 Bacteria 1438
94 Ga0157380_10328589 3300014326 Bacteria 1421
95 Ga0157377_10013156 3300014745 Bacteria 4181
96 Ga0157379_10002412 3300014968 Bacteria 15616
97 Ga0206353_11244890 3300020082 Bacteria 980
98 Ga0206353_11567955 3300020082 Bacteria 1734
99 Ga0224712_10083384 3300022467 Bacteria 1324
100 Ga0207642_10067072 3300025899 Bacteria 1692
101 Ga0207688_10008452 3300025901 Bacteria 5600
102 Ga0207647_10050316 3300025904 Bacteria 2580
103 Ga0207647_10089028 3300025904 Bacteria 1843
104 Ga0207699_10151101 3300025906 Bacteria 1537
105 Ga0207705_10029698 3300025909 Bacteria 3898
106 Ga0207707_10117722 3300025912 Bacteria 2322
107 Ga0207693_10102225 3300025915 Bacteria 2248
108 Ga0207660_10129937 3300025917 Bacteria 1916
109 Ga0207657_10028924 3300025919 Bacteria 5048
110 Ga0207657_10214566 3300025919 Bacteria 1543
111 Ga0207652_10005509 3300025921 Bacteria 10269
112 Ga0207681_10100968 3300025923 Bacteria 2081
113 Ga0207687_10115285 3300025927 Bacteria 2001
114 Ga0207690_10043916 3300025932 Bacteria 2944
115 Ga0207706_10240482 3300025933 Bacteria 1583
116 Ga0207709_10005121 3300025935 Bacteria 7481
117 Ga0207669_10051480 3300025937 Bacteria 2468
118 Ga0207704_10132109 3300025938 Bacteria 1731
119 Ga0207711_10080976 3300025941 Bacteria 2837
120 Ga0207661_10072169 3300025944 Bacteria 2824
121 Ga0207661_10089591 3300025944 Bacteria 2560
122 Ga0207661_10226099 3300025944 Bacteria 1655
123 Ga0207679_10170649 3300025945 Bacteria 1790
124 Ga0207712_10043207 3300025961 Bacteria 3107
125 Ga0207668_10145936 3300025972 Bacteria 1826
126 Ga0207668_10512219 3300025972 Bacteria 1034
127 Ga0207658_10006837 3300025986 Bacteria 7773
128 Ga0207658_10134989 3300025986 Bacteria 1988
129 Ga0207677_10049023 3300026023 Bacteria 2847
130 Ga0207703_10068440 3300026035 Bacteria 2925
131 Ga0207639_10211683 3300026041 Bacteria 1669
132 Ga0207708_10002440 3300026075 Bacteria 13668
133 Ga0207702_10150650 3300026078 Bacteria 2115
134 Ga0207702_10176321 3300026078 Bacteria 1965
135 Ga0207702_10621087 3300026078 Bacteria 1061
136 Ga0207641_10013529 3300026088 Bacteria 6694
137 Ga0207648_10017922 3300026089 Bacteria 6422
138 Ga0207648_10157374 3300026089 Bacteria 2006
139 Ga0207674_10001835 3300026116 Bacteria 27058
140 Ga0207675_100124261 3300026118 Bacteria 2443
141 Ga0207683_10022539 3300026121 Bacteria 5406
142 Ga0207683_10047437 3300026121 Bacteria 3762
143 Ga0207683_10086764 3300026121 Bacteria 2782
144 Ga0209813_10139619 3300027866 Bacteria 859
145 Ga0268266_10002050 3300028379 Bacteria 22345
146 Ga0265338_10236024 3300028800 Bacteria 1357
147 Ga0307511_10014084 3300030521 Bacteria 7787
148 Ga0307509_10117049 3300031507 Bacteria 2652
149 Ga0316579_10013664 3300031691 Bacteria 3495
150 Ga0316576_10034755 3300031727 Bacteria 3594
151 Ga0316576_10050783 3300031727 Bacteria 3016
152 Ga0316576_10091741 3300031727 Bacteria 2263
153 Ga0316576_10294720 3300031727 Bacteria 1213
154 Ga0316578_10033845 3300031728 Bacteria 2930
155 Ga0316578_10127346 3300031728 Bacteria 1531
156 Ga0316577_10018491 3300031733 Bacteria 3855
157 Ga0307410_10224836 3300031852 Bacteria 1446
158 Ga0307410_10266675 3300031852 Bacteria 1338
159 Ga0307406_10465347 3300031901 Bacteria 1018
160 Ga0307409_100055147 3300031995 Bacteria 3067
161 Ga0307416_100170582 3300032002 Bacteria 2025
162 Ga0307416_100675078 3300032002 Bacteria 1120
163 Ga0307411_10193909 3300032005 Bacteria 1554
164 Ga0307415_100072199 3300032126 Bacteria 2430
165 Ga0307415_100161195 3300032126 Bacteria 1739
166 Ga0307415_100471161 3300032126 Bacteria 1091
167 Ga0316583_10024739 3300032133 Bacteria 2144
168 Ga0316585_10005669 3300032137 Bacteria 3532
169 Ga0316585_10006454 3300032137 Bacteria 3354
170 Ga0316580_10001973 3300032139 Bacteria 5539
171 Ga0316580_10006428 3300032139 Bacteria 3471
172 Ga0307507_10000017 3300033179 Bacteria 224506
173 Ga0316574_0019611 3300035398 Bacteria 3991
174 Ga0316574_0078780 3300035398 Bacteria 2089
175 Ga0316582_0021859 3300036647 Bacteria 3788
176 Ga0316582_0055528 3300036647 Bacteria 2524
177 Ga0316584_0054391 3300036712 Bacteria 2995
178 Ga0316584_0071801 3300036712 Bacteria 2594
179 Ga0395900_0021471 3300037418 Bacteria 6601
180 Ga0395898_0018337 3300037466 Bacteria 7137
181 Ga0395905_0053293 3300037471 Bacteria 3786
182 Ga0395905_0113490 3300037471 Bacteria 2546
183 Ga0316581_0004037 3300037588 Bacteria 3709
184 Ga0395901_0021550 3300038443 Bacteria 6602
185 Ga0395901_0042675 3300038443 Bacteria 4703
186 Ga0466969_0017406 3300044656 Bacteria 3751
187 Ga0466972_0074810 3300044658 Bacteria 1614
