F421880

General Info

Members Datasets Scaffolds Average Seq Length
360 189 720 419

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10150523|Ga0157375_101505233
Length 435
Sequence MSVYERHTLSNGLRVVTAPLEHAQSVACYIMLAAGSRYESPANRGIAHFAEHMFFKGTERRPSARDLSMEVDKIGGEFNAFTSKEYTGYYIRCAGEKRDTALDVLVDMLRNSKFDTEELEREKGVILEEMNMYYDTPRDHVGSVYEELIFGSNPLGWETLGTRETIKAATRETFMNYLDEWYTPPRMVVGVAGMVGEDLLPKLEELLGDMSGNGGGSPAPAELPHSTEPQVGLHRKESDQANICVGVPSYALTHPDRYALQMLGTVLGTGMSSRLFLEVREQRGLAYYVYALNSSYTDAGTLVSQAGVDLHRADEAVRVIAHEFHRLAEERVPDDELEKSRALAKGRFVLQTESPNGLMLFGLRREVLEGRAAEPEELLAGIDAVTAEDVQRVAQDIIGSNGMRVAVIGPFDDESRSAPRWRAELELVNLVRTGP

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
63 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
66 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
75 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
90 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
91 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
116 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
185 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 1.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.11
Rhizosphere 88.61
Stem 0
Stem Tuber 0
Unclassified 3.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10150523 3300013308 Bacteria 2462
2 JGI25407J50210_10001363 3300003373 Bacteria 5527
3 Ga0070658_10003997 3300005327 Bacteria 12087
4 Ga0070658_10128773 3300005327 Bacteria 2108
5 Ga0070683_100027433 3300005329 Bacteria 5136
6 Ga0070683_100027790 3300005329 Bacteria 5105
7 Ga0070683_100081421 3300005329 Archaea 3031
8 Ga0070683_100172707 3300005329 Bacteria 2052
9 Ga0070683_100178159 3300005329 Bacteria 2018
10 Ga0070680_100002454 3300005336 Bacteria 13746
11 Ga0070660_100005117 3300005339 Bacteria 9057
12 Ga0070660_100005410 3300005339 Bacteria 8840
13 Ga0070661_100020278 3300005344 Bacteria 4738
14 Ga0070661_100023765 3300005344 Bacteria 4396
15 Ga0070659_100004651 3300005366 Bacteria 9804
16 Ga0070713_100146483 3300005436 Bacteria 2097
17 Ga0070681_10014602 3300005458 Bacteria 7815
18 Ga0070681_10021806 3300005458 Bacteria 6423
19 Ga0070681_10076145 3300005458 Bacteria 3314
20 Ga0070681_10126917 3300005458 Bacteria 2484
21 Ga0070699_100145859 3300005518 Bacteria 2091
22 Ga0070679_100004023 3300005530 Bacteria 13548
23 Ga0070679_100037853 3300005530 Bacteria 4793
24 Ga0070679_100057102 3300005530 Bacteria 3890
25 Ga0070684_100001780 3300005535 Bacteria 15732
26 Ga0070684_100116945 3300005535 Bacteria 2395
27 Ga0070684_100186268 3300005535 Bacteria 1888
28 Ga0068853_100090817 3300005539 Unclassified 2685
29 Ga0070696_100015369 3300005546 Bacteria 5141
30 Ga0070665_100008828 3300005548 Bacteria 10204
31 Ga0068855_100026961 3300005563 Bacteria 6875
32 Ga0068855_100033063 3300005563 Bacteria 6174
33 Ga0068857_100010310 3300005577 Bacteria 8117
34 Ga0068857_100142011 3300005577 Bacteria 2171
35 Ga0068856_100089393 3300005614 Archaea 3063
36 Ga0068851_10117681 3300005834 Bacteria 1425
37 Ga0081455_10010388 3300005937 Bacteria 9459
38 Ga0081455_10017765 3300005937 Bacteria 6804
39 Ga0081455_10019553 3300005937 Bacteria 6403
40 Ga0081455_10046197 3300005937 Bacteria 3781
41 Ga0081455_10065022 3300005937 Bacteria 3052
42 Ga0081538_10000144 3300005981 Bacteria 73787
43 Ga0081538_10000846 3300005981 Bacteria 33031
44 Ga0081538_10002830 3300005981 Bacteria 16602
45 Ga0081538_10013832 3300005981 Bacteria 6366
46 Ga0075433_10099666 3300006852 Bacteria 2572
47 Ga0075434_100097447 3300006871 Bacteria 2946
48 Ga0075435_100067743 3300007076 Bacteria 2907
49 Ga0075435_100116538 3300007076 Bacteria 2226
50 Ga0105240_10022408 3300009093 Bacteria 8374
51 Ga0105240_10024799 3300009093 Bacteria 7897
52 Ga0105240_10073124 3300009093 Bacteria 4234
53 Ga0105240_10284586 3300009093 Bacteria 1898
