F421968

General Info

Members Datasets Scaffolds Average Seq Length
360 201 720 200

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0258898|Ga0495629_0258898_205_768
Length 187
Sequence MNPTRADALALVHEYTQSESLRKHMLSVETAMRAYAEHYGEDVEKWGVTGLIHDFDYERFPNATQAADQDHPFEGVKILRERGWPEDILEAVLGHAQYSGVPRASRMAKTLFAVDELTGLITATALVRPSRSVLEVDARSVRKKMKDVIEGAADLGVELDAHITFVISAMQRSADVLGLVGTPAAAP

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
139 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
179 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
180 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
181 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
182 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
183 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
184 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
185 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
186 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
187 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
188 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
189 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
190 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
193 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
194 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.61
Rhizosphere 96.39
Stem 0
Stem Tuber 0
Unclassified 11.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0258898 3300046459 Bacteria 1196
2 Ga0065715_10006568 3300005293 Bacteria 7085
3 Ga0065707_10220896 3300005295 Unclassified 1225
4 Ga0070658_10004268 3300005327 Bacteria 11682
5 Ga0070658_10056627 3300005327 Bacteria 3187
6 Ga0070658_10424431 3300005327 Bacteria 1144
7 Ga0070683_100007167 3300005329 Bacteria 9403
8 Ga0070683_100060264 3300005329 Bacteria 3527
9 Ga0070683_100292185 3300005329 Bacteria 1550
10 Ga0070680_100002122 3300005336 Bacteria 14654
11 Ga0070680_100005089 3300005336 Bacteria 9921
12 Ga0070680_100014642 3300005336 Bacteria 6133
13 Ga0070680_100424396 3300005336 Unclassified 1134
14 Ga0070680_100560467 3300005336 Bacteria 979
15 Ga0070682_100001372 3300005337 Bacteria 13759
16 Ga0070682_100001537 3300005337 Bacteria 12940
17 Ga0070682_100079577 3300005337 Bacteria 2117
18 Ga0070682_100258533 3300005337 Bacteria 1259
19 Ga0070682_100550103 3300005337 Bacteria 903
20 Ga0070660_100005681 3300005339 Bacteria 8642
21 Ga0070660_100008489 3300005339 Bacteria 7189
22 Ga0070660_100164543 3300005339 Bacteria 1789
23 Ga0070660_100379461 3300005339 Bacteria 1167
24 Ga0070660_100453030 3300005339 Unclassified 1065
25 Ga0070691_10126156 3300005341 Unclassified 1293
26 Ga0070661_100004122 3300005344 Bacteria 10019
27 Ga0070661_100018376 3300005344 Bacteria 4970
28 Ga0070661_100026870 3300005344 Bacteria 4143
29 Ga0070661_100064859 3300005344 Bacteria 2684
30 Ga0070661_100229216 3300005344 Bacteria 1427
31 Ga0070671_100000509 3300005355 Bacteria 27161
32 Ga0070674_100056456 3300005356 Bacteria 2723
33 Ga0070659_100010163 3300005366 Bacteria 6925
34 Ga0070659_100142627 3300005366 Unclassified 1950
35 Ga0070659_101074049 3300005366 Bacteria 709
36 Ga0070709_10004892 3300005434 Bacteria 7239
37 Ga0070714_100000743 3300005435 Bacteria 23044
38 Ga0070714_100002107 3300005435 Bacteria 14594
39 Ga0070714_100002266 3300005435 Bacteria 14150
40 Ga0070714_100011100 3300005435 Bacteria 7139
41 Ga0070713_100418694 3300005436 Bacteria 1254
42 Ga0070710_10003572 3300005437 Bacteria 7374
43 Ga0070710_10073322 3300005437 Bacteria 1979
44 Ga0070694_100011694 3300005444 Bacteria 5437
45 Ga0070694_100051671 3300005444 Bacteria 2776
46 Ga0070694_100635294 3300005444 Unclassified 863