188 Ga0466965_0097845 3300044683 Bacteria 1498
189 Ga0466966_0023849 3300044684 Bacteria 4004
190 Ga0466966_0069984 3300044684 Bacteria 2200
191 Ga0466961_0028894 3300044693 Bacteria 3565
192 Ga0466961_0085285 3300044693 Bacteria 1997
193 Ga0466961_0115880 3300044693 Bacteria 1684
194 Ga0466963_0045969 3300044694 Bacteria 2877
195 Ga0466964_0007202 3300044706 Bacteria 4161
196 Ga0466971_0010385 3300044719 Bacteria 4067
197 Ga0466971_0083631 3300044719 Bacteria 1457
198 Ga0466970_0055604 3300044765 Bacteria 2113
199 Ga0466957_0133555 3300044842 Bacteria 1593
200 Ga0466957_0146703 3300044842 Bacteria 1523
201 Ga0466957_0316388 3300044842 Bacteria 1052
202 Ga0466960_0014413 3300044901 Bacteria 3383
203 Ga0466960_0052435 3300044901 Bacteria 1974
204 Ga0466959_0054988 3300045049 Bacteria 2907
205 Ga0466959_0175487 3300045049 Bacteria 1501
206 Ga0451576_0242004 3300045051 Bacteria 1885
207 Ga0466958_0031540 3300045836 Bacteria 3150
208 Ga0466958_0173266 3300045836 Bacteria 1367
209 Ga0466958_0215430 3300045836 Bacteria 1224
210 Ga0466967_0005343 3300045976 Bacteria 8877
211 Ga0466967_0087514 3300045976 Bacteria 2824
212 Ga0466967_0097230 3300045976 Bacteria 2687
213 Ga0466967_0150099 3300045976 Bacteria 2177
214 Ga0495592_0159344 3300046454 Bacteria 1554
215 Ga0495603_0047733 3300046455 Bacteria 2549
216 Ga0495603_0153835 3300046455 Bacteria 1335
217 Ga0495629_0299346 3300046459 Bacteria 1102
218 Ga0495653_0030858 3300046463 Bacteria 4265
219 Ga0495664_0215942 3300046477 Bacteria 1161
220 Ga0495594_0122287 3300046499 Bacteria 1472
221 Ga0495608_0278297 3300046511 Bacteria 1039
222 Ga0495618_0048327 3300046514 Bacteria 2685
223 Ga0495628_0026880 3300046516 Bacteria 4684
224 Ga0495652_0002460 3300046529 Bacteria 19044
225 Ga0495645_0177161 3300046543 Bacteria 1463
226 Ga0495634_0344479 3300046642 Bacteria 893
227 Ga0495635_0100604 3300046663 Bacteria 1976
228 Ga0495635_0188074 3300046663 Bacteria 1402
229 Ga0495646_0097555 3300046680 Bacteria 1688
230 Ga0495589_0038411 3300046794 Bacteria 2396
231 Ga0495676_0009647 3300047321 Bacteria 8781
232 Ga0495676_0237382 3300047321 Bacteria 1249
233 Ga0495680_0075310 3300047322 Bacteria 2561
234 Ga0495685_002871 3300047447 Bacteria 5441
235 Ga0496100_0120973 3300048903 Bacteria 1831
236 Ga0496100_0204964 3300048903 Bacteria 1439
237 Ga0496100_0265633 3300048903 Bacteria 1274
238 Ga0496100_0282335 3300048903 Bacteria 1238
239 Ga0496101_0004944 3300048904 Bacteria 8463
240 Ga0496101_0057676 3300048904 Bacteria 2809
241 Ga0496101_0085175 3300048904 Bacteria 2341
242 Ga0496101_0134423 3300048904 Bacteria 1881
243 Ga0496101_0261869 3300048904 Bacteria 1349
244 Ga0496102_0003531 3300048905 Bacteria 13258
245 Ga0496102_0007598 3300048905 Bacteria 9263
246 Ga0496102_0058962 3300048905 Bacteria 3509
247 Ga0496102_0089954 3300048905 Bacteria 2840
248 Ga0496102_0216574 3300048905 Bacteria 1805
249 Ga0496102_0434997 3300048905 Bacteria 1231
250 Ga0496102_0494685 3300048905 Bacteria 1145
251 Ga0496102_0700355 3300048905 Bacteria 936
252 Ga0496103_0092850 3300048906 Bacteria 1905
253 Ga0496103_0124765 3300048906 Bacteria 1641
254 Ga0496103_0231723 3300048906 Bacteria 1188
255 Ga0496104_0001887 3300048907 Bacteria 18156
256 Ga0496104_0207937 3300048907 Bacteria 1869
257 Ga0496104_0232293 3300048907 Bacteria 1756
258 Ga0496105_0001083 3300048908 Bacteria 18870
259 Ga0496105_0004648 3300048908 Bacteria 10349
260 Ga0496105_0090237 3300048908 Bacteria 2531
261 Ga0496105_0171059 3300048908 Bacteria 1781
262 Ga0496105_0269743 3300048908 Bacteria 1375
263 Ga0496106_0018988 3300048909 Bacteria 5095
264 Ga0496106_0113935 3300048909 Bacteria 2108
265 Ga0496106_0375715 3300048909 Bacteria 1142
266 Ga0496107_0006776 3300048910 Bacteria 7885
267 Ga0496107_0009782 3300048910 Bacteria 6650
268 Ga0496107_0087033 3300048910 Bacteria 2281
269 Ga0496107_0120151 3300048910 Bacteria 1935
270 Ga0496108_0006283 3300048911 Bacteria 9629
271 Ga0496108_0068243 3300048911 Bacteria 3000
272 Ga0496108_0101629 3300048911 Bacteria 2453
273 Ga0496108_0360596 3300048911 Bacteria 1269
274 Ga0496108_0394844 3300048911 Bacteria 1208
275 Ga0496108_0433320 3300048911 Bacteria 1148
276 Ga0496108_0580715 3300048911 Bacteria 977
277 Ga0496109_0004303 3300048912 Bacteria 11891
278 Ga0496109_0010244 3300048912 Bacteria 8007
279 Ga0496109_0016425 3300048912 Bacteria 6472
280 Ga0496109_0049170 3300048912 Bacteria 3838
281 Ga0496109_0244787 3300048912 Bacteria 1688
282 Ga0496109_0266383 3300048912 Bacteria 1614
283 Ga0496109_0353338 3300048912 Bacteria 1388
284 Ga0496110_0013541 3300048913 Bacteria 6749
