F421844
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 360 | 176 | 357 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300006852|Ga0075433_10636672|Ga0075433_106366722 |
| Length | 170 |
| Sequence | VIEEGNDVTLSPWQDMRAVIQRVNEASVTVEEEVVGQIGLGLLVLLGVGRDDGAAEATLLAEKIAAMRIFPDGEGRFNRSALDAGGAVLVVSQFTLYADTRRGRRPSFSDAAPPEAAAPLVDAFADALRQQGLAVATGSFGAHMRVALINDGPVTIVLDSERFREPRRMH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541299 | Paenisporosarcina sp. OV554 | Isolate | Unclassified |
| 2 | 2837183177 | Egibacter rhizosphaerae EGI 80759 | Isolate | Unclassified |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 41 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 42 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 45 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 46 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 87 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 90 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 91 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 92 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 94 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 95 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 96 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 97 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 98 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 99 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 100 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 101 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 102 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 103 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 105 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 106 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 107 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 108 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 109 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 112 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 113 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 114 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 115 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 120 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 121 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 122 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 123 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 124 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 125 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 126 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 127 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 128 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 129 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 130 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 131 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 132 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 139 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 140 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 141 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 158 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 164 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 165 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 166 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 176 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.94 |
| Metatranscriptomes | 2.22 |
| Isolates | 0.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.39 |
| Nodule | 0 |
| Rhizoplane | 1.39 |
| Rhizosphere | 95.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10037274 | 3300003316 | Bacteria | 2414 |
| 2 | rootH1_10110869 | 3300003323 | Bacteria | 3946 |
| 3 | JGI25407J50210_10030845 | 3300003373 | Bacteria | 1388 |
| 4 | Ga0070683_100791600 | 3300005329 | Bacteria | 909 |
| 5 | Ga0070690_100661472 | 3300005330 | Bacteria | 799 |
| 6 | Ga0068869_100223011 | 3300005334 | Bacteria | 1495 |
| 7 | Ga0070682_100010187 | 3300005337 | Bacteria | 5331 |
| 8 | Ga0070682_100363329 | 3300005337 | Bacteria | 1083 |
| 9 | Ga0070660_100004242 | 3300005339 | Bacteria | 9898 |
| 10 | Ga0070689_100010919 | 3300005340 | Bacteria | 6489 |
| 11 | Ga0070692_10013367 | 3300005345 | Bacteria | 3824 |
| 12 | Ga0070668_100471848 | 3300005347 | Bacteria | 1082 |
| 13 | Ga0070674_101298131 | 3300005356 | Bacteria | 649 |
| 14 | Ga0070659_100076202 | 3300005366 | Bacteria | 2675 |
| 15 | Ga0070667_100198802 | 3300005367 | Bacteria | 1778 |
| 16 | Ga0070705_100395599 | 3300005440 | Bacteria | 1022 |
| 17 | Ga0070700_100056341 | 3300005441 | Unclassified | 2463 |
| 18 | Ga0070700_100511842 | 3300005441 | Bacteria | 925 |
| 19 | Ga0070694_100018718 | 3300005444 | Bacteria | 4399 |