47 Ga0070663_100070665 3300005455 Bacteria 2539
48 Ga0070678_100223281 3300005456 Bacteria 1567
49 Ga0070678_100789043 3300005456 Unclassified 862
50 Ga0070662_100341717 3300005457 Unclassified 1225
51 Ga0070681_10001785 3300005458 Bacteria 19321
52 Ga0070681_10010783 3300005458 Bacteria 9031
53 Ga0070681_10012048 3300005458 Bacteria 8576
54 Ga0070681_10017131 3300005458 Bacteria 7243
55 Ga0068867_100012425 3300005459 Bacteria 6024
56 Ga0068867_100235790 3300005459 Bacteria 1481
57 Ga0070706_100005823 3300005467 Bacteria 11698
58 Ga0070707_100002297 3300005468 Bacteria 18268
59 Ga0070707_100309052 3300005468 Bacteria 1536
60 Ga0070698_100015220 3300005471 Bacteria 8135
61 Ga0070698_100166840 3300005471 Bacteria 2144
62 Ga0070699_100012145 3300005518 Bacteria 7434
63 Ga0070699_100146155 3300005518 Bacteria 2089
64 Ga0070699_100170700 3300005518 Bacteria 1927
65 Ga0070699_100190538 3300005518 Bacteria 1821
66 Ga0070679_100005228 3300005530 Bacteria 12016
67 Ga0070679_100011054 3300005530 Bacteria 8586
68 Ga0070679_100012514 3300005530 Bacteria 8112
69 Ga0070679_100066706 3300005530 Bacteria 3587
70 Ga0070679_100068687 3300005530 Bacteria 3534
71 Ga0070679_100073454 3300005530 Bacteria 3412
72 Ga0070679_100092143 3300005530 Bacteria 3018
73 Ga0070679_100128736 3300005530 Bacteria 2513
74 Ga0070679_100363891 3300005530 Bacteria 1394
75 Ga0070679_100626523 3300005530 Bacteria 1019
76 Ga0070684_100005126 3300005535 Bacteria 10015
77 Ga0070684_100055199 3300005535 Bacteria 3462
78 Ga0070684_100249567 3300005535 Bacteria 1622
79 Ga0070684_100281369 3300005535 Bacteria 1524
80 Ga0070684_101469321 3300005535 Bacteria 642
81 Ga0070697_100027395 3300005536 Bacteria 4559
82 Ga0070697_100059389 3300005536 Bacteria 3114
83 Ga0070697_100314661 3300005536 Bacteria 1347
84 Ga0068853_100005469 3300005539 Bacteria 9953
85 Ga0068853_100025555 3300005539 Bacteria 4957
86 Ga0070672_100248178 3300005543 Bacteria 1499
87 Ga0070695_100491851 3300005545 Bacteria 947
88 Ga0070696_100135912 3300005546 Unclassified 1792
89 Ga0070696_100261477 3300005546 Bacteria 1312
90 Ga0070665_100056816 3300005548 Bacteria 3924
91 Ga0070704_100016063 3300005549 Bacteria 4721
92 Ga0068855_100061951 3300005563 Bacteria 4369
93 Ga0068855_100339401 3300005563 Bacteria 1657
94 Ga0068855_100611576 3300005563 Bacteria 1174
95 Ga0070664_100002362 3300005564 Bacteria 15158
96 Ga0070664_100072871 3300005564 Unclassified 2946
97 Ga0070664_100483108 3300005564 Bacteria 1140
98 Ga0068857_100021560 3300005577 Bacteria 5669
99 Ga0068854_100027103 3300005578 Bacteria 3946
100 Ga0068856_100109818 3300005614 Bacteria 2755
101 Ga0070702_100023067 3300005615 Bacteria 3301
102 Ga0068852_100006588 3300005616 Bacteria 8410
103 Ga0068852_100023021 3300005616 Bacteria 5007
104 Ga0068852_100053115 3300005616 Bacteria 3486
105 Ga0068859_100051087 3300005617 Bacteria 4155
106 Ga0068859_100413902 3300005617 Bacteria 1444
107 Ga0068866_10537979 3300005718 Bacteria 779
108 Ga0070716_100046793 3300006173 Bacteria 2436
109 Ga0075428_100585608 3300006844 Unclassified 1192
110 Ga0075431_100140012 3300006847 Bacteria 2494
111 Ga0075433_10012739 3300006852 Bacteria 6807
112 Ga0075434_100064151 3300006871 Bacteria 3657
113 Ga0075429_100025775 3300006880 Bacteria 5106
114 Ga0068865_100218762 3300006881 Bacteria 1488
115 Ga0075436_100037354 3300006914 Bacteria 3353
116 Ga0097620_100051088 3300006931 Bacteria 4155
117 Ga0097620_100413903 3300006931 Bacteria 1444
118 Ga0075435_100424201 3300007076 Bacteria 1146
119 Ga0105240_10008795 3300009093 Bacteria 14383
120 Ga0105240_10028874 3300009093 Bacteria 7235