54 Ga0111539_10018905 3300009094 Bacteria 8522
55 Ga0105245_10113435 3300009098 Bacteria 2524
56 Ga0105248_10105279 3300009177 Bacteria 3180
57 Ga0105248_10325292 3300009177 Bacteria 1732
58 Ga0105237_10022957 3300009545 Bacteria 6398
59 Ga0105238_10082873 3300009551 Bacteria 3197
60 Ga0157370_10009683 3300013104 Bacteria 10248
61 Ga0157370_10080554 3300013104 Bacteria 3065
62 Ga0157369_10003497 3300013105 Bacteria 18655
63 Ga0157369_10036809 3300013105 Bacteria 5360
64 Ga0157369_10092028 3300013105 Bacteria 3236
65 Ga0157369_10179591 3300013105 Archaea 2227
66 Ga0157372_10237566 3300013307 Unclassified 2114
67 Ga0157379_10281721 3300014968 Bacteria 1513
68 Ga0197907_10236494 3300020069 Bacteria 1539
69 Ga0197907_10415367 3300020069 Archaea 1926
70 Ga0206351_10629098 3300020077 Bacteria 1106
71 Ga0206354_10920346 3300020081 Bacteria 6385
72 Ga0206353_10815333 3300020082 Bacteria 10780
73 Ga0206353_11449795 3300020082 Bacteria 6437
74 Ga0213876_10018725 3300021384 Bacteria 3657
75 Ga0207705_10071026 3300025909 Unclassified 2523
76 Ga0207707_10001354 3300025912 Bacteria 22790
77 Ga0207707_10006587 3300025912 Bacteria 10132
78 Ga0207707_10013582 3300025912 Bacteria 7100
79 Ga0207707_10029791 3300025912 Bacteria 4774
80 Ga0207707_10103109 3300025912 Bacteria 2494
81 Ga0207707_10222126 3300025912 Bacteria 1644
82 Ga0207695_10175921 3300025913 Archaea 2063
83 Ga0207695_10235375 3300025913 Bacteria 1734
84 Ga0207671_10045172 3300025914 Bacteria 3257
85 Ga0207693_10040730 3300025915 Bacteria 3659
86 Ga0207660_10004499 3300025917 Bacteria 9091
87 Ga0207657_10000150 3300025919 Bacteria 70716
88 Ga0207657_10000184 3300025919 Bacteria 64813
89 Ga0207657_10002804 3300025919 Bacteria 18753
90 Ga0207649_10025080 3300025920 Bacteria 3472
91 Ga0207649_10027713 3300025920 Bacteria 3328
92 Ga0207649_10118908 3300025920 Bacteria 1778
93 Ga0207652_10003340 3300025921 Bacteria 13271
94 Ga0207652_10020970 3300025921 Bacteria 5389
95 Ga0207652_10188719 3300025921 Bacteria 1853
96 Ga0207694_10035395 3300025924 Bacteria 3830
97 Ga0207687_10243690 3300025927 Bacteria 1426
98 Ga0207700_10077359 3300025928 Bacteria 2584
99 Ga0207664_10106949 3300025929 Bacteria 2320
100 Ga0207690_10026006 3300025932 Unclassified 3684
101 Ga0207690_10163726 3300025932 Unclassified 1660
102 Ga0207661_10060350 3300025944 Archaea 3059
103 Ga0207661_10109165 3300025944 Unclassified 2337
104 Ga0207667_10033529 3300025949 Bacteria 5520
105 Ga0207667_10122174 3300025949 Bacteria 2683
106 Ga0207667_10164087 3300025949 Bacteria 2284
107 Ga0207667_10178175 3300025949 Unclassified 2183
108 Ga0207667_10208510 3300025949 Unclassified 2003
109 Ga0207678_10107773 3300026067 Bacteria 2377
110 Ga0207702_10208486 3300026078 Bacteria 1816
111 Ga0207698_10115140 3300026142 Bacteria 2263
112 Ga0207698_10158393 3300026142 Bacteria 1976
113 Ga0207428_10096712 3300027907 Bacteria 2286
114 Ga0268266_10119789 3300028379 Bacteria 2341
115 Ga0265326_10016441 3300028558 Bacteria 2138
116 Ga0265319_1032301 3300028563 Bacteria 1816
117 Ga0265319_1043372 3300028563 Bacteria 1511
118 Ga0265338_10012521 3300028800 Bacteria 9664
119 Ga0265330_10016980 3300031235 Bacteria 3356
120 Ga0265330_10025898 3300031235 Bacteria 2657
121 Ga0265328_10016085 3300031239 Bacteria 2917
122 Ga0265339_10034388 3300031249 Bacteria 2848
123 Ga0265331_10033463 3300031250 Bacteria 2541
124 Ga0265327_10008657 3300031251 Bacteria 7533
125 Ga0265316_10019191 3300031344 Bacteria 5854
126 Ga0265313_10007589 3300031595 Bacteria 7367
127 Ga0265314_10006567 3300031711 Bacteria 10254
128 Ga0265342_10035854 3300031712 Bacteria 3032
129 Ga0373944_0001726 3300035089 Bacteria 5522
130 Ga0373936_0003132 3300035113 Bacteria 6193
131 Ga0373945_0024448 3300035116 Bacteria 2093
132 Ga0373943_0001289 3300035170 Bacteria 11242