285 Ga0496110_0046762 3300048913 Bacteria 3786
286 Ga0496110_0143162 3300048913 Bacteria 2162
287 Ga0496110_0146749 3300048913 Bacteria 2134
288 Ga0496110_0197688 3300048913 Bacteria 1826
289 Ga0496110_0324178 3300048913 Bacteria 1403
290 Ga0496111_0009167 3300048914 Bacteria 6587
291 Ga0496111_0140891 3300048914 Bacteria 1787
292 Ga0496111_0164630 3300048914 Bacteria 1647
293 Ga0496112_0503037 3300048915 Bacteria 1147
294 Ga0496114_0001400 3300048917 Bacteria 18335
295 Ga0496114_0001878 3300048917 Bacteria 15934
296 Ga0496114_0003849 3300048917 Bacteria 11572
297 Ga0496114_0019338 3300048917 Bacteria 5518
298 Ga0496114_0038571 3300048917 Bacteria 3953
299 Ga0496114_0421094 3300048917 Bacteria 1183
300 Ga0496115_0026579 3300048918 Bacteria 4519
301 Ga0496115_0050446 3300048918 Bacteria 3334
302 Ga0496115_0078561 3300048918 Bacteria 2684
303 Ga0501034_0052800 3300049571 Bacteria 4094
304 Ga0501038_0195890 3300049574 Bacteria 1624
305 Ga0501042_0060051 3300049578 Bacteria 2716
306 Ga0501047_0009968 3300049581 Bacteria 8981
307 Ga0501047_0048961 3300049581 Bacteria 4081
308 Ga0501067_0000281 3300049583 Bacteria 27873
309 Ga0501067_0003200 3300049583 Bacteria 9029
310 Ga0501067_0016252 3300049583 Bacteria 4113
311 Ga0501067_0086897 3300049583 Bacteria 1735
312 Ga0501068_0002654 3300049584 Bacteria 9479
313 Ga0501068_0018232 3300049584 Bacteria 4066
314 Ga0501068_0046956 3300049584 Bacteria 2604
315 Ga0501069_0011295 3300049585 Bacteria 4735
316 Ga0501069_0018624 3300049585 Bacteria 3748
317 Ga0501070_0001910 3300049586 Bacteria 18394
318 Ga0501070_0021067 3300049586 Bacteria 5469
319 Ga0501071_0001378 3300049587 Bacteria 13940
320 Ga0501071_0084900 3300049587 Bacteria 2321
321 Ga0501072_0071737 3300049588 Bacteria 2737
322 Ga0501072_0117294 3300049588 Bacteria 2120
323 Ga0501072_0148107 3300049588 Bacteria 1872
324 Ga0501073_0002579 3300049589 Bacteria 13545
325 Ga0501073_0003388 3300049589 Bacteria 11987
326 Ga0501074_0000114 3300049590 Bacteria 40265
327 Ga0501074_0000753 3300049590 Bacteria 20344
328 Ga0501076_0069820 3300049592 Bacteria 2808
329 Ga0501077_0004109 3300049593 Bacteria 8784
330 Ga0501077_0019112 3300049593 Bacteria 4332
331 Ga0501079_0163439 3300049741 Bacteria 1736
332 Ga0501079_0261184 3300049741 Bacteria 1353
333 Ga0501080_0001132 3300049742 Bacteria 21939
334 Ga0501080_0010201 3300049742 Bacteria 8589
335 Ga0501083_0003296 3300049744 Bacteria 11279
336 Ga0501035_0065447 3300049822 Bacteria 3228
337 Ga0501044_0058689 3300049823 Bacteria 3945
338 Ga0501044_0321786 3300049823 Bacteria 1471
339 Ga0501045_0079644 3300049824 Bacteria 2415
340 Ga0501045_0307444 3300049824 Bacteria 1180
341 Ga0501212_012563 3300049851 Bacteria 1234
342 nmdc:mga03n38_427030_c1 3300050490 Bacteria 734
343 nmdc:mga0yw44_100577_c1 3300050492 Bacteria 1841
344 nmdc:mga06z11_3309_c1 3300050494 Bacteria 6235
345 nmdc:mga04h51_163963_c1 3300050495 Bacteria 857
346 Ga0495601_0040983 3300053077 Bacteria 2901
347 Ga0495612_0018494 3300053078 Bacteria 2790
348 Ga0495595_0019453 3300053084 Bacteria 2946
349 Ga0495619_0155419 3300053085 Bacteria 1578
350 Ga0495619_0286177 3300053085 Bacteria 1142
351 Ga0501084_0186355 3300054114 Bacteria 1751
352 Ga0501082_0103147 3300060353 Bacteria 2467
353 Ga0466962_0033133 3300061719 Bacteria 2471
354 Ga0466962_0043449 3300061719 Bacteria 2150
355 Ga0466962_0098678 3300061719 Bacteria 1402
356 Ga0530510_0139992 3300061734 Bacteria 1783
357 Ga0530510_0178564 3300061734 Bacteria 1574
358 Ga0530510_0247238 3300061734 Bacteria 1329

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300011119 Ga0105246_11330823 Ga0105246_113308231 199
2 3300050490 nmdc:mga03n38_427030_c1 nmdc:mga03n38_427030_c1_11_649 211
3 3300044719 Ga0466971_0083631 Ga0466971_0083631_481_1221 228
4 3300045836 Ga0466958_0173266 Ga0466958_0173266_383_1123 228
5 3300061719 Ga0466962_0098678 Ga0466962_0098678_362_1102 228
6 3300027866 Ga0209813_10139619 Ga0209813_101396191 230
7 3300050495 nmdc:mga04h51_163963_c1 nmdc:mga04h51_163963_c1_29_724 230
8 3300033179 Ga0307507_10000017 Ga0307507_1000001762 232
9 3300005434 Ga0070709_10156989 Ga0070709_101569891 233
10 3300005435 Ga0070714_100245507 Ga0070714_1002455072 233
11 3300006175 Ga0070712_100096320 Ga0070712_1000963202 233
12 3300022467 Ga0224712_10083384 Ga0224712_100833841 233
13 3300025906 Ga0207699_10151101 Ga0207699_101511012 233
14 3300025915 Ga0207693_10102225 Ga0207693_101022252 233
15 3300030521 Ga0307511_10014084 Ga0307511_100140846 233
16 3300031507 Ga0307509_10117049 Ga0307509_101170492 233