121 Ga0105240_10302010 3300009093 Bacteria 1831
122 Ga0105245_10017648 3300009098 Bacteria 6229
123 Ga0105245_10377429 3300009098 Bacteria 1411
124 Ga0105245_11024964 3300009098 Unclassified 870
125 Ga0114129_10001798 3300009147 Bacteria 29219
126 Ga0114129_10081620 3300009147 Bacteria 4495
127 Ga0114129_10149168 3300009147 Bacteria 3200
128 Ga0105241_10023755 3300009174 Bacteria 4549
129 Ga0105237_10070597 3300009545 Bacteria 3488
130 Ga0105238_10002830 3300009551 Bacteria 17309
131 Ga0105249_10000027 3300009553 Bacteria 231352
132 Ga0105249_10634727 3300009553 Bacteria 1125
133 Ga0105239_10004128 3300010375 Bacteria 17443
134 Ga0157373_10077719 3300013100 Bacteria 2341
135 Ga0157373_10092756 3300013100 Bacteria 2127
136 Ga0157373_10152981 3300013100 Bacteria 1623
137 Ga0157371_10015851 3300013102 Bacteria 5638
138 Ga0157370_10015103 3300013104 Bacteria 7868
139 Ga0157370_10023180 3300013104 Bacteria 6168
140 Ga0157370_10610591 3300013104 Bacteria 998
141 Ga0157369_10059923 3300013105 Bacteria 4105
142 Ga0157369_10174172 3300013105 Bacteria 2266
143 Ga0157369_10228075 3300013105 Bacteria 1948
144 Ga0157378_10025984 3300013297 Bacteria 5160
145 Ga0157372_10018513 3300013307 Bacteria 7488
146 Ga0157372_10022804 3300013307 Bacteria 6777
147 Ga0157372_10028548 3300013307 Bacteria 6089
148 Ga0157372_10031393 3300013307 Bacteria 5817
149 Ga0157372_10074596 3300013307 Bacteria 3826
150 Ga0157372_10097395 3300013307 Bacteria 3355
151 Ga0157372_10442196 3300013307 Bacteria 1515
152 Ga0157372_10597140 3300013307 Bacteria 1287
153 Ga0157372_10930497 3300013307 Unclassified 1008
154 Ga0157375_11103003 3300013308 Bacteria 929
155 Ga0182008_10003042 3300014497 Bacteria 10291
156 Ga0157376_10016381 3300014969 Bacteria 5626
157 Ga0197907_11502575 3300020069 Bacteria 857
158 Ga0206356_11238063 3300020070 Bacteria 1908
159 Ga0206354_10752620 3300020081 Bacteria 3483
160 Ga0207692_10007399 3300025898 Bacteria 4502
161 Ga0207692_10205023 3300025898 Bacteria 1161
162 Ga0207699_10011517 3300025906 Bacteria 4470
163 Ga0207705_10010652 3300025909 Bacteria 6677
164 Ga0207705_10032637 3300025909 Bacteria 3722
165 Ga0207684_10012595 3300025910 Bacteria 7350
166 Ga0207684_10681953 3300025910 Unclassified 874
167 Ga0207707_10005605 3300025912 Bacteria 10984
168 Ga0207707_10006608 3300025912 Bacteria 10118
169 Ga0207707_10007690 3300025912 Bacteria 9387
170 Ga0207707_10017174 3300025912 Bacteria 6306
171 Ga0207707_10024601 3300025912 Bacteria 5271
172 Ga0207707_10061833 3300025912 Bacteria 3259
173 Ga0207707_10109034 3300025912 Bacteria 2420
174 Ga0207707_10245223 3300025912 Bacteria 1557
175 Ga0207707_10396061 3300025912 Bacteria 1186
176 Ga0207695_10015875 3300025913 Bacteria 8847
177 Ga0207695_10022872 3300025913 Bacteria 7081
178 Ga0207660_10002959 3300025917 Bacteria 11110
179 Ga0207660_10008478 3300025917 Bacteria 6651
180 Ga0207660_10011538 3300025917 Bacteria 5758
181 Ga0207660_10193957 3300025917 Bacteria 1583
182 Ga0207660_10315591 3300025917 Bacteria 1247
183 Ga0207660_10571244 3300025917 Unclassified 920
184 Ga0207657_10013864 3300025919 Bacteria 7888
185 Ga0207657_10114579 3300025919 Bacteria 2223
186 Ga0207657_10207845 3300025919 Bacteria 1572
187 Ga0207657_10309563 3300025919 Bacteria 1250
188 Ga0207657_10496106 3300025919 Unclassified 957
189 Ga0207649_10053414 3300025920 Bacteria 2511
190 Ga0207649_10330637 3300025920 Bacteria 1122
191 Ga0207652_10032751 3300025921 Bacteria 4372
192 Ga0207652_10050933 3300025921 Bacteria 3548
193 Ga0207652_10095396 3300025921 Bacteria 2620
194 Ga0207652_10110959 3300025921 Bacteria 2432
195 Ga0207652_10129509 3300025921 Bacteria 2250