133 Ga0373943_0077116 3300035170 Bacteria 1701
134 Ga0373946_0010789 3300035171 Bacteria 3393
135 Ga0373955_0017219 3300035172 Bacteria 3572
136 Ga0373924_0065738 3300035410 Bacteria 1523
137 Ga0373947_0010258 3300035725 Bacteria 5377
138 Ga0373947_0013551 3300035725 Bacteria 4672
139 Ga0373937_0078386 3300036401 Bacteria 3053
140 Ga0373925_0001472 3300037068 Bacteria 20286
141 Ga0373925_0001570 3300037068 Bacteria 19317
142 Ga0373925_0104688 3300037068 Bacteria 2179
143 Ga0395899_0009667 3300037312 Bacteria 7401
144 Ga0395899_0018028 3300037312 Bacteria 5372
145 Ga0395899_0026852 3300037312 Bacteria 4343
146 Ga0395899_0046508 3300037312 Bacteria 3233
147 Ga0395899_0065279 3300037312 Bacteria 2675
148 Ga0395900_0003882 3300037418 Bacteria 15973
149 Ga0395900_0007286 3300037418 Bacteria 11447
150 Ga0395900_0023449 3300037418 Bacteria 6316
151 Ga0395900_0066300 3300037418 Bacteria 3710
152 Ga0395900_0074000 3300037418 Bacteria 3503
153 Ga0395900_0115393 3300037418 Unclassified 2755
154 Ga0395900_0234291 3300037418 Bacteria 1845
155 Ga0395898_0002274 3300037466 Bacteria 23201
156 Ga0395898_0003505 3300037466 Bacteria 17509
157 Ga0395898_0005031 3300037466 Bacteria 14336
158 Ga0395898_0076706 3300037466 Bacteria 3227
159 Ga0395898_0190405 3300037466 Bacteria 1960
160 Ga0395905_0013559 3300037471 Bacteria 7809
161 Ga0395905_0025056 3300037471 Bacteria 5626
162 Ga0395905_0032865 3300037471 Bacteria 4877
163 Ga0395905_0043200 3300037471 Bacteria 4229
164 Ga0395905_0064555 3300037471 Bacteria 3426
165 Ga0395905_0154935 3300037471 Bacteria 2155
166 Ga0395901_0001441 3300038443 Bacteria 24821
167 Ga0395901_0002561 3300038443 Bacteria 18423
168 Ga0395901_0010581 3300038443 Bacteria 9347
169 Ga0395901_0016319 3300038443 Bacteria 7564
170 Ga0395901_0042298 3300038443 Bacteria 4723
171 Ga0395901_0042867 3300038443 Bacteria 4693
172 Ga0395901_0045895 3300038443 Bacteria 4536
173 Ga0395901_0073925 3300038443 Bacteria 3556
174 Ga0395901_0074374 3300038443 Bacteria 3544
175 Ga0395901_0174431 3300038443 Bacteria 2255
176 Ga0395901_0197826 3300038443 Bacteria 2107
177 Ga0395901_0367633 3300038443 Bacteria 1482
178 Ga0439466_0016944 3300041411 Bacteria 2629
179 Ga0450888_001132 3300042126 Bacteria 2541
180 Ga0439444_0007302 3300042437 Bacteria 1694
181 Ga0466965_0104358 3300044683 Bacteria 1452
182 Ga0466966_0072931 3300044684 Bacteria 2148
183 Ga0466961_0007695 3300044693 Bacteria 6861
184 Ga0466961_0030156 3300044693 Bacteria 3486
185 Ga0466963_0000694 3300044694 Bacteria 16387
186 Ga0466963_0005870 3300044694 Bacteria 7235
187 Ga0466963_0023051 3300044694 Bacteria 3948
188 Ga0466963_0054139 3300044694 Bacteria 2666
189 Ga0466963_0100422 3300044694 Bacteria 1980
190 Ga0466963_0120468 3300044694 Bacteria 1805
191 Ga0466964_0009234 3300044706 Bacteria 3709
192 Ga0466971_0000533 3300044719 Bacteria 15074
193 Ga0466971_0019621 3300044719 Bacteria 3004
194 Ga0466957_0019838 3300044842 Bacteria 3957
195 Ga0466959_0015362 3300045049 Bacteria 5576
196 Ga0466959_0141325 3300045049 Bacteria 1701
197 Ga0466958_0000693 3300045836 Bacteria 14666
198 Ga0466958_0051439 3300045836 Bacteria 2494
199 Ga0466958_0115659 3300045836 Bacteria 1676
200 Ga0466967_0007603 3300045976 Bacteria 7837
201 Ga0466967_0028694 3300045976 Bacteria 4649
202 Ga0466967_0051225 3300045976 Bacteria 3617
203 Ga0466967_0129995 3300045976 Bacteria 2336
204 Ga0466967_0344446 3300045976 Unclassified 1442
205 Ga0495592_0071555 3300046454 Bacteria 2524
206 Ga0495592_0121599 3300046454 Bacteria 1836
207 Ga0495629_0004194 3300046459 Bacteria 10821
208 Ga0495629_0033150 3300046459 Bacteria 3655
209 Ga0495629_0100858 3300046459 Bacteria 2014
210 Ga0495641_0000799 3300046461 Bacteria 26716
211 Ga0495651_0022919 3300046462 Bacteria 4856
212 Ga0495651_0044165 3300046462 Bacteria 3454