17 3300044656 Ga0466969_0017406 Ga0466969_0017406_231_932 233
18 3300046454 Ga0495592_0159344 Ga0495592_0159344_305_1042 233
19 3300046477 Ga0495664_0215942 Ga0495664_0215942_396_1133 233
20 3300046514 Ga0495618_0048327 Ga0495618_0048327_435_1187 233
21 3300046516 Ga0495628_0026880 Ga0495628_0026880_342_1094 233
22 3300046529 Ga0495652_0002460 Ga0495652_0002460_3665_4402 233
23 3300046543 Ga0495645_0177161 Ga0495645_0177161_727_1449 233
24 3300046642 Ga0495634_0344479 Ga0495634_0344479_100_852 233
25 3300046663 Ga0495635_0188074 Ga0495635_0188074_430_1152 233
26 3300046680 Ga0495646_0097555 Ga0495646_0097555_223_960 233
27 3300053077 Ga0495601_0040983 Ga0495601_0040983_1482_2234 233
28 3300053078 Ga0495612_0018494 Ga0495612_0018494_622_1344 233
29 3300053085 Ga0495619_0155419 Ga0495619_0155419_570_1292 233
30 3300044842 Ga0466957_0133555 Ga0466957_0133555_371_1108 235
31 3300044684 Ga0466966_0069984 Ga0466966_0069984_194_922 237
32 3300044693 Ga0466961_0028894 Ga0466961_0028894_291_1019 237
33 3300044719 Ga0466971_0010385 Ga0466971_0010385_2418_3146 237
34 3300045049 Ga0466959_0175487 Ga0466959_0175487_118_846 237
35 3300061719 Ga0466962_0033133 Ga0466962_0033133_968_1696 237
36 3300049588 Ga0501072_0148107 Ga0501072_0148107_1011_1733 240
37 3300049824 Ga0501045_0307444 Ga0501045_0307444_39_761 240
38 3300005339 Ga0070660_100223721 Ga0070660_1002237212 243
39 3300005457 Ga0070662_100216503 Ga0070662_1002165032 243
40 3300005564 Ga0070664_100006459 Ga0070664_1000064594 243
41 3300005616 Ga0068852_100408113 Ga0068852_1004081131 243
42 3300006038 Ga0075365_10032319 Ga0075365_100323192 243
43 3300006042 Ga0075368_10003313 Ga0075368_100033135 243
44 3300006048 Ga0075363_100000053 Ga0075363_10000005320 243
45 3300006178 Ga0075367_10002805 Ga0075367_100028055 243
46 3300009545 Ga0105237_10838037 Ga0105237_108380371 243
47 3300025919 Ga0207657_10214566 Ga0207657_102145662 243
48 3300025933 Ga0207706_10240482 Ga0207706_102404822 243
49 3300025945 Ga0207679_10170649 Ga0207679_101706491 243
50 3300044658 Ga0466972_0074810 Ga0466972_0074810_28_762 243
51 3300044901 Ga0466960_0014413 Ga0466960_0014413_93_827 243
52 3300050494 nmdc:mga06z11_3309_c1 nmdc:mga06z11_3309_c1_3017_3751 243
53 3300005338 Ga0068868_100125831 Ga0068868_1001258312 244
54 3300005338 Ga0068868_100407288 Ga0068868_1004072881 244
55 3300005367 Ga0070667_100045369 Ga0070667_1000453691 244
56 3300005440 Ga0070705_100347527 Ga0070705_1003475272 244
57 3300005456 Ga0070678_100372376 Ga0070678_1003723762 244
58 3300005459 Ga0068867_100327242 Ga0068867_1003272422 244
59 3300005530 Ga0070679_100128974 Ga0070679_1001289741 244
60 3300005544 Ga0070686_100065284 Ga0070686_1000652841 244
61 3300005549 Ga0070704_100097847 Ga0070704_1000978472 244
62 3300005614 Ga0068856_100039128 Ga0068856_1000391284 244
63 3300005614 Ga0068856_100330438 Ga0068856_1003304382 244
64 3300005615 Ga0070702_100006466 Ga0070702_1000064662 244
65 3300005615 Ga0070702_100036973 Ga0070702_1000369733 244
66 3300005615 Ga0070702_100150298 Ga0070702_1001502982 244
67 3300005616 Ga0068852_100480963 Ga0068852_1004809632 244
68 3300005718 Ga0068866_10120903 Ga0068866_101209032 244
69 3300005719 Ga0068861_100055283 Ga0068861_1000552833 244
70 3300005840 Ga0068870_10036837 Ga0068870_100368372 244
71 3300005841 Ga0068863_100131964 Ga0068863_1001319643 244
72 3300005843 Ga0068860_100427398 Ga0068860_1004273982 244
73 3300005844 Ga0068862_100330203 Ga0068862_1003302032 244
74 3300006038 Ga0075365_10009691 Ga0075365_100096913 244
75 3300006173 Ga0070716_100180601 Ga0070716_1001806012 244
76 3300006844 Ga0075428_100728122 Ga0075428_1007281222 244
77 3300009094 Ga0111539_10088653 Ga0111539_100886532 244
78 3300009098 Ga0105245_10023170 Ga0105245_100231704 244
79 3300009098 Ga0105245_10361044 Ga0105245_103610442 244
80 3300009148 Ga0105243_10071553 Ga0105243_100715532 244
81 3300009148 Ga0105243_10145024 Ga0105243_101450242 244
82 3300009176 Ga0105242_10006464 Ga0105242_100064644 244
83 3300009177 Ga0105248_10049376 Ga0105248_100493763 244
84 3300009551 Ga0105238_10029063 Ga0105238_100290633 244
85 3300009551 Ga0105238_10227331 Ga0105238_102273312 244
86 3300009553 Ga0105249_10090028 Ga0105249_100900282 244
87 3300009553 Ga0105249_10386042 Ga0105249_103860422 244
88 3300013102 Ga0157371_10576514 Ga0157371_105765141 244
89 3300013297 Ga0157378_10032796 Ga0157378_100327962 244
90 3300013306 Ga0163162_10081704 Ga0163162_100817042 244
91 3300013306 Ga0163162_10266555 Ga0163162_102665551 244
92 3300013306 Ga0163162_10867827 Ga0163162_108678272 244