196 Ga0207652_10346331 3300025921 Bacteria 1341
197 Ga0207652_10381972 3300025921 Bacteria 1271
198 Ga0207652_10528901 3300025921 Bacteria 1061
199 Ga0207646_10008600 3300025922 Bacteria 10202
200 Ga0207646_10470689 3300025922 Bacteria 1133
201 Ga0207694_10006548 3300025924 Bacteria 8850
202 Ga0207650_10271580 3300025925 Bacteria 1378
203 Ga0207687_10748369 3300025927 Bacteria 832
204 Ga0207700_10237346 3300025928 Bacteria 1553
205 Ga0207664_10036929 3300025929 Bacteria 3778
206 Ga0207664_10043500 3300025929 Bacteria 3513
207 Ga0207664_10064085 3300025929 Bacteria 2938
208 Ga0207644_10008617 3300025931 Bacteria 6671
209 Ga0207690_10022118 3300025932 Bacteria 3951
210 Ga0207690_10124512 3300025932 Unclassified 1877
211 Ga0207706_10139993 3300025933 Bacteria 2128
212 Ga0207706_10435045 3300025933 Bacteria 1136
213 Ga0207706_10678116 3300025933 Bacteria 881
214 Ga0207669_10038210 3300025937 Bacteria 2762
215 Ga0207669_10602373 3300025937 Bacteria 893
216 Ga0207665_10000447 3300025939 Bacteria 28305
217 Ga0207691_10023409 3300025940 Bacteria 5814
218 Ga0207691_10202984 3300025940 Bacteria 1725
219 Ga0207661_10003622 3300025944 Bacteria 10753
220 Ga0207661_10023866 3300025944 Bacteria 4627
221 Ga0207679_10004546 3300025945 Bacteria 8639
222 Ga0207679_11146737 3300025945 Bacteria 713
223 Ga0207667_10017939 3300025949 Bacteria 7954
224 Ga0207667_10096175 3300025949 Bacteria 3056
225 Ga0207667_10230883 3300025949 Bacteria 1895
226 Ga0207667_10519931 3300025949 Bacteria 1206
227 Ga0207667_11023550 3300025949 Bacteria 812
228 Ga0207712_10000175 3300025961 Bacteria 66289
229 Ga0207640_10009530 3300025981 Bacteria 5439
230 Ga0207640_10842957 3300025981 Bacteria 797
231 Ga0207639_10003420 3300026041 Bacteria 10675
232 Ga0207639_10299684 3300026041 Bacteria 1420
233 Ga0207639_10674923 3300026041 Bacteria 957
234 Ga0207678_10022025 3300026067 Bacteria 5584
235 Ga0207678_10158693 3300026067 Bacteria 1931
236 Ga0207708_10552141 3300026075 Unclassified 971
237 Ga0207702_10052409 3300026078 Bacteria 3452
238 Ga0207648_10009339 3300026089 Bacteria 9397
239 Ga0207648_10045098 3300026089 Unclassified 3868
240 Ga0207676_10542812 3300026095 Bacteria 1110
241 Ga0207674_10017901 3300026116 Bacteria 7723
242 Ga0207683_10016698 3300026121 Bacteria 6246
243 Ga0207683_10247374 3300026121 Bacteria 1627
244 Ga0207698_10009726 3300026142 Bacteria 6140
245 Ga0207698_10018535 3300026142 Bacteria 4745
246 Ga0207698_10098738 3300026142 Bacteria 2413
247 Ga0207698_10536972 3300026142 Bacteria 1144
248 Ga0207698_10637885 3300026142 Unclassified 1054
249 Ga0209969_1000728 3300027360 Unclassified 4418
250 Ga0209996_1007052 3300027395 Bacteria 1460
251 Ga0209995_1002012 3300027471 Unclassified 3186
252 Ga0209968_1030016 3300027526 Bacteria 907
253 Ga0209999_1001287 3300027543 Bacteria 4301
254 Ga0209999_1031814 3300027543 Bacteria 980
255 Ga0209966_1000537 3300027695 Bacteria 9624
256 Ga0209998_10001817 3300027717 Bacteria 5052
257 Ga0265331_10107873 3300031250 Bacteria 1278
258 Ga0307408_100131802 3300031548 Bacteria 1951
259 Ga0307408_100360941 3300031548 Unclassified 1236
260 Ga0265314_10045562 3300031711 Bacteria 3100
261 Ga0307405_10051308 3300031731 Bacteria 2559
262 Ga0307405_10174025 3300031731 Bacteria 1538
263 Ga0307413_10283686 3300031824 Unclassified 1247
264 Ga0307413_10884255 3300031824 Bacteria 757
265 Ga0307410_10065563 3300031852 Bacteria 2498
266 Ga0307410_10385845 3300031852 Unclassified 1128
267 Ga0307406_10253378 3300031901 Bacteria 1327
268 Ga0307407_10059564 3300031903 Unclassified 2224
269 Ga0307407_10143493 3300031903 Bacteria 1543