213 Ga0495651_0128890 3300046462 Bacteria 1849
214 Ga0495653_0018170 3300046463 Bacteria 5715
215 Ga0495653_0145691 3300046463 Bacteria 1660
216 Ga0495582_0000108 3300046473 Bacteria 43115
217 Ga0495582_0058324 3300046473 Bacteria 2129
218 Ga0495639_0074062 3300046475 Bacteria 1577
219 Ga0495639_0081132 3300046475 Bacteria 1511
220 Ga0495662_0002285 3300046476 Bacteria 9659
221 Ga0495662_0084223 3300046476 Bacteria 1547
222 Ga0495594_0043152 3300046499 Bacteria 2471
223 Ga0495608_0010865 3300046511 Bacteria 6346
224 Ga0495618_0079986 3300046514 Bacteria 2085
225 Ga0495628_0061695 3300046516 Unclassified 2940
226 Ga0495628_0090228 3300046516 Bacteria 2373
227 Ga0495628_0150999 3300046516 Bacteria 1770
228 Ga0495630_0004425 3300046517 Bacteria 9858
229 Ga0495630_0019726 3300046517 Bacteria 4960
230 Ga0495630_0022796 3300046517 Bacteria 4625
231 Ga0495637_0037357 3300046520 Bacteria 2109
232 Ga0495663_0013996 3300046525 Bacteria 2246
233 Ga0495652_0119783 3300046529 Bacteria 2101
234 Ga0495665_0003428 3300046531 Bacteria 8609
235 Ga0495640_0016699 3300046533 Bacteria 5490
236 Ga0495640_0021523 3300046533 Bacteria 4730
237 Ga0495640_0192983 3300046533 Bacteria 1294
238 Ga0495586_0027796 3300046535 Bacteria 3027
239 Ga0495587_0065518 3300046536 Bacteria 2121
240 Ga0495667_0011757 3300046559 Bacteria 5929
241 Ga0495667_0103014 3300046559 Bacteria 1846
242 Ga0495634_0029913 3300046642 Bacteria 3766
243 Ga0495634_0047691 3300046642 Bacteria 2885
244 Ga0495634_0198510 3300046642 Bacteria 1247
245 Ga0495635_0027234 3300046663 Bacteria 3976
246 Ga0495635_0061225 3300046663 Bacteria 2586
247 Ga0495635_0079414 3300046663 Bacteria 2245
248 Ga0495657_0167961 3300046675 Unclassified 1353
249 Ga0495599_0067568 3300046678 Bacteria 2232
250 Ga0495599_0141506 3300046678 Bacteria 1492
251 Ga0495623_0048500 3300046679 Bacteria 2693
252 Ga0495646_0035240 3300046680 Bacteria 3105
253 Ga0495658_0000132 3300046683 Bacteria 41217
254 Ga0495658_0016073 3300046683 Bacteria 3850
255 Ga0495669_0035118 3300046684 Bacteria 2213
256 Ga0495613_0061973 3300046689 Bacteria 2738
257 Ga0495613_0253556 3300046689 Bacteria 1227
258 Ga0495624_0016278 3300046690 Bacteria 5007
259 Ga0495600_0070881 3300046809 Bacteria 2278
260 Ga0495600_0071654 3300046809 Bacteria 2264
261 Ga0495581_0002525 3300047315 Bacteria 10383
262 Ga0495581_0078477 3300047315 Bacteria 1911
263 Ga0495581_0188407 3300047315 Bacteria 1206
264 Ga0495604_0011373 3300047317 Bacteria 7063
265 Ga0495674_0001965 3300047319 Bacteria 20247
266 Ga0495674_0081988 3300047319 Bacteria 2766
267 Ga0495674_0298053 3300047319 Bacteria 1317
268 Ga0495676_0000313 3300047321 Bacteria 39431
269 Ga0495676_0062519 3300047321 Bacteria 2906
270 Ga0495676_0118126 3300047321 Bacteria 1934
271 Ga0495680_0001277 3300047322 Bacteria 27465
272 Ga0495680_0074733 3300047322 Bacteria 2573
273 Ga0495680_0083545 3300047322 Bacteria 2407
274 Ga0495675_0141147 3300047444 Bacteria 1493
275 Ga0495684_0006639 3300047471 Bacteria 8972
276 Ga0495684_0025317 3300047471 Bacteria 4562
277 Ga0495684_0068693 3300047471 Bacteria 2694
278 Ga0495593_0001711 3300047673 Bacteria 12985
279 Ga0495602_0071028 3300048088 Bacteria 2975
280 Ga0495602_0201626 3300048088 Bacteria 1517
281 Ga0496100_0001055 3300048903 Bacteria 13288
282 Ga0496100_0056191 3300048903 Bacteria 2574
283 Ga0496101_0006784 3300048904 Bacteria 7383
284 Ga0496101_0018944 3300048904 Bacteria 4689
285 Ga0496101_0022583 3300048904 Bacteria 4333
286 Ga0496101_0023794 3300048904 Bacteria 4235
287 Ga0496102_0004720 3300048905 Bacteria 11537
288 Ga0496103_0014033 3300048906 Bacteria 4756
289 Ga0496103_0044005 3300048906 Bacteria 2750
290 Ga0496103_0050727 3300048906 Bacteria 2567
291 Ga0496104_0005229 3300048907 Bacteria 11353
292 Ga0496104_0020664 3300048907 Bacteria 6038