| 20 | Ga0070694_100201726 | 3300005444 | Bacteria | 1483 |
| 21 | Ga0070694_100233824 | 3300005444 | Bacteria | 1384 |
| 22 | Ga0070694_100433900 | 3300005444 | Bacteria | 1034 |
| 23 | Ga0070708_100000866 | 3300005445 | Bacteria | 22856 |
| 24 | Ga0070706_100166767 | 3300005467 | Bacteria | 2056 |
| 25 | Ga0070706_100344557 | 3300005467 | Bacteria | 1389 |
| 26 | Ga0070698_100028261 | 3300005471 | Bacteria | 5827 |
| 27 | Ga0070698_100033046 | 3300005471 | Bacteria | 5360 |
| 28 | Ga0070698_100228919 | 3300005471 | Bacteria | 1792 |
| 29 | Ga0070699_100493130 | 3300005518 | Bacteria | 1112 |
| 30 | Ga0070679_100014924 | 3300005530 | Bacteria | 7462 |
| 31 | Ga0070679_100162724 | 3300005530 | Bacteria | 2205 |
| 32 | Ga0070684_100181636 | 3300005535 | Bacteria | 1913 |
| 33 | Ga0070684_101377468 | 3300005535 | Bacteria | 664 |
| 34 | Ga0070697_100191474 | 3300005536 | Bacteria | 1736 |
| 35 | Ga0070697_100452436 | 3300005536 | Bacteria | 1119 |
| 36 | Ga0070695_100009496 | 3300005545 | Bacteria | 5793 |
| 37 | Ga0070704_100151765 | 3300005549 | Bacteria | 1822 |
| 38 | Ga0070704_100625246 | 3300005549 | Bacteria | 948 |
| 39 | Ga0068857_100006740 | 3300005577 | Bacteria | 9876 |
| 40 | Ga0068854_100770853 | 3300005578 | Bacteria | 836 |
| 41 | Ga0068854_101753540 | 3300005578 | Unclassified | 568 |
| 42 | Ga0068852_100056374 | 3300005616 | Bacteria | 3396 |
| 43 | Ga0068859_100016119 | 3300005617 | Bacteria | 7505 |
| 44 | Ga0068859_100346344 | 3300005617 | Bacteria | 1580 |
| 45 | Ga0068859_100913629 | 3300005617 | Bacteria | 962 |
| 46 | Ga0068864_100892321 | 3300005618 | Bacteria | 878 |
| 47 | Ga0068861_101508848 | 3300005719 | Bacteria | 660 |
| 48 | Ga0068870_10235926 | 3300005840 | Bacteria | 1127 |
| 49 | Ga0068860_100544016 | 3300005843 | Bacteria | 1163 |
| 50 | Ga0068862_100019345 | 3300005844 | Bacteria | 5682 |
| 51 | Ga0068862_100031175 | 3300005844 | Bacteria | 4498 |
| 52 | Ga0068862_100170610 | 3300005844 | Bacteria | 1948 |
| 53 | Ga0068862_100716901 | 3300005844 | Bacteria | 970 |
| 54 | Ga0081455_10058369 | 3300005937 | Bacteria | 3265 |
| 55 | Ga0081538_10000006 | 3300005981 | Bacteria | 181056 |
| 56 | Ga0081539_10012741 | 3300005985 | Bacteria | 6432 |
| 57 | Ga0075364_10084511 | 3300006051 | Bacteria | 2102 |
| 58 | Ga0075366_10016930 | 3300006195 | Bacteria | 4190 |
| 59 | Ga0068871_101889765 | 3300006358 | Unclassified | 567 |
| 60 | Ga0075428_100000709 | 3300006844 | Bacteria | 34431 |
| 61 | Ga0075428_100002340 | 3300006844 | Bacteria | 20568 |
| 62 | Ga0075428_100901533 | 3300006844 | Bacteria | 938 |
| 63 | Ga0075428_101440492 | 3300006844 | Unclassified | 722 |
| 64 | Ga0075428_101682219 | 3300006844 | Bacteria | 662 |
| 65 | Ga0075430_100019347 | 3300006846 | Bacteria | 5789 |
| 66 | Ga0075430_100260606 | 3300006846 | Bacteria | 1436 |
| 67 | Ga0075431_100023362 | 3300006847 | Bacteria | 6325 |
| 68 | Ga0075431_100243616 | 3300006847 | Bacteria | 1828 |
| 69 | Ga0075433_10008456 | 3300006852 | Bacteria | 8214 |
| 70 | Ga0075433_10036433 | 3300006852 | Bacteria | 4238 |
| 71 | Ga0075433_10636672 | 3300006852 | Unclassified | 935 |
| 72 | Ga0075434_100083471 | 3300006871 | Bacteria | 3192 |
| 73 | Ga0075434_100553305 | 3300006871 | Bacteria | 1170 |
| 74 | Ga0075429_100089579 | 3300006880 | Unclassified | 2682 |
| 75 | Ga0075429_100280055 | 3300006880 | Bacteria | 1460 |
| 76 | Ga0075429_100948647 | 3300006880 | Bacteria | 752 |
| 77 | Ga0097620_100016119 | 3300006931 | Bacteria | 7505 |
| 78 | Ga0097620_100346355 | 3300006931 | Bacteria | 1580 |
| 79 | Ga0097620_100913501 | 3300006931 | Bacteria | 962 |
| 80 | Ga0111539_10010924 | 3300009094 | Bacteria | 11428 |
| 81 | Ga0111539_10193249 | 3300009094 | Bacteria | 2374 |
| 82 | Ga0111539_10335747 | 3300009094 | Bacteria | 1759 |
| 83 | Ga0114129_10387460 | 3300009147 | Unclassified | 1844 |
| 84 | Ga0114129_10416244 | 3300009147 | Bacteria | 1769 |
| 85 | Ga0114129_10571828 | 3300009147 | Bacteria | 1467 |
| 86 | Ga0105243_10589069 | 3300009148 | Bacteria | 1069 |
| 87 | Ga0105241_12446181 | 3300009174 | Unclassified | 522 |
| 88 | Ga0105242_10112079 | 3300009176 | Bacteria | 2327 |
| 89 | Ga0105242_10640028 | 3300009176 | Unclassified | 1033 |
| 90 | Ga0105248_10702699 | 3300009177 | Bacteria | 1141 |
| 91 | Ga0105249_10448340 | 3300009553 | Bacteria | 1329 |
| 92 | Ga0105249_10761811 | 3300009553 | Unclassified | 1030 |
| 93 | Ga0105028_102739 | 3300009993 | Unclassified | 1852 |
| 94 | Ga0105246_10014787 | 3300011119 | Unclassified | 4915 |
| 95 | Ga0105246_11460241 | 3300011119 | Unclassified | 641 |
| 96 | Ga0157371_10023244 | 3300013102 | Bacteria | 4533 |
| 97 | Ga0163162_10818970 | 3300013306 | Bacteria | 1048 |
| 98 | Ga0157372_10692311 | 3300013307 | Unclassified | 1186 |