270 Ga0307412_10131867 3300031911 Bacteria 1816
271 Ga0307409_100010236 3300031995 Bacteria 5815
272 Ga0307409_100231498 3300031995 Bacteria 1675
273 Ga0307409_100630265 3300031995 Unclassified 1063
274 Ga0307416_100416034 3300032002 Bacteria 1387
275 Ga0307411_10043031 3300032005 Unclassified 2887
276 Ga0307411_10558111 3300032005 Bacteria 978
277 Ga0373952_0114197 3300035092 Bacteria 726
278 Ga0373941_0147093 3300035115 Bacteria 861
279 Ga0373945_0192506 3300035116 Bacteria 844
280 Ga0373960_0121785 3300035121 Bacteria 866
281 Ga0373961_0054686 3300035241 Bacteria 1194
282 Ga0373961_0149268 3300035241 Bacteria 795
283 Ga0373931_0005966 3300035691 Bacteria 5665
284 Ga0373931_0353840 3300035691 Bacteria 920
285 Ga0395905_0526767 3300037471 Bacteria 1082
286 Ga0439461_0021337 3300041410 Bacteria 1290
287 Ga0439432_014922 3300042006 Bacteria 2626
288 Ga0439434_0008523 3300042435 Bacteria 3008
289 Ga0451577_0000001 3300042876 Bacteria 2461803
290 Ga0466966_0011050 3300044684 Bacteria 5994
291 Ga0466961_0110359 3300044693 Bacteria 1731
292 Ga0453684_0358427 3300044712 Bacteria 1642
293 Ga0466959_0074930 3300045049 Bacteria 2446
294 Ga0466967_0062939 3300045976 Bacteria 3295
295 Ga0495592_0126685 3300046454 Bacteria 1791
296 Ga0495580_0462784 3300046472 Unclassified 850
297 Ga0495639_0062738 3300046475 Bacteria 1705
298 Ga0495594_0104564 3300046499 Bacteria 1594
299 Ga0495640_0384948 3300046533 Unclassified 863
300 Ga0495586_0163463 3300046535 Unclassified 1256
301 Ga0495645_0071676 3300046543 Bacteria 2498
302 Ga0495667_0236445 3300046559 Bacteria 1164
303 Ga0495588_0218693 3300046674 Bacteria 1006
304 Ga0495588_0289037 3300046674 Bacteria 864
305 Ga0495599_0036335 3300046678 Bacteria 3093
306 Ga0495669_0200713 3300046684 Bacteria 953
307 Ga0495600_0028201 3300046809 Bacteria 3632
308 Ga0495581_0046939 3300047315 Bacteria 2496
309 Ga0495684_0518904 3300047471 Unclassified 816
310 Ga0496101_0088810 3300048904 Bacteria 2296
311 Ga0496102_0001968 3300048905 Bacteria 17728
312 Ga0496103_0003862 3300048906 Bacteria 9117
313 Ga0496105_0006931 3300048908 Bacteria 8727
314 Ga0496106_0068371 3300048909 Bacteria 2709
315 Ga0496108_0010795 3300048911 Bacteria 7414
316 Ga0496109_0000845 3300048912 Bacteria 25624
317 Ga0496111_0012435 3300048914 Bacteria 5762
318 Ga0496112_0008604 3300048915 Bacteria 9146
319 Ga0496112_0036657 3300048915 Bacteria 4784
320 Ga0496113_0016362 3300048916 Bacteria 5122
321 Ga0496113_0297199 3300048916 Bacteria 1293
322 Ga0496115_0098538 3300048918 Bacteria 2394
323 Ga0501298_006643 3300049521 Bacteria 1897
324 Ga0501034_0110651 3300049571 Bacteria 2738
325 Ga0501037_0134842 3300049573 Bacteria 1769
326 Ga0501043_0117963 3300049579 Bacteria 2082
327 Ga0501046_0187707 3300049580 Bacteria 1543
328 Ga0501047_0013125 3300049581 Bacteria 7847
329 Ga0501047_0023281 3300049581 Bacteria 5948
330 Ga0501217_003541 3300049661 Bacteria 3160
331 Ga0501224_019867 3300049664 Unclassified 1000
332 Ga0501227_065933 3300049665 Unclassified 934
333 Ga0501235_014341 3300049669 Unclassified 1747
334 Ga0501247_006658 3300049677 Unclassified 1312
335 Ga0501249_004755 3300049679 Bacteria 2766
336 Ga0501251_003422 3300049681 Unclassified 1585
337 Ga0501252_001848 3300049682 Bacteria 2032
338 Ga0501258_003922 3300049687 Unclassified 1386
339 Ga0501259_003344 3300049688 Bacteria 2563
340 Ga0501221_000156 3300049704 Bacteria 9177
341 Ga0501225_0065795 3300049705 Unclassified 1024
342 Ga0501234_025338 3300049707 Unclassified 951
343 Ga0501080_0037058 3300049742 Bacteria 4553
344 Ga0501266_033670 3300049763 Unclassified 740
345 Ga0501270_028548 3300049767 Bacteria 905