293 Ga0496105_0000406 3300048908 Bacteria 28366
294 Ga0496105_0000889 3300048908 Bacteria 20439
295 Ga0496105_0006181 3300048908 Bacteria 9183
296 Ga0496105_0086916 3300048908 Bacteria 2584
297 Ga0496105_0154647 3300048908 Bacteria 1884
298 Ga0496106_0000263 3300048909 Bacteria 36905
299 Ga0496107_0000712 3300048910 Bacteria 18973
300 Ga0496107_0023622 3300048910 Bacteria 4347
301 Ga0496107_0030612 3300048910 Bacteria 3836
302 Ga0496108_0007285 3300048911 Bacteria 8969
303 Ga0496108_0132356 3300048911 Bacteria 2143
304 Ga0496109_0001107 3300048912 Bacteria 22340
305 Ga0496109_0019473 3300048912 Bacteria 5988
306 Ga0496109_0303757 3300048912 Bacteria 1505
307 Ga0496110_0001849 3300048913 Bacteria 15623
308 Ga0496111_0032855 3300048914 Bacteria 3700
309 Ga0496111_0089533 3300048914 Bacteria 2254
310 Ga0496112_0025591 3300048915 Bacteria 5667
311 Ga0496112_0055125 3300048915 Bacteria 3907
312 Ga0496113_0011248 3300048916 Bacteria 5960
313 Ga0496114_0000444 3300048917 Bacteria 30383
314 Ga0496114_0018037 3300048917 Bacteria 5702
315 Ga0496114_0030258 3300048917 Bacteria 4454
316 Ga0496114_0042105 3300048917 Bacteria 3784
317 Ga0496115_0000415 3300048918 Bacteria 34771
318 Ga0496115_0002152 3300048918 Bacteria 14088
319 Ga0496115_0020168 3300048918 Bacteria 5139
320 Ga0496115_0036195 3300048918 Bacteria 3907
321 Ga0501032_0003470 3300049569 Bacteria 12075
322 Ga0501034_0187237 3300049571 Bacteria 2033
323 Ga0501037_0056677 3300049573 Bacteria 2861
324 Ga0501038_0003547 3300049574 Bacteria 14523
325 Ga0501039_0106890 3300049575 Bacteria 2185
326 Ga0501040_0029264 3300049576 Bacteria 3717
327 Ga0501046_0067985 3300049580 Bacteria 2774
328 Ga0501047_0038397 3300049581 Bacteria 4633
329 Ga0501067_0007172 3300049583 Bacteria 6192
330 Ga0501068_0001136 3300049584 Bacteria 14097
331 Ga0501069_0036785 3300049585 Bacteria 2700
332 Ga0501070_0000104 3300049586 Bacteria 74572
333 Ga0501070_0020812 3300049586 Bacteria 5503
334 Ga0501074_0009845 3300049590 Bacteria 6943
335 Ga0501079_0179379 3300049741 Bacteria 1652
336 Ga0501080_0069633 3300049742 Bacteria 3272
337 Ga0501081_0147150 3300049743 Archaea 1691
338 Ga0501083_0010154 3300049744 Bacteria 6635
339 Ga0501035_0004076 3300049822 Bacteria 13891
340 Ga0501044_0115488 3300049823 Bacteria 2690
341 Ga0501045_0084725 3300049824 Bacteria 2338
342 nmdc:mga0qj67_152216_c1 3300050509 Bacteria 1877
343 nmdc:mga08y16_180624_c1 3300050511 Bacteria 2191
344 nmdc:mga0n895_255047_c1 3300050512 Bacteria 1780
345 nmdc:mga0rr50_103707_c1 3300050513 Bacteria 2239
346 nmdc:mga0rr50_69353_c1 3300050513 Bacteria 2683
347 Ga0495601_0061273 3300053077 Bacteria 2388
348 Ga0495612_0077014 3300053078 Bacteria 1397
349 Ga0495595_0008187 3300053084 Bacteria 4290
350 Ga0495595_0082502 3300053084 Bacteria 1533
351 Ga0495619_0008738 3300053085 Bacteria 6405
352 Ga0495619_0008766 3300053085 Bacteria 6394
353 Ga0495619_0036245 3300053085 Bacteria 3211
354 Ga0495619_0066048 3300053085 Bacteria 2414
355 Ga0495619_0151001 3300053085 Bacteria 1602
356 Ga0495619_0157000 3300053085 Unclassified 1570
357 Ga0501084_0100809 3300054114 Bacteria 2424
358 Ga0466962_0047772 3300061719 Bacteria 2045
359 Ga0466962_0101436 3300061719 Bacteria 1382
360 Ga0530510_0014794 3300061734 Bacteria 5510
361 Ga0157375_10150523
362 JGI25407J50210_10001363
363 Ga0070658_10003997
364 Ga0070658_10128773
365 Ga0070683_100027433
366 Ga0070683_100027790
367 Ga0070683_100081421
368 Ga0070683_100172707
369 Ga0070683_100178159
370 Ga0070680_100002454
371 Ga0070660_100005117
372 Ga0070660_100005410
373 Ga0070661_100020278
374 Ga0070661_100023765
375 Ga0070659_100004651
376 Ga0070713_100146483
377 Ga0070681_10014602
378 Ga0070681_10021806
379 Ga0070681_10076145
380 Ga0070681_10126917
381 Ga0070699_100145859
382 Ga0070679_100004023
383 Ga0070679_100037853