93 3300013307 Ga0157372_10152184 Ga0157372_101521842 244
94 3300013307 Ga0157372_10389899 Ga0157372_103898992 244
95 3300013307 Ga0157372_10588920 Ga0157372_105889202 244
96 3300013308 Ga0157375_10031147 Ga0157375_100311472 244
97 3300013308 Ga0157375_10657052 Ga0157375_106570522 244
98 3300014326 Ga0157380_10011186 Ga0157380_100111864 244
99 3300014326 Ga0157380_10319777 Ga0157380_103197772 244
100 3300014326 Ga0157380_10328589 Ga0157380_103285892 244
101 3300014745 Ga0157377_10013156 Ga0157377_100131562 244
102 3300020082 Ga0206353_11244890 Ga0206353_112448902 244
103 3300025899 Ga0207642_10067072 Ga0207642_100670722 244
104 3300025923 Ga0207681_10100968 Ga0207681_101009682 244
105 3300025935 Ga0207709_10005121 Ga0207709_100051214 244
106 3300025937 Ga0207669_10051480 Ga0207669_100514802 244
107 3300025941 Ga0207711_10080976 Ga0207711_100809763 244
108 3300025944 Ga0207661_10072169 Ga0207661_100721692 244
109 3300025944 Ga0207661_10089591 Ga0207661_100895914 244
110 3300025972 Ga0207668_10145936 Ga0207668_101459363 244
111 3300025972 Ga0207668_10512219 Ga0207668_105122192 244
112 3300025986 Ga0207658_10006837 Ga0207658_100068371 244
113 3300026075 Ga0207708_10002440 Ga0207708_100024402 244
114 3300026078 Ga0207702_10150650 Ga0207702_101506503 244
115 3300026088 Ga0207641_10013529 Ga0207641_100135294 244
116 3300026089 Ga0207648_10017922 Ga0207648_100179225 244
117 3300026089 Ga0207648_10157374 Ga0207648_101573742 244
118 3300026118 Ga0207675_100124261 Ga0207675_1001242613 244
119 3300026121 Ga0207683_10022539 Ga0207683_100225392 244
120 3300026121 Ga0207683_10047437 Ga0207683_100474374 244
121 3300028800 Ga0265338_10236024 Ga0265338_102360242 244
122 3300031691 Ga0316579_10013664 Ga0316579_100136642 244
123 3300031727 Ga0316576_10050783 Ga0316576_100507832 244
124 3300031727 Ga0316576_10091741 Ga0316576_100917412 244
125 3300031727 Ga0316576_10294720 Ga0316576_102947202 244
126 3300031728 Ga0316578_10033845 Ga0316578_100338452 244
127 3300031728 Ga0316578_10127346 Ga0316578_101273462 244
128 3300031733 Ga0316577_10018491 Ga0316577_100184913 244
129 3300031852 Ga0307410_10224836 Ga0307410_102248362 244
130 3300031852 Ga0307410_10266675 Ga0307410_102666752 244
131 3300031901 Ga0307406_10465347 Ga0307406_104653472 244
132 3300031995 Ga0307409_100055147 Ga0307409_1000551472 244
133 3300032002 Ga0307416_100170582 Ga0307416_1001705822 244
134 3300032002 Ga0307416_100675078 Ga0307416_1006750782 244
135 3300032126 Ga0307415_100072199 Ga0307415_1000721992 244
136 3300032126 Ga0307415_100471161 Ga0307415_1004711612 244
137 3300032133 Ga0316583_10024739 Ga0316583_100247392 244
138 3300032137 Ga0316585_10006454 Ga0316585_100064541 244
139 3300032139 Ga0316580_10001973 Ga0316580_100019734 244
140 3300032139 Ga0316580_10006428 Ga0316580_100064282 244
141 3300035398 Ga0316574_0019611 Ga0316574_0019611_3015_3767 244
142 3300035398 Ga0316574_0078780 Ga0316574_0078780_840_1592 244
143 3300036647 Ga0316582_0021859 Ga0316582_0021859_1688_2440 244
144 3300036647 Ga0316582_0055528 Ga0316582_0055528_1726_2508 244
145 3300036712 Ga0316584_0054391 Ga0316584_0054391_1142_1894 244
146 3300036712 Ga0316584_0071801 Ga0316584_0071801_1054_1806 244
147 3300037418 Ga0395900_0021471 Ga0395900_0021471_4443_5201 244
148 3300037466 Ga0395898_0018337 Ga0395898_0018337_1003_1761 244
149 3300037471 Ga0395905_0053293 Ga0395905_0053293_909_1667 244
150 3300037471 Ga0395905_0113490 Ga0395905_0113490_1157_1897 244
151 3300038443 Ga0395901_0021550 Ga0395901_0021550_5048_5806 244
152 3300038443 Ga0395901_0042675 Ga0395901_0042675_2319_3059 244
153 3300044683 Ga0466965_0097845 Ga0466965_0097845_744_1481 244
154 3300044693 Ga0466961_0115880 Ga0466961_0115880_85_822 244
155 3300044694 Ga0466963_0045969 Ga0466963_0045969_1813_2550 244
156 3300044842 Ga0466957_0146703 Ga0466957_0146703_183_956 244
157 3300044842 Ga0466957_0316388 Ga0466957_0316388_62_835 244
158 3300045049 Ga0466959_0054988 Ga0466959_0054988_1413_2186 244
159 3300045836 Ga0466958_0031540 Ga0466958_0031540_615_1388 244
160 3300046455 Ga0495603_0153835 Ga0495603_0153835_84_827 244
161 3300046459 Ga0495629_0299346 Ga0495629_0299346_288_1025 244
162 3300046463 Ga0495653_0030858 Ga0495653_0030858_2488_3222 244
163 3300046499 Ga0495594_0122287 Ga0495594_0122287_55_798 244
164 3300046511 Ga0495608_0278297 Ga0495608_0278297_91_915 244
165 3300046663 Ga0495635_0100604 Ga0495635_0100604_979_1713 244
166 3300046794 Ga0495589_0038411 Ga0495589_0038411_1518_2261 244
167 3300047321 Ga0495676_0009647 Ga0495676_0009647_4843_5586 244