346 Ga0501274_000184 3300049771 Bacteria 3941
347 Ga0501035_0288418 3300049822 Bacteria 1386
348 nmdc:mga05p37_15652_c1 3300050507 Bacteria 9117
349 nmdc:mga05p37_35727_c1 3300050507 Bacteria 6094
350 nmdc:mga05p37_409853_c1 3300050507 Bacteria 1580
351 nmdc:mga09592_23328_c1 3300050508 Bacteria 5110
352 nmdc:mga0n895_354750_c1 3300050512 Bacteria 1485
353 nmdc:mga0n895_62502_c1 3300050512 Bacteria 3681
354 nmdc:mga0n895_71826_c1 3300050512 Bacteria 3433
355 nmdc:mga0rr50_172700_c1 3300050513 Bacteria 1762
356 nmdc:mga0rr50_53004_c1 3300050513 Bacteria 3016
357 nmdc:mga08x19_15643_c1 3300050514 Bacteria 4617
358 nmdc:mga08x19_2560_c1 3300050514 Bacteria 11051
359 nmdc:mga08x19_30320_c1 3300050514 Bacteria 3397
360 nmdc:mga0a205_254787_c1 3300050515 Bacteria 1634
361 Ga0495629_0258898
362 Ga0065715_10006568
363 Ga0065707_10220896
364 Ga0070658_10004268
365 Ga0070658_10056627
366 Ga0070658_10424431
367 Ga0070683_100007167
368 Ga0070683_100060264
369 Ga0070683_100292185
370 Ga0070680_100002122
371 Ga0070680_100005089
372 Ga0070680_100014642
373 Ga0070680_100424396
374 Ga0070680_100560467
375 Ga0070682_100001372
376 Ga0070682_100001537
377 Ga0070682_100079577
378 Ga0070682_100258533
379 Ga0070682_100550103
380 Ga0070660_100005681
381 Ga0070660_100008489
382 Ga0070660_100164543
383 Ga0070660_100379461
384 Ga0070660_100453030
385 Ga0070691_10126156
386 Ga0070661_100004122
387 Ga0070661_100018376
388 Ga0070661_100026870
389 Ga0070661_100064859
390 Ga0070661_100229216
391 Ga0070671_100000509
392 Ga0070674_100056456
393 Ga0070659_100010163
394 Ga0070659_100142627
395 Ga0070659_101074049
396 Ga0070709_10004892
397 Ga0070714_100000743
398 Ga0070714_100002107
399 Ga0070714_100002266
400 Ga0070714_100011100
401 Ga0070713_100418694
402 Ga0070710_10003572
403 Ga0070710_10073322
404 Ga0070694_100011694
405 Ga0070694_100051671
406 Ga0070694_100635294
407 Ga0070663_100070665
408 Ga0070678_100223281
409 Ga0070678_100789043
410 Ga0070662_100341717
411 Ga0070681_10001785
412 Ga0070681_10010783
413 Ga0070681_10012048
414 Ga0070681_10017131
415 Ga0068867_100012425
416 Ga0068867_100235790
417 Ga0070706_100005823
418 Ga0070707_100002297
419 Ga0070707_100309052
420 Ga0070698_100015220
421 Ga0070698_100166840
422 Ga0070699_100012145
423 Ga0070699_100146155
424 Ga0070699_100170700
425 Ga0070699_100190538
426 Ga0070679_100005228
427 Ga0070679_100011054
428 Ga0070679_100012514
429 Ga0070679_100066706
430 Ga0070679_100068687
431 Ga0070679_100073454
432 Ga0070679_100092143
433 Ga0070679_100128736
434 Ga0070679_100363891
435 Ga0070679_100626523
436 Ga0070684_100005126
437 Ga0070684_100055199
438 Ga0070684_100249567
439 Ga0070684_100281369
440 Ga0070684_101469321
441 Ga0070697_100027395
442 Ga0070697_100059389
443 Ga0070697_100314661
444 Ga0068853_100005469
445 Ga0068853_100025555
446 Ga0070672_100248178
447 Ga0070695_100491851
448 Ga0070696_100135912
449 Ga0070696_100261477
450 Ga0070665_100056816
451 Ga0070704_100016063
452 Ga0068855_100061951
453 Ga0068855_100339401
454 Ga0068855_100611576
455 Ga0070664_100002362
456 Ga0070664_100072871
457 Ga0070664_100483108
458 Ga0068857_100021560
459 Ga0068854_100027103
460 Ga0068856_100109818
461 Ga0070702_100023067
462 Ga0068852_100006588
463 Ga0068852_100023021
464 Ga0068852_100053115
465 Ga0068859_100051087
466 Ga0068859_100413902
467 Ga0068866_10537979
468 Ga0070716_100046793
469 Ga0075428_100585608
470 Ga0075431_100140012
471 Ga0075433_10012739
472 Ga0075434_100064151
473 Ga0075429_100025775
474 Ga0068865_100218762
475 Ga0075436_100037354
476 Ga0097620_100051088
477 Ga0097620_100413903
478 Ga0075435_100424201
479 Ga0105240_10008795