384 Ga0070679_100057102
385 Ga0070684_100001780
386 Ga0070684_100116945
387 Ga0070684_100186268
388 Ga0068853_100090817
389 Ga0070696_100015369
390 Ga0070665_100008828
391 Ga0068855_100026961
392 Ga0068855_100033063
393 Ga0068857_100010310
394 Ga0068857_100142011
395 Ga0068856_100089393
396 Ga0068851_10117681
397 Ga0081455_10010388
398 Ga0081455_10017765
399 Ga0081455_10019553
400 Ga0081455_10046197
401 Ga0081455_10065022
402 Ga0081538_10000144
403 Ga0081538_10000846
404 Ga0081538_10002830
405 Ga0081538_10013832
406 Ga0075433_10099666
407 Ga0075434_100097447
408 Ga0075435_100067743
409 Ga0075435_100116538
410 Ga0105240_10022408
411 Ga0105240_10024799
412 Ga0105240_10073124
413 Ga0105240_10284586
414 Ga0111539_10018905
415 Ga0105245_10113435
416 Ga0105248_10105279
417 Ga0105248_10325292
418 Ga0105237_10022957
419 Ga0105238_10082873
420 Ga0157370_10009683
421 Ga0157370_10080554
422 Ga0157369_10003497
423 Ga0157369_10036809
424 Ga0157369_10092028
425 Ga0157369_10179591
426 Ga0157372_10237566
427 Ga0157379_10281721
428 Ga0197907_10236494
429 Ga0197907_10415367
430 Ga0206351_10629098
431 Ga0206354_10920346
432 Ga0206353_10815333
433 Ga0206353_11449795
434 Ga0213876_10018725
435 Ga0207705_10071026
436 Ga0207707_10001354
437 Ga0207707_10006587
438 Ga0207707_10013582
439 Ga0207707_10029791
440 Ga0207707_10103109
441 Ga0207707_10222126
442 Ga0207695_10175921
443 Ga0207695_10235375
444 Ga0207671_10045172
445 Ga0207693_10040730
446 Ga0207660_10004499
447 Ga0207657_10000150
448 Ga0207657_10000184
449 Ga0207657_10002804
450 Ga0207649_10025080
451 Ga0207649_10027713
452 Ga0207649_10118908
453 Ga0207652_10003340
454 Ga0207652_10020970
455 Ga0207652_10188719
456 Ga0207694_10035395
457 Ga0207687_10243690
458 Ga0207700_10077359
459 Ga0207664_10106949
460 Ga0207690_10026006
461 Ga0207690_10163726
462 Ga0207661_10060350
463 Ga0207661_10109165
464 Ga0207667_10033529
465 Ga0207667_10122174
466 Ga0207667_10164087
467 Ga0207667_10178175
468 Ga0207667_10208510
469 Ga0207678_10107773
470 Ga0207702_10208486
471 Ga0207698_10115140
472 Ga0207698_10158393
473 Ga0207428_10096712
474 Ga0268266_10119789
475 Ga0265326_10016441
476 Ga0265319_1032301
477 Ga0265319_1043372
478 Ga0265338_10012521
479 Ga0265330_10016980
480 Ga0265330_10025898
481 Ga0265328_10016085
482 Ga0265339_10034388
483 Ga0265331_10033463
484 Ga0265327_10008657
485 Ga0265316_10019191
486 Ga0265313_10007589
487 Ga0265314_10006567
488 Ga0265342_10035854
489 Ga0373944_0001726
490 Ga0373936_0003132
491 Ga0373945_0024448
492 Ga0373943_0001289
493 Ga0373943_0077116
494 Ga0373946_0010789
495 Ga0373955_0017219
496 Ga0373924_0065738
497 Ga0373947_0010258
498 Ga0373947_0013551
499 Ga0373937_0078386
500 Ga0373925_0001472
501 Ga0373925_0001570
502 Ga0373925_0104688
503 Ga0395899_0009667
504 Ga0395899_0018028
505 Ga0395899_0026852
506 Ga0395899_0046508
507 Ga0395899_0065279
508 Ga0395900_0003882
509 Ga0395900_0007286
510 Ga0395900_0023449
511 Ga0395900_0066300
512 Ga0395900_0074000
513 Ga0395900_0115393
514 Ga0395900_0234291
515 Ga0395898_0002274
516 Ga0395898_0003505
517 Ga0395898_0005031
518 Ga0395898_0076706
519 Ga0395898_0190405
520 Ga0395905_0013559
521 Ga0395905_0025056
522 Ga0395905_0032865
523 Ga0395905_0043200
524 Ga0395905_0064555
525 Ga0395905_0154935
526 Ga0395901_0001441
527 Ga0395901_0002561
528 Ga0395901_0010581
529 Ga0395901_0016319
530 Ga0395901_0042298
531 Ga0395901_0042867
532 Ga0395901_0045895
533 Ga0395901_0073925
534 Ga0395901_0074374
535 Ga0395901_0174431
536 Ga0395901_0197826
537 Ga0395901_0367633
538 Ga0439466_0016944
539 Ga0450888_001132
540 Ga0439444_0007302
541 Ga0466965_0104358
542 Ga0466966_0072931
543 Ga0466961_0007695
544 Ga0466961_0030156
545 Ga0466963_0000694
546 Ga0466963_0005870
547 Ga0466963_0023051
548 Ga0466963_0054139
549 Ga0466963_0100422
550 Ga0466963_0120468