| 99 | Ga0157372_10829027 | 3300013307 | Bacteria | 1074 |
| 100 | Ga0163163_10778933 | 3300014325 | Bacteria | 1020 |
| 101 | Ga0157380_10243276 | 3300014326 | Bacteria | 1624 |
| 102 | Ga0157380_11647841 | 3300014326 | Bacteria | 698 |
| 103 | Ga0206354_10018681 | 3300020081 | Bacteria | 1494 |
| 104 | Ga0206354_10806462 | 3300020081 | Bacteria | 1402 |
| 105 | Ga0206353_11690045 | 3300020082 | Bacteria | 6863 |
| 106 | Ga0207642_10034470 | 3300025899 | Bacteria | 2153 |
| 107 | Ga0207643_10646460 | 3300025908 | Bacteria | 682 |
| 108 | Ga0207684_10683978 | 3300025910 | Unclassified | 873 |
| 109 | Ga0207707_10007237 | 3300025912 | Bacteria | 9658 |
| 110 | Ga0207660_10004447 | 3300025917 | Bacteria | 9130 |
| 111 | Ga0207657_10007354 | 3300025919 | Bacteria | 11299 |
| 112 | Ga0207652_10012154 | 3300025921 | Bacteria | 6955 |
| 113 | Ga0207652_10021094 | 3300025921 | Bacteria | 5374 |
| 114 | Ga0207646_11150428 | 3300025922 | Bacteria | 682 |
| 115 | Ga0207686_10149158 | 3300025934 | Bacteria | 1626 |
| 116 | Ga0207670_10015334 | 3300025936 | Unclassified | 4577 |
| 117 | Ga0207711_11310075 | 3300025941 | Bacteria | 666 |
| 118 | Ga0207689_10353408 | 3300025942 | Bacteria | 1222 |
| 119 | Ga0207712_10117188 | 3300025961 | Bacteria | 2008 |
| 120 | Ga0207712_10245831 | 3300025961 | Bacteria | 1443 |
| 121 | Ga0207658_10488481 | 3300025986 | Bacteria | 1095 |
| 122 | Ga0207703_10253617 | 3300026035 | Bacteria | 1587 |
| 123 | Ga0207708_10318945 | 3300026075 | Unclassified | 1268 |
| 124 | Ga0207708_11267145 | 3300026075 | Unclassified | 645 |
| 125 | Ga0207641_11454920 | 3300026088 | Bacteria | 687 |
| 126 | Ga0207674_10007543 | 3300026116 | Bacteria | 12673 |
| 127 | Ga0207674_10161244 | 3300026116 | Unclassified | 2197 |
| 128 | Ga0207675_100915787 | 3300026118 | Bacteria | 893 |
| 129 | Ga0207675_101572432 | 3300026118 | Bacteria | 678 |
| 130 | Ga0207428_10035807 | 3300027907 | Bacteria | 4054 |
| 131 | Ga0268265_10022224 | 3300028380 | Bacteria | 4454 |
| 132 | Ga0268265_10079981 | 3300028380 | Bacteria | 2576 |
| 133 | Ga0268265_10153130 | 3300028380 | Bacteria | 1947 |
| 134 | Ga0268264_10407730 | 3300028381 | Bacteria | 1308 |
| 135 | Ga0265323_10033292 | 3300028653 | Unclassified | 1909 |
| 136 | Ga0265324_10052856 | 3300029957 | Bacteria | 1395 |
| 137 | Ga0265330_10012400 | 3300031235 | Bacteria | 3987 |
| 138 | Ga0265330_10030228 | 3300031235 | Bacteria | 2434 |
| 139 | Ga0265332_10000071 | 3300031238 | Bacteria | 86362 |
| 140 | Ga0265328_10026116 | 3300031239 | Bacteria | 2197 |
| 141 | Ga0265320_10010947 | 3300031240 | Bacteria | 5363 |
| 142 | Ga0265320_10026755 | 3300031240 | Bacteria | 3015 |
| 143 | Ga0265325_10059881 | 3300031241 | Bacteria | 1936 |
| 144 | Ga0265329_10007586 | 3300031242 | Bacteria | 4183 |
| 145 | Ga0265339_10003939 | 3300031249 | Bacteria | 10268 |
| 146 | Ga0265339_10101813 | 3300031249 | Bacteria | 1494 |
| 147 | Ga0265331_10000051 | 3300031250 | Bacteria | 181262 |
| 148 | Ga0265331_10018225 | 3300031250 | Bacteria | 3646 |
| 149 | Ga0265331_10040566 | 3300031250 | Unclassified | 2264 |
| 150 | Ga0265316_10000030 | 3300031344 | Bacteria | 162620 |
| 151 | Ga0265313_10038183 | 3300031595 | Bacteria | 2394 |
| 152 | Ga0316575_10004204 | 3300031665 | Bacteria | 5052 |
| 153 | Ga0316575_10017319 | 3300031665 | Unclassified | 2736 |
| 154 | Ga0316579_10002620 | 3300031691 | Bacteria | 6830 |
| 155 | Ga0316579_10049842 | 3300031691 | Bacteria | 1957 |
| 156 | Ga0316579_10090389 | 3300031691 | Bacteria | 1462 |
| 157 | Ga0316579_10094344 | 3300031691 | Unclassified | 1430 |
| 158 | Ga0316579_10316298 | 3300031691 | Bacteria | 755 |
| 159 | Ga0265314_10000386 | 3300031711 | Bacteria | 59716 |
| 160 | Ga0265314_10001909 | 3300031711 | Bacteria | 22269 |
| 161 | Ga0265342_10004580 | 3300031712 | Bacteria | 10801 |
| 162 | Ga0265342_10006795 | 3300031712 | Bacteria | 8472 |
| 163 | Ga0316576_10001562 | 3300031727 | Bacteria | 12429 |
| 164 | Ga0316576_10001763 | 3300031727 | Bacteria | 11951 |
| 165 | Ga0316576_10004967 | 3300031727 | Bacteria | 8057 |
| 166 | Ga0316576_10137316 | 3300031727 | Bacteria | 1840 |
| 167 | Ga0316576_10262147 | 3300031727 | Bacteria | 1296 |
| 168 | Ga0316576_10482577 | 3300031727 | Bacteria | 913 |
| 169 | Ga0316576_10492015 | 3300031727 | Unclassified | 903 |
| 170 | Ga0316576_10748883 | 3300031727 | Bacteria | 705 |
| 171 | Ga0316576_11216830 | 3300031727 | Bacteria | 532 |
| 172 | Ga0316576_11323386 | 3300031727 | Unclassified | 507 |
| 173 | Ga0316578_10001355 | 3300031728 | Bacteria | 9870 |
| 174 | Ga0316578_10009992 | 3300031728 | Unclassified | 4908 |
| 175 | Ga0316578_10057734 | 3300031728 | Unclassified | 2280 |
| 176 | Ga0316578_10057855 | 3300031728 | Bacteria | 2278 |