480 Ga0105240_10028874
481 Ga0105240_10302010
482 Ga0105245_10017648
483 Ga0105245_10377429
484 Ga0105245_11024964
485 Ga0114129_10001798
486 Ga0114129_10081620
487 Ga0114129_10149168
488 Ga0105241_10023755
489 Ga0105237_10070597
490 Ga0105238_10002830
491 Ga0105249_10000027
492 Ga0105249_10634727
493 Ga0105239_10004128
494 Ga0157373_10077719
495 Ga0157373_10092756
496 Ga0157373_10152981
497 Ga0157371_10015851
498 Ga0157370_10015103
499 Ga0157370_10023180
500 Ga0157370_10610591
501 Ga0157369_10059923
502 Ga0157369_10174172
503 Ga0157369_10228075
504 Ga0157378_10025984
505 Ga0157372_10018513
506 Ga0157372_10022804
507 Ga0157372_10028548
508 Ga0157372_10031393
509 Ga0157372_10074596
510 Ga0157372_10097395
511 Ga0157372_10442196
512 Ga0157372_10597140
513 Ga0157372_10930497
514 Ga0157375_11103003
515 Ga0182008_10003042
516 Ga0157376_10016381
517 Ga0197907_11502575
518 Ga0206356_11238063
519 Ga0206354_10752620
520 Ga0207692_10007399
521 Ga0207692_10205023
522 Ga0207699_10011517
523 Ga0207705_10010652
524 Ga0207705_10032637
525 Ga0207684_10012595
526 Ga0207684_10681953
527 Ga0207707_10005605
528 Ga0207707_10006608
529 Ga0207707_10007690
530 Ga0207707_10017174
531 Ga0207707_10024601
532 Ga0207707_10061833
533 Ga0207707_10109034
534 Ga0207707_10245223
535 Ga0207707_10396061
536 Ga0207695_10015875
537 Ga0207695_10022872
538 Ga0207660_10002959
539 Ga0207660_10008478
540 Ga0207660_10011538
541 Ga0207660_10193957
542 Ga0207660_10315591
543 Ga0207660_10571244
544 Ga0207657_10013864
545 Ga0207657_10114579
546 Ga0207657_10207845
547 Ga0207657_10309563
548 Ga0207657_10496106
549 Ga0207649_10053414
550 Ga0207649_10330637
551 Ga0207652_10032751
552 Ga0207652_10050933
553 Ga0207652_10095396
554 Ga0207652_10110959
555 Ga0207652_10129509
556 Ga0207652_10346331
557 Ga0207652_10381972
558 Ga0207652_10528901
559 Ga0207646_10008600
560 Ga0207646_10470689
561 Ga0207694_10006548
562 Ga0207650_10271580
563 Ga0207687_10748369
564 Ga0207700_10237346
565 Ga0207664_10036929
566 Ga0207664_10043500
567 Ga0207664_10064085
568 Ga0207644_10008617
569 Ga0207690_10022118
570 Ga0207690_10124512
571 Ga0207706_10139993
572 Ga0207706_10435045
573 Ga0207706_10678116
574 Ga0207669_10038210
575 Ga0207669_10602373
576 Ga0207665_10000447
577 Ga0207691_10023409
578 Ga0207691_10202984
579 Ga0207661_10003622
580 Ga0207661_10023866
581 Ga0207679_10004546
582 Ga0207679_11146737
583 Ga0207667_10017939
584 Ga0207667_10096175
585 Ga0207667_10230883
586 Ga0207667_10519931
587 Ga0207667_11023550
588 Ga0207712_10000175
589 Ga0207640_10009530
590 Ga0207640_10842957
591 Ga0207639_10003420
592 Ga0207639_10299684
593 Ga0207639_10674923
594 Ga0207678_10022025
595 Ga0207678_10158693
596 Ga0207708_10552141
597 Ga0207702_10052409
598 Ga0207648_10009339
599 Ga0207648_10045098
600 Ga0207676_10542812
601 Ga0207674_10017901
602 Ga0207683_10016698
603 Ga0207683_10247374
604 Ga0207698_10009726
605 Ga0207698_10018535
606 Ga0207698_10098738
607 Ga0207698_10536972
608 Ga0207698_10637885
609 Ga0209969_1000728
610 Ga0209996_1007052
611 Ga0209995_1002012
612 Ga0209968_1030016
613 Ga0209999_1001287
614 Ga0209999_1031814
615 Ga0209966_1000537
616 Ga0209998_10001817
617 Ga0265331_10107873
618 Ga0307408_100131802
619 Ga0307408_100360941
620 Ga0265314_10045562
621 Ga0307405_10051308
622 Ga0307405_10174025
623 Ga0307413_10283686
624 Ga0307413_10884255
625 Ga0307410_10065563
626 Ga0307410_10385845
627 Ga0307406_10253378
628 Ga0307407_10059564
629 Ga0307407_10143493
630 Ga0307412_10131867
631 Ga0307409_100010236
632 Ga0307409_100231498
633 Ga0307409_100630265
634 Ga0307416_100416034
635 Ga0307411_10043031
636 Ga0307411_10558111