168 3300047321 Ga0495676_0237382 Ga0495676_0237382_188_931 244
169 3300047322 Ga0495680_0075310 Ga0495680_0075310_1808_2542 244
170 3300047447 Ga0495685_002871 Ga0495685_002871_4651_5394 244
171 3300048903 Ga0496100_0204964 Ga0496100_0204964_219_971 244
172 3300048903 Ga0496100_0282335 Ga0496100_0282335_228_968 244
173 3300048904 Ga0496101_0085175 Ga0496101_0085175_894_1646 244
174 3300048904 Ga0496101_0261869 Ga0496101_0261869_461_1201 244
175 3300048905 Ga0496102_0003531 Ga0496102_0003531_9716_10468 244
176 3300048905 Ga0496102_0089954 Ga0496102_0089954_216_956 244
177 3300048905 Ga0496102_0216574 Ga0496102_0216574_590_1330 244
178 3300048905 Ga0496102_0494685 Ga0496102_0494685_247_987 244
179 3300048905 Ga0496102_0700355 Ga0496102_0700355_47_913 244
180 3300048906 Ga0496103_0124765 Ga0496103_0124765_886_1626 244
181 3300048907 Ga0496104_0207937 Ga0496104_0207937_417_1154 244
182 3300048907 Ga0496104_0232293 Ga0496104_0232293_428_1183 244
183 3300048908 Ga0496105_0004648 Ga0496105_0004648_4447_5199 244
184 3300048908 Ga0496105_0090237 Ga0496105_0090237_1326_2081 244
185 3300048909 Ga0496106_0375715 Ga0496106_0375715_295_1035 244
186 3300048910 Ga0496107_0120151 Ga0496107_0120151_909_1661 244
187 3300048911 Ga0496108_0068243 Ga0496108_0068243_1322_2188 244
188 3300048911 Ga0496108_0433320 Ga0496108_0433320_228_968 244
189 3300048912 Ga0496109_0010244 Ga0496109_0010244_2049_2834 244
190 3300048912 Ga0496109_0016425 Ga0496109_0016425_1156_2022 244
191 3300048913 Ga0496110_0143162 Ga0496110_0143162_814_1620 244
192 3300048913 Ga0496110_0146749 Ga0496110_0146749_424_1179 244
193 3300048913 Ga0496110_0324178 Ga0496110_0324178_579_1313 244
194 3300048915 Ga0496112_0503037 Ga0496112_0503037_374_1114 244
195 3300048917 Ga0496114_0001400 Ga0496114_0001400_17376_18128 244
196 3300048917 Ga0496114_0001878 Ga0496114_0001878_8028_8765 244
197 3300048917 Ga0496114_0038571 Ga0496114_0038571_2382_3248 244
198 3300048917 Ga0496114_0421094 Ga0496114_0421094_107_868 244
199 3300048918 Ga0496115_0026579 Ga0496115_0026579_1053_1790 244
200 3300049578 Ga0501042_0060051 Ga0501042_0060051_1146_1895 244
201 3300049581 Ga0501047_0009968 Ga0501047_0009968_1636_2400 244
202 3300049583 Ga0501067_0016252 Ga0501067_0016252_979_1752 244
203 3300049583 Ga0501067_0086897 Ga0501067_0086897_955_1692 244
204 3300049584 Ga0501068_0046956 Ga0501068_0046956_1143_1907 244
205 3300049587 Ga0501071_0084900 Ga0501071_0084900_340_1089 244
206 3300049588 Ga0501072_0071737 Ga0501072_0071737_1664_2413 244
207 3300049592 Ga0501076_0069820 Ga0501076_0069820_1553_2302 244
208 3300049822 Ga0501035_0065447 Ga0501035_0065447_119_883 244
209 3300049823 Ga0501044_0058689 Ga0501044_0058689_1112_1876 244
210 3300049824 Ga0501045_0079644 Ga0501045_0079644_827_1576 244
211 3300049851 Ga0501212_012563 Ga0501212_012563_366_1193 244
212 3300053084 Ga0495595_0019453 Ga0495595_0019453_1429_2163 244
213 3300053085 Ga0495619_0286177 Ga0495619_0286177_19_756 244
214 3300061734 Ga0530510_0139992 Ga0530510_0139992_375_1112 244
215 3300061734 Ga0530510_0178564 Ga0530510_0178564_366_1139 244
216 3300061734 Ga0530510_0247238 Ga0530510_0247238_545_1285 244
217 iso_pu_bacteria 2506783011 2506868840 244
218 iso_pu_bacteria 2773857933 2774901738 244
219 3300025904 Ga0207647_10050316 Ga0207647_100503162 245
220 3300005329 Ga0070683_100001445 Ga0070683_10000144518 247
221 3300005338 Ga0068868_100073820 Ga0068868_1000738204 247
222 3300005341 Ga0070691_10046601 Ga0070691_100466012 247
223 3300005366 Ga0070659_100154230 Ga0070659_1001542302 247
224 3300005367 Ga0070667_100106105 Ga0070667_1001061053 247
225 3300005535 Ga0070684_100005022 Ga0070684_1000050222 247
226 3300005548 Ga0070665_100001385 Ga0070665_10000138511 247
227 3300005577 Ga0068857_100001052 Ga0068857_10000105213 247
228 3300005614 Ga0068856_100026900 Ga0068856_1000269007 247
229 3300005842 Ga0068858_100050640 Ga0068858_1000506402 247
230 3300006881 Ga0068865_100107785 Ga0068865_1001077852 247
231 3300009553 Ga0105249_10770709 Ga0105249_107707092 247
232 3300025901 Ga0207688_10008452 Ga0207688_100084524 247
233 3300025909 Ga0207705_10029698 Ga0207705_100296982 247
234 3300025932 Ga0207690_10043916 Ga0207690_100439164 247
235 3300025938 Ga0207704_10132109 Ga0207704_101321092 247
236 3300025961 Ga0207712_10043207 Ga0207712_100432072 247
237 3300025986 Ga0207658_10134989 Ga0207658_101349892 247
238 3300026023 Ga0207677_10049023 Ga0207677_100490232 247
239 3300026035 Ga0207703_10068440 Ga0207703_100684402 247
240 3300026078 Ga0207702_10176321 Ga0207702_101763212 247