| 177 | Ga0316578_10157602 | 3300031728 | Bacteria | 1368 |
| 178 | Ga0316578_10403894 | 3300031728 | Archaea | 809 |
| 179 | Ga0316577_10000518 | 3300031733 | Bacteria | 15462 |
| 180 | Ga0316577_10002642 | 3300031733 | Bacteria | 8899 |
| 181 | Ga0316577_10032211 | 3300031733 | Bacteria | 2928 |
| 182 | Ga0316577_10303278 | 3300031733 | Unclassified | 905 |
| 183 | Ga0316577_10410311 | 3300031733 | Unclassified | 769 |
| 184 | Ga0316577_10607919 | 3300031733 | Bacteria | 622 |
| 185 | Ga0307406_10367975 | 3300031901 | Bacteria | 1129 |
| 186 | Ga0307409_102072085 | 3300031995 | Bacteria | 599 |
| 187 | Ga0307416_101595005 | 3300032002 | Bacteria | 758 |
| 188 | Ga0307415_101751850 | 3300032126 | Unclassified | 600 |
| 189 | Ga0316583_10001244 | 3300032133 | Bacteria | 8387 |
| 190 | Ga0316585_10001370 | 3300032137 | Bacteria | 6412 |
| 191 | Ga0316585_10007039 | 3300032137 | Bacteria | 3229 |
| 192 | Ga0316585_10022001 | 3300032137 | Bacteria | 1960 |
| 193 | Ga0316585_10032879 | 3300032137 | Bacteria | 1635 |
| 194 | Ga0316585_10086174 | 3300032137 | Bacteria | 1025 |
| 195 | Ga0316585_10109540 | 3300032137 | Bacteria | 907 |
| 196 | Ga0316580_10000027 | 3300032139 | Bacteria | 22899 |
| 197 | Ga0316580_10011508 | 3300032139 | Bacteria | 2687 |
| 198 | Ga0316580_10040445 | 3300032139 | Bacteria | 1441 |
| 199 | Ga0316580_10075760 | 3300032139 | Archaea | 1029 |
| 200 | Ga0316593_10010562 | 3300032168 | Bacteria | 2652 |
| 201 | Ga0316593_10042463 | 3300032168 | Bacteria | 1517 |
| 202 | Ga0316593_10307757 | 3300032168 | Unclassified | 601 |
| 203 | Ga0316592_1004570 | 3300033524 | Unclassified | 2580 |
| 204 | Ga0316596_1033446 | 3300033541 | Bacteria | 1340 |
| 205 | Ga0373956_0197859 | 3300035119 | Bacteria | 952 |
| 206 | Ga0373943_0374542 | 3300035170 | Unclassified | 819 |
| 207 | Ga0316574_0000009 | 3300035398 | Bacteria | 45904 |
| 208 | Ga0316574_0002126 | 3300035398 | Bacteria | 9826 |
| 209 | Ga0316574_0223966 | 3300035398 | Unclassified | 1204 |
| 210 | Ga0316582_0000243 | 3300036647 | Bacteria | 18067 |
| 211 | Ga0316582_0001992 | 3300036647 | Bacteria | 9360 |
| 212 | Ga0316582_0002441 | 3300036647 | Bacteria | 8738 |
| 213 | Ga0316582_0006408 | 3300036647 | Bacteria | 6176 |
| 214 | Ga0316582_0015911 | 3300036647 | Bacteria | 4315 |
| 215 | Ga0316582_0028721 | 3300036647 | Bacteria | 3372 |
| 216 | Ga0316582_0060285 | 3300036647 | Bacteria | 2432 |
| 217 | Ga0316582_0111953 | 3300036647 | Bacteria | 1818 |
| 218 | Ga0316582_0148339 | 3300036647 | Bacteria | 1584 |
| 219 | Ga0316582_0347775 | 3300036647 | Bacteria | 1020 |
| 220 | Ga0316582_0586484 | 3300036647 | Bacteria | 768 |
| 221 | Ga0316582_0767214 | 3300036647 | Bacteria | 661 |
| 222 | Ga0316582_1170256 | 3300036647 | Unclassified | 524 |
| 223 | Ga0316584_0000778 | 3300036712 | Bacteria | 17873 |
| 224 | Ga0316584_0001053 | 3300036712 | Bacteria | 16063 |
| 225 | Ga0316584_0001256 | 3300036712 | Bacteria | 14986 |
| 226 | Ga0316584_0003201 | 3300036712 | Bacteria | 10598 |
| 227 | Ga0316584_0020594 | 3300036712 | Bacteria | 4785 |
| 228 | Ga0316584_0105680 | 3300036712 | Bacteria | 2107 |
| 229 | Ga0316584_0132670 | 3300036712 | Bacteria | 1860 |
| 230 | Ga0316584_0282698 | 3300036712 | Bacteria | 1205 |
| 231 | Ga0316584_0314066 | 3300036712 | Bacteria | 1132 |
| 232 | Ga0316584_0423848 | 3300036712 | Bacteria | 945 |
| 233 | Ga0316584_0498836 | 3300036712 | Unclassified | 855 |
| 234 | Ga0316584_0501611 | 3300036712 | Unclassified | 853 |
| 235 | Ga0316584_0549520 | 3300036712 | Bacteria | 806 |
| 236 | Ga0316584_0860550 | 3300036712 | Bacteria | 613 |
| 237 | Ga0316581_0001730 | 3300037588 | Bacteria | 5026 |
| 238 | Ga0316581_0004822 | 3300037588 | Bacteria | 3471 |
| 239 | Ga0316581_0009838 | 3300037588 | Bacteria | 2638 |
| 240 | Ga0316581_0083923 | 3300037588 | Bacteria | 980 |
| 241 | Ga0316581_0181348 | 3300037588 | Bacteria | 649 |
| 242 | Ga0400483_277133 | 3300039062 | Bacteria | 2078 |
| 243 | Ga0400489_47960 | 3300039093 | Bacteria | 5007 |
| 244 | Ga0400489_91703 | 3300039093 | Bacteria | 3122 |
| 245 | Ga0451797_1137418 | 3300041453 | Bacteria | 993 |
| 246 | Ga0450913_026620 | 3300042117 | Bacteria | 555 |
| 247 | Ga0451577_0036189 | 3300042876 | Bacteria | 4445 |
| 248 | Ga0451577_0127518 | 3300042876 | Bacteria | 2281 |
| 249 | Ga0453683_0000029 | 3300044673 | Bacteria | 243061 |
| 250 | Ga0453683_0029399 | 3300044673 | Bacteria | 3474 |
| 251 | Ga0453683_0053416 | 3300044673 | Bacteria | 2528 |
| 252 | Ga0453683_0445568 | 3300044673 | Unclassified | 837 |
| 253 | Ga0453683_0536509 | 3300044673 | Bacteria | 761 |
| 254 | Ga0453683_0713949 | 3300044673 | Bacteria | 657 |
| 255 | Ga0453684_0000035 | 3300044712 | Bacteria | 725956 |