637 Ga0373952_0114197
638 Ga0373941_0147093
639 Ga0373945_0192506
640 Ga0373960_0121785
641 Ga0373961_0054686
642 Ga0373961_0149268
643 Ga0373931_0005966
644 Ga0373931_0353840
645 Ga0395905_0526767
646 Ga0439461_0021337
647 Ga0439432_014922
648 Ga0439434_0008523
649 Ga0451577_0000001
650 Ga0466966_0011050
651 Ga0466961_0110359
652 Ga0453684_0358427
653 Ga0466959_0074930
654 Ga0466967_0062939
655 Ga0495592_0126685
656 Ga0495580_0462784
657 Ga0495639_0062738
658 Ga0495594_0104564
659 Ga0495640_0384948
660 Ga0495586_0163463
661 Ga0495645_0071676
662 Ga0495667_0236445
663 Ga0495588_0218693
664 Ga0495588_0289037
665 Ga0495599_0036335
666 Ga0495669_0200713
667 Ga0495600_0028201
668 Ga0495581_0046939
669 Ga0495684_0518904
670 Ga0496101_0088810
671 Ga0496102_0001968
672 Ga0496103_0003862
673 Ga0496105_0006931
674 Ga0496106_0068371
675 Ga0496108_0010795
676 Ga0496109_0000845
677 Ga0496111_0012435
678 Ga0496112_0008604
679 Ga0496112_0036657
680 Ga0496113_0016362
681 Ga0496113_0297199
682 Ga0496115_0098538
683 Ga0501298_006643
684 Ga0501034_0110651
685 Ga0501037_0134842
686 Ga0501043_0117963
687 Ga0501046_0187707
688 Ga0501047_0013125
689 Ga0501047_0023281
690 Ga0501217_003541
691 Ga0501224_019867
692 Ga0501227_065933
693 Ga0501235_014341
694 Ga0501247_006658
695 Ga0501249_004755
696 Ga0501251_003422
697 Ga0501252_001848
698 Ga0501258_003922
699 Ga0501259_003344
700 Ga0501221_000156
701 Ga0501225_0065795
702 Ga0501234_025338
703 Ga0501080_0037058
704 Ga0501266_033670
705 Ga0501270_028548
706 Ga0501274_000184
707 Ga0501035_0288418
708 nmdc:mga05p37_15652_c1
709 nmdc:mga05p37_35727_c1
710 nmdc:mga05p37_409853_c1
711 nmdc:mga09592_23328_c1
712 nmdc:mga0n895_354750_c1
713 nmdc:mga0n895_62502_c1
714 nmdc:mga0n895_71826_c1
715 nmdc:mga0rr50_172700_c1
716 nmdc:mga0rr50_53004_c1
717 nmdc:mga08x19_15643_c1
718 nmdc:mga08x19_2560_c1
719 nmdc:mga08x19_30320_c1
720 nmdc:mga0a205_254787_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

21

120

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yse-assembly1.cif.gz_C crystal structure of e. coli heterotetrameric glyrs in complex with trna 0.5536 9 191
4s1c-assembly3.cif.gz_D-2 crystal structure of l. monocytogenes phosphodiesterase pgph hd domain 0.5445 11 185
3p3q-assembly3.cif.gz_A crystal structure of mmoq response regulator from methylococcus capsulatus str. bath at the resolution 2.4a, northeast structural genomics consortium target mcr175m 0.5377 15 165
4s1b-assembly3.cif.gz_A crystal structure of l. monocytogenes phosphodiesterase pgph hd domain in complex with cyclic-di-amp 0.5354 10 185
2o08-assembly1.cif.gz_B crystal structure of a putative hd superfamily hydrolase (bh1327) from bacillus halodurans at 1.90 a resolution 0.5244 5 183
ID Description Score Start End Superfamily
af_Q58188_1_153_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6395 9 151 1.10.3210.10
af_Q2FZ08_320_474_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6147 11 154 1.10.3210.10
af_Q58188_1_153_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5979 9 151 1.10.3210.10
2pjqD01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.5751 6 95 1.10.472.50
2pjqD01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.5602 6 95 1.10.472.50
ID Description Score Start End GO Terms
AF-A0A354C5T0-F1-model_v4 HD domain-containing protein 0.9985 6 59
AF-A0A2V7IHX2-F1-model_v4 HAD family hydrolase 0.9958 6 195 GO:0016787
AF-A0A1Q6WNY3-F1-model_v4 HAD family hydrolase 0.9952 25 194 GO:0016787
AF-A0A7W0GXW9-F1-model_v4 HAD family hydrolase 0.9932 105 195
AF-A0A7W0GWB1-F1-model_v4 HDIG domain-containing protein 0.9916 6 112

Map