551 Ga0466964_0009234
552 Ga0466971_0000533
553 Ga0466971_0019621
554 Ga0466957_0019838
555 Ga0466959_0015362
556 Ga0466959_0141325
557 Ga0466958_0000693
558 Ga0466958_0051439
559 Ga0466958_0115659
560 Ga0466967_0007603
561 Ga0466967_0028694
562 Ga0466967_0051225
563 Ga0466967_0129995
564 Ga0466967_0344446
565 Ga0495592_0071555
566 Ga0495592_0121599
567 Ga0495629_0004194
568 Ga0495629_0033150
569 Ga0495629_0100858
570 Ga0495641_0000799
571 Ga0495651_0022919
572 Ga0495651_0044165
573 Ga0495651_0128890
574 Ga0495653_0018170
575 Ga0495653_0145691
576 Ga0495582_0000108
577 Ga0495582_0058324
578 Ga0495639_0074062
579 Ga0495639_0081132
580 Ga0495662_0002285
581 Ga0495662_0084223
582 Ga0495594_0043152
583 Ga0495608_0010865
584 Ga0495618_0079986
585 Ga0495628_0061695
586 Ga0495628_0090228
587 Ga0495628_0150999
588 Ga0495630_0004425
589 Ga0495630_0019726
590 Ga0495630_0022796
591 Ga0495637_0037357
592 Ga0495663_0013996
593 Ga0495652_0119783
594 Ga0495665_0003428
595 Ga0495640_0016699
596 Ga0495640_0021523
597 Ga0495640_0192983
598 Ga0495586_0027796
599 Ga0495587_0065518
600 Ga0495667_0011757
601 Ga0495667_0103014
602 Ga0495634_0029913
603 Ga0495634_0047691
604 Ga0495634_0198510
605 Ga0495635_0027234
606 Ga0495635_0061225
607 Ga0495635_0079414
608 Ga0495657_0167961
609 Ga0495599_0067568
610 Ga0495599_0141506
611 Ga0495623_0048500
612 Ga0495646_0035240
613 Ga0495658_0000132
614 Ga0495658_0016073
615 Ga0495669_0035118
616 Ga0495613_0061973
617 Ga0495613_0253556
618 Ga0495624_0016278
619 Ga0495600_0070881
620 Ga0495600_0071654
621 Ga0495581_0002525
622 Ga0495581_0078477
623 Ga0495581_0188407
624 Ga0495604_0011373
625 Ga0495674_0001965
626 Ga0495674_0081988
627 Ga0495674_0298053
628 Ga0495676_0000313
629 Ga0495676_0062519
630 Ga0495676_0118126
631 Ga0495680_0001277
632 Ga0495680_0074733
633 Ga0495680_0083545
634 Ga0495675_0141147
635 Ga0495684_0006639
636 Ga0495684_0025317
637 Ga0495684_0068693
638 Ga0495593_0001711
639 Ga0495602_0071028
640 Ga0495602_0201626
641 Ga0496100_0001055
642 Ga0496100_0056191
643 Ga0496101_0006784
644 Ga0496101_0018944
645 Ga0496101_0022583
646 Ga0496101_0023794
647 Ga0496102_0004720
648 Ga0496103_0014033
649 Ga0496103_0044005
650 Ga0496103_0050727
651 Ga0496104_0005229
652 Ga0496104_0020664
653 Ga0496105_0000406
654 Ga0496105_0000889
655 Ga0496105_0006181
656 Ga0496105_0086916
657 Ga0496105_0154647
658 Ga0496106_0000263
659 Ga0496107_0000712
660 Ga0496107_0023622
661 Ga0496107_0030612
662 Ga0496108_0007285
663 Ga0496108_0132356
664 Ga0496109_0001107
665 Ga0496109_0019473
666 Ga0496109_0303757
667 Ga0496110_0001849
668 Ga0496111_0032855
669 Ga0496111_0089533
670 Ga0496112_0025591
671 Ga0496112_0055125
672 Ga0496113_0011248
673 Ga0496114_0000444
674 Ga0496114_0018037
675 Ga0496114_0030258
676 Ga0496114_0042105
677 Ga0496115_0000415
678 Ga0496115_0002152
679 Ga0496115_0020168
680 Ga0496115_0036195
681 Ga0501032_0003470
682 Ga0501034_0187237
683 Ga0501037_0056677
684 Ga0501038_0003547
685 Ga0501039_0106890
686 Ga0501040_0029264
687 Ga0501046_0067985
688 Ga0501047_0038397
689 Ga0501067_0007172
690 Ga0501068_0001136
691 Ga0501069_0036785
692 Ga0501070_0000104
693 Ga0501070_0020812
694 Ga0501074_0009845
695 Ga0501079_0179379
696 Ga0501080_0069633
697 Ga0501081_0147150
698 Ga0501083_0010154
699 Ga0501035_0004076
700 Ga0501044_0115488
701 Ga0501045_0084725
702 nmdc:mga0qj67_152216_c1
703 nmdc:mga08y16_180624_c1
704 nmdc:mga0n895_255047_c1
705 nmdc:mga0rr50_103707_c1
706 nmdc:mga0rr50_69353_c1
707 Ga0495601_0061273
708 Ga0495612_0077014
709 Ga0495595_0008187
710 Ga0495595_0082502
711 Ga0495619_0008738
712 Ga0495619_0008766
713 Ga0495619_0036245
714 Ga0495619_0066048
715 Ga0495619_0151001
716 Ga0495619_0157000
717 Ga0501084_0100809
718 Ga0466962_0047772
719 Ga0466962_0101436
720 Ga0530510_0014794