| 256 | Ga0453684_0000402 | 3300044712 | Bacteria | 178427 |
| 257 | Ga0453684_0007550 | 3300044712 | Bacteria | 19936 |
| 258 | Ga0453684_0020337 | 3300044712 | Bacteria | 10021 |
| 259 | Ga0453684_0043555 | 3300044712 | Bacteria | 6030 |
| 260 | Ga0453684_0046036 | 3300044712 | Bacteria | 5810 |
| 261 | Ga0453684_0057334 | 3300044712 | Bacteria | 5042 |
| 262 | Ga0453684_0079884 | 3300044712 | Bacteria | 4087 |
| 263 | Ga0453684_0080463 | 3300044712 | Bacteria | 4068 |
| 264 | Ga0453684_0087039 | 3300044712 | Bacteria | 3874 |
| 265 | Ga0453684_0110150 | 3300044712 | Bacteria | 3347 |
| 266 | Ga0453684_0193952 | 3300044712 | Unclassified | 2374 |
| 267 | Ga0453684_0206762 | 3300044712 | Bacteria | 2284 |
| 268 | Ga0453684_0244965 | 3300044712 | Bacteria | 2062 |
| 269 | Ga0453684_0296311 | 3300044712 | Unclassified | 1840 |
| 270 | Ga0453684_0316493 | 3300044712 | Bacteria | 1769 |
| 271 | Ga0453684_0363221 | 3300044712 | Bacteria | 1629 |
| 272 | Ga0453684_0409468 | 3300044712 | Bacteria | 1517 |
| 273 | Ga0453684_0479246 | 3300044712 | Bacteria | 1380 |
| 274 | Ga0453684_0549015 | 3300044712 | Bacteria | 1273 |
| 275 | Ga0453684_0649663 | 3300044712 | Bacteria | 1151 |
| 276 | Ga0453684_0864464 | 3300044712 | Bacteria | 971 |
| 277 | Ga0453684_1142514 | 3300044712 | Bacteria | 821 |
| 278 | Ga0453684_1239068 | 3300044712 | Unclassified | 781 |
| 279 | Ga0453684_1341579 | 3300044712 | Unclassified | 744 |
| 280 | Ga0453684_1667622 | 3300044712 | Bacteria | 652 |
| 281 | Ga0453684_2401220 | 3300044712 | Bacteria | 522 |
| 282 | Ga0451576_0000078 | 3300045051 | Bacteria | 243039 |
| 283 | Ga0451576_0000123 | 3300045051 | Bacteria | 196806 |
| 284 | Ga0451576_0002907 | 3300045051 | Bacteria | 24422 |
| 285 | Ga0451576_0015115 | 3300045051 | Bacteria | 8568 |
| 286 | Ga0451576_0015535 | 3300045051 | Bacteria | 8428 |
| 287 | Ga0451576_0048196 | 3300045051 | Bacteria | 4477 |
| 288 | Ga0451576_0053778 | 3300045051 | Bacteria | 4216 |
| 289 | Ga0451576_0413092 | 3300045051 | Bacteria | 1415 |
| 290 | Ga0451576_0434473 | 3300045051 | Bacteria | 1378 |
| 291 | Ga0451576_0756695 | 3300045051 | Bacteria | 1020 |
| 292 | Ga0451576_1154139 | 3300045051 | Unclassified | 810 |
| 293 | Ga0451576_1348884 | 3300045051 | Bacteria | 743 |
| 294 | Ga0495580_0517609 | 3300046472 | Bacteria | 795 |
| 295 | Ga0495594_0279498 | 3300046499 | Unclassified | 951 |
| 296 | Ga0495656_0025905 | 3300046615 | Bacteria | 2330 |
| 297 | Ga0495636_0293330 | 3300047318 | Unclassified | 760 |
| 298 | Ga0496108_0000059 | 3300048911 | Bacteria | 123078 |
| 299 | Ga0496109_0368542 | 3300048912 | Bacteria | 1357 |
| 300 | Ga0496110_0597181 | 3300048913 | Bacteria | 1002 |
| 301 | Ga0496111_0756611 | 3300048914 | Bacteria | 705 |
| 302 | Ga0501299_155274 | 3300049522 | Unclassified | 580 |
| 303 | Ga0501033_0312933 | 3300049570 | Bacteria | 1104 |
| 304 | Ga0501034_0806817 | 3300049571 | Unclassified | 831 |
| 305 | Ga0501036_0049995 | 3300049572 | Bacteria | 3541 |
| 306 | Ga0501037_0263825 | 3300049573 | Bacteria | 1203 |
| 307 | Ga0501038_0101291 | 3300049574 | Bacteria | 2398 |
| 308 | Ga0501039_0084554 | 3300049575 | Bacteria | 2471 |
| 309 | Ga0501039_1228779 | 3300049575 | Bacteria | 579 |
| 310 | Ga0501040_0060929 | 3300049576 | Bacteria | 2594 |
| 311 | Ga0501041_0071369 | 3300049577 | Bacteria | 2132 |
| 312 | Ga0501041_0307428 | 3300049577 | Bacteria | 999 |
| 313 | Ga0501041_0499421 | 3300049577 | Unclassified | 774 |
| 314 | Ga0501046_0144838 | 3300049580 | Bacteria | 1795 |
| 315 | Ga0501048_0974192 | 3300049582 | Bacteria | 610 |
| 316 | Ga0501067_0065096 | 3300049583 | Bacteria | 2018 |
| 317 | Ga0501068_0172754 | 3300049584 | Bacteria | 1364 |
| 318 | Ga0501071_0679508 | 3300049587 | Bacteria | 792 |
| 319 | Ga0501072_0027139 | 3300049588 | Bacteria | 4468 |
| 320 | Ga0501072_0363321 | 3300049588 | Bacteria | 1149 |
| 321 | Ga0501075_0034845 | 3300049591 | Bacteria | 3751 |
| 322 | Ga0501075_0062754 | 3300049591 | Unclassified | 2801 |
| 323 | Ga0501076_0052471 | 3300049592 | Bacteria | 3230 |
| 324 | Ga0501076_0329769 | 3300049592 | Bacteria | 1252 |
| 325 | Ga0501257_013612 | 3300049686 | Bacteria | 1866 |
| 326 | Ga0501079_0068275 | 3300049741 | Bacteria | 2744 |
| 327 | Ga0501079_0526927 | 3300049741 | Bacteria | 929 |
| 328 | Ga0501080_0046238 | 3300049742 | Bacteria | 4054 |
| 329 | Ga0501080_1311964 | 3300049742 | Bacteria | 620 |
| 330 | Ga0501081_0045111 | 3300049743 | Bacteria | 3027 |
| 331 | Ga0501083_0598361 | 3300049744 | Bacteria | 717 |
| 332 | Ga0501045_0058046 | 3300049824 | Bacteria | 2833 |
| 333 | nmdc:mga00v17_389991_c1 | 3300050491 | Bacteria | 905 |
| 334 | nmdc:mga0yw44_217223_c1 | 3300050492 | Bacteria | 1266 |
| 335 | nmdc:mga0k408_16223_c1 | 3300050493 | Bacteria | 4130 |