241 3300026078 Ga0207702_10621087 Ga0207702_106210872 247
242 3300026116 Ga0207674_10001835 Ga0207674_1000183513 247
243 3300026121 Ga0207683_10086764 Ga0207683_100867642 247
244 3300028379 Ga0268266_10002050 Ga0268266_1000205021 247
245 3300032005 Ga0307411_10193909 Ga0307411_101939092 247
246 3300032126 Ga0307415_100161195 Ga0307415_1001611952 247
247 3300045976 Ga0466967_0097230 Ga0466967_0097230_434_1180 247
248 3300049571 Ga0501034_0052800 Ga0501034_0052800_2179_2925 247
249 3300049574 Ga0501038_0195890 Ga0501038_0195890_800_1546 247
250 3300049581 Ga0501047_0048961 Ga0501047_0048961_168_914 247
251 3300049583 Ga0501067_0000281 Ga0501067_0000281_13003_13749 247
252 3300049583 Ga0501067_0003200 Ga0501067_0003200_6274_7020 247
253 3300049584 Ga0501068_0002654 Ga0501068_0002654_1147_1893 247
254 3300049584 Ga0501068_0018232 Ga0501068_0018232_40_786 247
255 3300049585 Ga0501069_0018624 Ga0501069_0018624_560_1306 247
256 3300049586 Ga0501070_0001910 Ga0501070_0001910_3283_4029 247
257 3300049586 Ga0501070_0021067 Ga0501070_0021067_2326_3072 247
258 3300049587 Ga0501071_0001378 Ga0501071_0001378_12152_12898 247
259 3300049588 Ga0501072_0117294 Ga0501072_0117294_1201_1947 247
260 3300049589 Ga0501073_0002579 Ga0501073_0002579_11474_12220 247
261 3300049589 Ga0501073_0003388 Ga0501073_0003388_5972_6718 247
262 3300049590 Ga0501074_0000114 Ga0501074_0000114_20501_21247 247
263 3300049590 Ga0501074_0000753 Ga0501074_0000753_5110_5856 247
264 3300049593 Ga0501077_0004109 Ga0501077_0004109_4973_5719 247
265 3300049593 Ga0501077_0019112 Ga0501077_0019112_962_1708 247
266 3300049741 Ga0501079_0163439 Ga0501079_0163439_852_1598 247
267 3300049741 Ga0501079_0261184 Ga0501079_0261184_597_1343 247
268 3300049742 Ga0501080_0001132 Ga0501080_0001132_14156_14902 247
269 3300049742 Ga0501080_0010201 Ga0501080_0010201_7006_7752 247
270 3300049744 Ga0501083_0003296 Ga0501083_0003296_4514_5260 247
271 3300049823 Ga0501044_0321786 Ga0501044_0321786_450_1196 247
272 3300054114 Ga0501084_0186355 Ga0501084_0186355_99_845 247
273 3300060353 Ga0501082_0103147 Ga0501082_0103147_1559_2305 247
274 3300002067 JGI24735J21928_10076248 JGI24735J21928_100762482 248
275 3300005327 Ga0070658_10010726 Ga0070658_100107262 248
276 3300005329 Ga0070683_100167372 Ga0070683_1001673722 248
277 3300005336 Ga0070680_100165038 Ga0070680_1001650382 248
278 3300005339 Ga0070660_100042748 Ga0070660_1000427485 248
279 3300005530 Ga0070679_100000778 Ga0070679_10000077819 248
280 3300005530 Ga0070679_100908629 Ga0070679_1009086291 248
281 3300005539 Ga0068853_100362179 Ga0068853_1003621792 248
282 3300009098 Ga0105245_10006078 Ga0105245_100060784 248
283 3300009098 Ga0105245_10239062 Ga0105245_102390622 248
284 3300009098 Ga0105245_10336330 Ga0105245_103363301 248
285 3300009553 Ga0105249_10104931 Ga0105249_101049313 248
286 3300010375 Ga0105239_10001993 Ga0105239_1000199316 248
287 3300010375 Ga0105239_10403449 Ga0105239_104034492 248
288 3300011119 Ga0105246_10000815 Ga0105246_100008157 248
289 3300013105 Ga0157369_10002826 Ga0157369_1000282618 248
290 3300013105 Ga0157369_10089148 Ga0157369_100891482 248
291 3300013296 Ga0157374_10483740 Ga0157374_104837402 248
292 3300013307 Ga0157372_10002613 Ga0157372_1000261314 248
293 3300013307 Ga0157372_10480331 Ga0157372_104803311 248
294 3300013308 Ga0157375_10042393 Ga0157375_100423935 248
295 3300014968 Ga0157379_10002412 Ga0157379_100024124 248
296 3300020082 Ga0206353_11567955 Ga0206353_115679552 248
297 3300025904 Ga0207647_10089028 Ga0207647_100890282 248
298 3300025912 Ga0207707_10117722 Ga0207707_101177222 248
299 3300025917 Ga0207660_10129937 Ga0207660_101299372 248
300 3300025919 Ga0207657_10028924 Ga0207657_100289244 248
301 3300025921 Ga0207652_10005509 Ga0207652_100055092 248
302 3300025927 Ga0207687_10115285 Ga0207687_101152852 248
303 3300025944 Ga0207661_10226099 Ga0207661_102260992 248
304 3300026041 Ga0207639_10211683 Ga0207639_102116832 248
305 3300031727 Ga0316576_10034755 Ga0316576_100347551 248
306 3300032137 Ga0316585_10005669 Ga0316585_100056692 248
307 3300037588 Ga0316581_0004037 Ga0316581_0004037_2424_3224 248
308 3300044684 Ga0466966_0023849 Ga0466966_0023849_1832_2728 248
309 3300044693 Ga0466961_0085285 Ga0466961_0085285_454_1212 248
310 3300044706 Ga0466964_0007202 Ga0466964_0007202_1170_1955 248
311 3300044765 Ga0466970_0055604 Ga0466970_0055604_1314_2072 248
312 3300044901 Ga0466960_0052435 Ga0466960_0052435_827_1585 248
313 3300045051 Ga0451576_0242004 Ga0451576_0242004_880_1626 248
314 3300045836 Ga0466958_0215430 Ga0466958_0215430_147_905 248