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00675

Peptidase_M16

Insulinase (Peptidase family M16)

14

163

0.95

PF05193

Peptidase_M16_C

Peptidase M16 inactive domain

168

343

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hdi-assembly1.cif.gz_B crystal structure of bacillus halodurans metallo peptidase 0.9568 5 415
7v4y-assembly1.cif.gz_A ttha1264/ttha1265 complex 0.9543 4 409
7v4y-assembly1.cif.gz_B ttha1264/ttha1265 complex 0.9463 4 413
5hxk-assembly2.cif.gz_C structure of ttha1265 0.9437 4 413
7v4y-assembly1.cif.gz_A ttha1264/ttha1265 complex 0.9428 4 409
ID Description Score Start End Superfamily
af_A0A0P0V776_44_161_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.979 4 107 3.30.830.10
af_Q4W6B5_16_247_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9767 2 213 3.30.830.10
af_A0A1D6G373_49_271_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9763 1 211 3.30.830.10
af_P98080_18_243_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9745 2 211 3.30.830.10
af_Q23295_11_239_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9731 2 214 3.30.830.10
ID Description Score Start End GO Terms
AF-A0A351RSA1-F1-model_v4 Peptidase M16 0.9862 1 189 GO:0004222
GO:0006508
GO:0046872
AF-A0A7J5EAA3-F1-model_v4 Insulinase family protein 0.9856 1 187 GO:0004222
GO:0006508
GO:0046872
AF-A0A2H0X9A9-F1-model_v4 Peptidase M16 0.983 2 414 GO:0046872
AF-A0A1J5GWF9-F1-model_v4 Peptidase M16 0.9775 4 425 GO:0004222
GO:0006508
GO:0046872
AF-A0A1F8DP07-F1-model_v4 Peptidase M16 C-terminal domain-containing protein 0.977 53 422 GO:0046872

Map