| 336 | nmdc:mga05p37_119912_c1 | 3300050507 | Bacteria | 3231 |
| 337 | nmdc:mga09592_1611934_c1 | 3300050508 | Bacteria | 525 |
| 338 | nmdc:mga09592_73480_c1 | 3300050508 | Unclassified | 2905 |
| 339 | nmdc:mga0qj67_13736_c1 | 3300050509 | Bacteria | 6111 |
| 340 | nmdc:mga06r32_1226239_c1 | 3300050510 | Bacteria | 696 |
| 341 | nmdc:mga06r32_225770_c1 | 3300050510 | Bacteria | 1861 |
| 342 | nmdc:mga06r32_33323_c1 | 3300050510 | Bacteria | 4851 |
| 343 | nmdc:mga08y16_1573_c2 | 3300050511 | Bacteria | 22644 |
| 344 | nmdc:mga08y16_266645_c1 | 3300050511 | Bacteria | 1768 |
| 345 | nmdc:mga0n895_27679_c1 | 3300050512 | Bacteria | 5387 |
| 346 | nmdc:mga0n895_802925_c1 | 3300050512 | Bacteria | 931 |
| 347 | nmdc:mga0a205_139931_c1 | 3300050515 | Unclassified | 1801 |
| 348 | nmdc:mga0a205_184098_c1 | 3300050515 | Bacteria | 1982 |
| 349 | nmdc:mga0a205_19109_c1 | 3300050515 | Bacteria | 6459 |
| 350 | nmdc:mga0a205_231515_c1 | 3300050515 | Bacteria | 1731 |
| 351 | Ga0495619_0003996 | 3300053085 | Bacteria | 9454 |
| 352 | Ga0501082_0049688 | 3300060353 | Bacteria | 3617 |
| 353 | Ga0501082_0286098 | 3300060353 | Bacteria | 1435 |
| 354 | Ga0501082_1952181 | 3300060353 | Bacteria | 512 |
| 355 | Ga0530510_0012391 | 3300061734 | Bacteria | 5990 |
| 356 | Ga0530510_0289406 | 3300061734 | Bacteria | 1225 |
| 357 | Ga0530510_0972364 | 3300061734 | Bacteria | 649 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049571 | Ga0501034_0806817 | Ga0501034_0806817_358_816 | 133 |
| 2 | 3300061734 | Ga0530510_0289406 | Ga0530510_0289406_22_423 | 133 |
| 3 | 3300014326 | Ga0157380_10243276 | Ga0157380_102432762 | 137 |
| 4 | 3300036647 | Ga0316582_0111953 | Ga0316582_0111953_1352_1765 | 137 |
| 5 | 3300003323 | rootH1_10110869 | rootH1_101108693 | 139 |
| 6 | 3300009147 | Ga0114129_10387460 | Ga0114129_103874602 | 140 |
| 7 | 3300014326 | Ga0157380_11647841 | Ga0157380_116478412 | 140 |
| 8 | 3300031901 | Ga0307406_10367975 | Ga0307406_103679751 | 141 |
| 9 | 3300042117 | Ga0450913_026620 | Ga0450913_026620_19_501 | 141 |
| 10 | iso_pu_bacteria | 8054357960 | 8054358969 | 141 |
| 11 | 3300032002 | Ga0307416_101595005 | Ga0307416_1015950051 | 142 |
| 12 | 3300036647 | Ga0316582_0347775 | Ga0316582_0347775_206_634 | 142 |
| 13 | 3300044712 | Ga0453684_0549015 | Ga0453684_0549015_10_438 | 142 |
| 14 | iso_pu_bacteria | 2738541299 | 2738839438 | 142 |
| 15 | 3300005337 | Ga0070682_100010187 | Ga0070682_1000101874 | 143 |
| 16 | 3300005339 | Ga0070660_100004242 | Ga0070660_1000042425 | 143 |
| 17 | 3300005366 | Ga0070659_100076202 | Ga0070659_1000762024 | 143 |
| 18 | 3300005530 | Ga0070679_100162724 | Ga0070679_1001627244 | 143 |
| 19 | 3300005535 | Ga0070684_100181636 | Ga0070684_1001816363 | 143 |
| 20 | 3300005616 | Ga0068852_100056374 | Ga0068852_1000563743 | 143 |
| 21 | 3300013307 | Ga0157372_10829027 | Ga0157372_108290272 | 143 |
| 22 | 3300020081 | Ga0206354_10018681 | Ga0206354_100186811 | 143 |
| 23 | 3300020082 | Ga0206353_11690045 | Ga0206353_116900457 | 143 |
| 24 | 3300025912 | Ga0207707_10007237 | Ga0207707_100072374 | 143 |
| 25 | 3300025917 | Ga0207660_10004447 | Ga0207660_100044472 | 143 |
| 26 | 3300025919 | Ga0207657_10007354 | Ga0207657_100073544 | 143 |
| 27 | 3300025921 | Ga0207652_10021094 | Ga0207652_100210942 | 143 |
| 28 | 3300044712 | Ga0453684_1667622 | Ga0453684_1667622_46_495 | 143 |
| 29 | 3300050510 | nmdc:mga06r32_33323_c1 | nmdc:mga06r32_33323_c1_2728_3159 | 143 |
| 30 | iso_pu_bacteria | 2837183177 | 2837183322 | 143 |
| 31 | 3300005719 | Ga0068861_101508848 | Ga0068861_1015088481 | 144 |
| 32 | 3300005844 | Ga0068862_100716901 | Ga0068862_1007169012 | 144 |
| 33 | 3300026118 | Ga0207675_100915787 | Ga0207675_1009157872 | 144 |
| 34 | 3300060353 | Ga0501082_1952181 | Ga0501082_1952181_35_502 | 144 |
| 35 | 3300003373 | JGI25407J50210_10030845 | JGI25407J50210_100308452 | 145 |
| 36 | 3300005340 | Ga0070689_100010919 | Ga0070689_1000109195 | 145 |
| 37 | 3300005445 | Ga0070708_100000866 | Ga0070708_10000086612 | 145 |
| 38 | 3300005467 | Ga0070706_100166767 | Ga0070706_1001667673 | 145 |
| 39 | 3300005467 | Ga0070706_100344557 | Ga0070706_1003445573 | 145 |
| 40 | 3300005471 | Ga0070698_100033046 | Ga0070698_1000330464 | 145 |
| 41 | 3300005536 | Ga0070697_100191474 | Ga0070697_1001914743 | 145 |
| 42 | 3300005536 | Ga0070697_100452436 | Ga0070697_1004524362 | 145 |
| 43 | 3300005545 | Ga0070695_100009496 | Ga0070695_1000094966 | 145 |
| 44 | 3300005578 | Ga0068854_101753540 | Ga0068854_1017535402 | 145 |
| 45 | 3300005617 | Ga0068859_100346344 | Ga0068859_1003463442 | 145 |
| 46 | 3300005840 | Ga0068870_10235926 | Ga0068870_102359261 | 145 |
| 47 | 3300005844 | Ga0068862_100170610 | Ga0068862_1001706102 | 145 |