315 3300045976 Ga0466967_0005343 Ga0466967_0005343_2819_3577 248
316 3300045976 Ga0466967_0087514 Ga0466967_0087514_1298_2083 248
317 3300045976 Ga0466967_0150099 Ga0466967_0150099_927_1685 248
318 3300046455 Ga0495603_0047733 Ga0495603_0047733_736_1488 248
319 3300048903 Ga0496100_0120973 Ga0496100_0120973_1070_1819 248
320 3300048903 Ga0496100_0265633 Ga0496100_0265633_13_924 248
321 3300048904 Ga0496101_0004944 Ga0496101_0004944_866_1615 248
322 3300048904 Ga0496101_0057676 Ga0496101_0057676_1028_1807 248
323 3300048904 Ga0496101_0134423 Ga0496101_0134423_50_799 248
324 3300048905 Ga0496102_0007598 Ga0496102_0007598_1640_2386 248
325 3300048905 Ga0496102_0058962 Ga0496102_0058962_552_1301 248
326 3300048905 Ga0496102_0434997 Ga0496102_0434997_415_1194 248
327 3300048906 Ga0496103_0092850 Ga0496103_0092850_711_1457 248
328 3300048906 Ga0496103_0231723 Ga0496103_0231723_400_1149 248
329 3300048907 Ga0496104_0001887 Ga0496104_0001887_15998_16747 248
330 3300048908 Ga0496105_0001083 Ga0496105_0001083_1043_1792 248
331 3300048908 Ga0496105_0171059 Ga0496105_0171059_588_1361 248
332 3300048908 Ga0496105_0269743 Ga0496105_0269743_172_951 248
333 3300048909 Ga0496106_0018988 Ga0496106_0018988_1024_1803 248
334 3300048909 Ga0496106_0113935 Ga0496106_0113935_580_1329 248
335 3300048910 Ga0496107_0006776 Ga0496107_0006776_1122_1901 248
336 3300048910 Ga0496107_0009782 Ga0496107_0009782_4269_5018 248
337 3300048910 Ga0496107_0087033 Ga0496107_0087033_449_1195 248
338 3300048911 Ga0496108_0006283 Ga0496108_0006283_3323_4069 248
339 3300048911 Ga0496108_0101629 Ga0496108_0101629_387_1166 248
340 3300048911 Ga0496108_0360596 Ga0496108_0360596_120_869 248
341 3300048911 Ga0496108_0394844 Ga0496108_0394844_363_1136 248
342 3300048911 Ga0496108_0580715 Ga0496108_0580715_192_953 248
343 3300048912 Ga0496109_0004303 Ga0496109_0004303_8894_9640 248
344 3300048912 Ga0496109_0049170 Ga0496109_0049170_1825_2604 248
345 3300048912 Ga0496109_0244787 Ga0496109_0244787_459_1208 248
346 3300048912 Ga0496109_0266383 Ga0496109_0266383_556_1317 248
347 3300048912 Ga0496109_0353338 Ga0496109_0353338_588_1361 248
348 3300048913 Ga0496110_0013541 Ga0496110_0013541_3913_4662 248
349 3300048913 Ga0496110_0046762 Ga0496110_0046762_810_1556 248
350 3300048913 Ga0496110_0197688 Ga0496110_0197688_834_1607 248
351 3300048914 Ga0496111_0009167 Ga0496111_0009167_2817_3563 248
352 3300048914 Ga0496111_0140891 Ga0496111_0140891_196_945 248
353 3300048914 Ga0496111_0164630 Ga0496111_0164630_422_1183 248
354 3300048917 Ga0496114_0003849 Ga0496114_0003849_3966_4715 248
355 3300048917 Ga0496114_0019338 Ga0496114_0019338_4729_5502 248
356 3300048918 Ga0496115_0050446 Ga0496115_0050446_2048_2827 248
357 3300048918 Ga0496115_0078561 Ga0496115_0078561_827_1576 248
358 3300049585 Ga0501069_0011295 Ga0501069_0011295_3824_4573 248
359 3300050492 nmdc:mga0yw44_100577_c1 nmdc:mga0yw44_100577_c1_69_902 248
360 3300061719 Ga0466962_0043449 Ga0466962_0043449_966_1724 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02754

CCG

Cysteine-rich domain

193

278

0.98

PF02754

CCG

Cysteine-rich domain

62

142

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.8012 5 247
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.7914 5 248
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.7834 5 247
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.7775 5 248
7f97-assembly2.cif.gz_D plasmodium falciparum prolyl-trna synthetase (pfprs) in complex with l-proline and compound l97 0.682 5 41
ID Description Score Start End Superfamily
af_P77252_3_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9494 8 83 3.40.30.10
af_P77252_132_217_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9436 139 222 3.40.30.10
af_P52074_170_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.927 8 83 3.40.30.10
af_P77252_132_217_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9127 139 222 3.40.30.10
af_P52074_302_386_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9063 139 222 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3S3QUR2-F1-model_v4 deleted 0.9922 5 178
AF-A0A838G7B0-F1-model_v4 (Fe-S)-binding protein 0.9916 5 246 GO:0005829
GO:0016491
AF-A0A846X8E3-F1-model_v4 (Fe-S)-binding protein 0.9896 5 246 GO:0005829
GO:0016491
AF-A0A2P2CJS7-F1-model_v4 Iron-sulfur oxidase component (EC 1.8.98.-) 0.9895 5 246 GO:0005829
GO:0016491
AF-A0A6G3QMG4-F1-model_v4 (Fe-S)-binding protein 0.9891 119 246 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
92.6 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map