| 48 | 3300005981 | Ga0081538_10000006 | Ga0081538_1000000618 | 145 |
| 49 | 3300006844 | Ga0075428_101682219 | Ga0075428_1016822192 | 145 |
| 50 | 3300006847 | Ga0075431_100023362 | Ga0075431_1000233626 | 145 |
| 51 | 3300006880 | Ga0075429_100089579 | Ga0075429_1000895793 | 145 |
| 52 | 3300006931 | Ga0097620_100346355 | Ga0097620_1003463552 | 145 |
| 53 | 3300009174 | Ga0105241_12446181 | Ga0105241_124461811 | 145 |
| 54 | 3300009176 | Ga0105242_10112079 | Ga0105242_101120792 | 145 |
| 55 | 3300009553 | Ga0105249_10761811 | Ga0105249_107618112 | 145 |
| 56 | 3300009993 | Ga0105028_102739 | Ga0105028_1027393 | 145 |
| 57 | 3300011119 | Ga0105246_10014787 | Ga0105246_100147876 | 145 |
| 58 | 3300011119 | Ga0105246_11460241 | Ga0105246_114602412 | 145 |
| 59 | 3300013102 | Ga0157371_10023244 | Ga0157371_100232444 | 145 |
| 60 | 3300014325 | Ga0163163_10778933 | Ga0163163_107789332 | 145 |
| 61 | 3300025910 | Ga0207684_10683978 | Ga0207684_106839781 | 145 |
| 62 | 3300025922 | Ga0207646_11150428 | Ga0207646_111504281 | 145 |
| 63 | 3300025934 | Ga0207686_10149158 | Ga0207686_101491583 | 145 |
| 64 | 3300025936 | Ga0207670_10015334 | Ga0207670_100153342 | 145 |
| 65 | 3300027907 | Ga0207428_10035807 | Ga0207428_100358073 | 145 |
| 66 | 3300028380 | Ga0268265_10153130 | Ga0268265_101531302 | 145 |
| 67 | 3300028653 | Ga0265323_10033292 | Ga0265323_100332922 | 145 |
| 68 | 3300031665 | Ga0316575_10004204 | Ga0316575_100042042 | 145 |
| 69 | 3300031691 | Ga0316579_10002620 | Ga0316579_100026203 | 145 |
| 70 | 3300031727 | Ga0316576_10004967 | Ga0316576_100049672 | 145 |
| 71 | 3300031727 | Ga0316576_10137316 | Ga0316576_101373163 | 145 |
| 72 | 3300031727 | Ga0316576_10492015 | Ga0316576_104920152 | 145 |
| 73 | 3300031727 | Ga0316576_11216830 | Ga0316576_112168301 | 145 |
| 74 | 3300031728 | Ga0316578_10001355 | Ga0316578_100013554 | 145 |
| 75 | 3300031728 | Ga0316578_10157602 | Ga0316578_101576023 | 145 |
| 76 | 3300031733 | Ga0316577_10002642 | Ga0316577_100026422 | 145 |
| 77 | 3300031733 | Ga0316577_10032211 | Ga0316577_100322114 | 145 |
| 78 | 3300032137 | Ga0316585_10022001 | Ga0316585_100220013 | 145 |
| 79 | 3300032137 | Ga0316585_10032879 | Ga0316585_100328792 | 145 |
| 80 | 3300032137 | Ga0316585_10109540 | Ga0316585_101095402 | 145 |
| 81 | 3300032139 | Ga0316580_10040445 | Ga0316580_100404452 | 145 |
| 82 | 3300032168 | Ga0316593_10042463 | Ga0316593_100424632 | 145 |
| 83 | 3300032168 | Ga0316593_10307757 | Ga0316593_103077572 | 145 |
| 84 | 3300033541 | Ga0316596_1033446 | Ga0316596_10334462 | 145 |
| 85 | 3300035398 | Ga0316574_0002126 | Ga0316574_0002126_4289_4726 | 145 |
| 86 | 3300036647 | Ga0316582_0002441 | Ga0316582_0002441_5282_5719 | 145 |
| 87 | 3300036647 | Ga0316582_0586484 | Ga0316582_0586484_268_705 | 145 |
| 88 | 3300036712 | Ga0316584_0001256 | Ga0316584_0001256_8956_9393 | 145 |
| 89 | 3300036712 | Ga0316584_0003201 | Ga0316584_0003201_8668_9105 | 145 |
| 90 | 3300036712 | Ga0316584_0020594 | Ga0316584_0020594_3141_3578 | 145 |
| 91 | 3300036712 | Ga0316584_0105680 | Ga0316584_0105680_554_991 | 145 |
| 92 | 3300036712 | Ga0316584_0423848 | Ga0316584_0423848_481_918 | 145 |
| 93 | 3300036712 | Ga0316584_0549520 | Ga0316584_0549520_98_535 | 145 |
| 94 | 3300036712 | Ga0316584_0860550 | Ga0316584_0860550_51_488 | 145 |
| 95 | 3300037588 | Ga0316581_0004822 | Ga0316581_0004822_989_1426 | 145 |
| 96 | 3300037588 | Ga0316581_0181348 | Ga0316581_0181348_91_528 | 145 |
| 97 | 3300042876 | Ga0451577_0036189 | Ga0451577_0036189_3352_3789 | 145 |
| 98 | 3300042876 | Ga0451577_0127518 | Ga0451577_0127518_1332_1769 | 145 |
| 99 | 3300044673 | Ga0453683_0029399 | Ga0453683_0029399_1951_2388 | 145 |
| 100 | 3300044673 | Ga0453683_0445568 | Ga0453683_0445568_130_600 | 145 |
| 101 | 3300044673 | Ga0453683_0536509 | Ga0453683_0536509_174_611 | 145 |
| 102 | 3300044673 | Ga0453683_0713949 | Ga0453683_0713949_11_448 | 145 |
| 103 | 3300044712 | Ga0453684_0000035 | Ga0453684_0000035_649338_649775 | 145 |
| 104 | 3300044712 | Ga0453684_0000402 | Ga0453684_0000402_163230_163667 | 145 |
| 105 | 3300044712 | Ga0453684_0043555 | Ga0453684_0043555_779_1216 | 145 |
| 106 | 3300044712 | Ga0453684_0057334 | Ga0453684_0057334_3505_3942 | 145 |
| 107 | 3300044712 | Ga0453684_0079884 | Ga0453684_0079884_2237_2689 | 145 |
| 108 | 3300044712 | Ga0453684_0080463 | Ga0453684_0080463_1746_2195 | 145 |
| 109 | 3300044712 | Ga0453684_0087039 | Ga0453684_0087039_505_942 | 145 |
| 110 | 3300044712 | Ga0453684_0110150 | Ga0453684_0110150_52_489 | 145 |
| 111 | 3300044712 | Ga0453684_0206762 | Ga0453684_0206762_1673_2110 | 145 |
| 112 | 3300044712 | Ga0453684_0244965 | Ga0453684_0244965_217_654 | 145 |
| 113 | 3300044712 | Ga0453684_0296311 | Ga0453684_0296311_776_1213 | 145 |
| 114 | 3300044712 | Ga0453684_0409468 | Ga0453684_0409468_891_1328 | 145 |
| 115 | 3300044712 | Ga0453684_0479246 | Ga0453684_0479246_689_1198 | 145 |
| 116 | 3300044712 | Ga0453684_0649663 | Ga0453684_0649663_59_526 | 145 |
| 117 | 3300044712 | Ga0453684_0864464 | Ga0453684_0864464_398_835 | 145 |
| 118 | 3300044712 | Ga0453684_1142514 | Ga0453684_1142514_140_589 | 145 |
| 119 | 3300044712 | Ga0453684_1239068 | Ga0453684_1239068_141_578 | 145 |
| 120 | 3300044712 | Ga0453684_1341579 | Ga0453684_1341579_68_538 | 145 |
| 121 | 3300044712 | Ga0453684_2401220 | Ga0453684_2401220_46_495 | 145 |
| 122 | 3300045051 | Ga0451576_0002907 | Ga0451576_0002907_14023_14460 | 145 |
| 123 | 3300045051 | Ga0451576_0015115 | Ga0451576_0015115_6289_6759 | 145 |
| 124 | 3300045051 | Ga0451576_0048196 | Ga0451576_0048196_2658_3095 | 145 |
| 125 | 3300045051 | Ga0451576_0053778 | Ga0451576_0053778_1652_2089 | 145 |
| 126 | 3300045051 | Ga0451576_0413092 | Ga0451576_0413092_287_796 | 145 |
| 127 | 3300045051 | Ga0451576_0434473 | Ga0451576_0434473_468_905 | 145 |
| 128 | 3300045051 | Ga0451576_0756695 | Ga0451576_0756695_366_803 | 145 |
| 129 | 3300045051 | Ga0451576_1154139 | Ga0451576_1154139_246_683 | 145 |
| 130 | 3300049522 | Ga0501299_155274 | Ga0501299_155274_131_568 | 145 |
| 131 | 3300049575 | Ga0501039_1228779 | Ga0501039_1228779_67_504 | 145 |
| 132 | 3300049577 | Ga0501041_0499421 | Ga0501041_0499421_229_666 | 145 |
| 133 | 3300049588 | Ga0501072_0363321 | Ga0501072_0363321_495_932 | 145 |
| 134 | 3300049591 | Ga0501075_0062754 | Ga0501075_0062754_408_845 | 145 |
| 135 | 3300049592 | Ga0501076_0329769 | Ga0501076_0329769_305_742 | 145 |
| 136 | 3300049741 | Ga0501079_0526927 | Ga0501079_0526927_276_713 | 145 |
| 137 | 3300049742 | Ga0501080_1311964 | Ga0501080_1311964_172_609 | 145 |
| 138 | 3300050508 | nmdc:mga09592_73480_c1 | nmdc:mga09592_73480_c1_1741_2178 | 145 |
| 139 | 3300050515 | nmdc:mga0a205_184098_c1 | nmdc:mga0a205_184098_c1_1283_1720 | 145 |
| 140 | 3300060353 | Ga0501082_0286098 | Ga0501082_0286098_974_1411 | 145 |
| 141 | 3300009094 | Ga0111539_10010924 | Ga0111539_1001092410 | 146 |
| 142 | 3300036647 | Ga0316582_0015911 | Ga0316582_0015911_321_761 | 146 |
| 143 | 3300037588 | Ga0316581_0083923 | Ga0316581_0083923_323_763 | 146 |
| 144 | 3300050511 | nmdc:mga08y16_1573_c2 | nmdc:mga08y16_1573_c2_351_794 | 146 |
| 145 | 3300061734 | Ga0530510_0972364 | Ga0530510_0972364_100_540 | 146 |
| 146 | 3300005471 | Ga0070698_100028261 | Ga0070698_1000282611 | 147 |
| 147 | 3300005578 | Ga0068854_100770853 | Ga0068854_1007708532 | 147 |
| 148 | 3300006051 | Ga0075364_10084511 | Ga0075364_100845112 | 147 |
| 149 | 3300031691 | Ga0316579_10316298 | Ga0316579_103162981 | 147 |
| 150 | 3300031727 | Ga0316576_10748883 | Ga0316576_107488832 | 147 |
| 151 | 3300031728 | Ga0316578_10057855 | Ga0316578_100578551 | 147 |
| 152 | 3300032139 | Ga0316580_10011508 | Ga0316580_100115082 | 147 |
| 153 | 3300036647 | Ga0316582_0767214 | Ga0316582_0767214_134_577 | 147 |
| 154 | 3300036712 | Ga0316584_0498836 | Ga0316584_0498836_284_727 | 147 |
| 155 | 3300039093 | Ga0400489_47960 | Ga0400489_47960_3727_4170 | 147 |
| 156 | 3300045051 | Ga0451576_0015535 | Ga0451576_0015535_1889_2428 | 147 |
| 157 | 3300049570 | Ga0501033_0312933 | Ga0501033_0312933_546_989 | 147 |
| 158 | 3300049572 | Ga0501036_0049995 | Ga0501036_0049995_1384_1827 | 147 |
| 159 | 3300049573 | Ga0501037_0263825 | Ga0501037_0263825_607_1050 | 147 |
| 160 | 3300049574 | Ga0501038_0101291 | Ga0501038_0101291_1316_1759 | 147 |
| 161 | 3300049575 | Ga0501039_0084554 | Ga0501039_0084554_1068_1511 | 147 |
| 162 | 3300049576 | Ga0501040_0060929 | Ga0501040_0060929_953_1396 | 147 |
| 163 | 3300049577 | Ga0501041_0071369 | Ga0501041_0071369_1391_1834 | 147 |
| 164 | 3300049580 | Ga0501046_0144838 | Ga0501046_0144838_462_905 | 147 |
| 165 | 3300049582 | Ga0501048_0974192 | Ga0501048_0974192_132_575 | 147 |
| 166 | 3300049584 | Ga0501068_0172754 | Ga0501068_0172754_748_1191 | 147 |
| 167 | 3300049587 | Ga0501071_0679508 | Ga0501071_0679508_106_549 | 147 |
| 168 | 3300049588 | Ga0501072_0027139 | Ga0501072_0027139_950_1393 | 147 |
| 169 | 3300049591 | Ga0501075_0034845 | Ga0501075_0034845_1732_2175 | 147 |
| 170 | 3300049592 | Ga0501076_0052471 | Ga0501076_0052471_1434_1877 | 147 |
| 171 | 3300049741 | Ga0501079_0068275 | Ga0501079_0068275_1071_1514 | 147 |
| 172 | 3300049742 | Ga0501080_0046238 | Ga0501080_0046238_1941_2384 | 147 |
| 173 | 3300049743 | Ga0501081_0045111 | Ga0501081_0045111_1403_1846 | 147 |
| 174 | 3300049824 | Ga0501045_0058046 | Ga0501045_0058046_633_1076 | 147 |
| 175 | 3300050491 | nmdc:mga00v17_389991_c1 | nmdc:mga00v17_389991_c1_79_522 | 147 |
| 176 | 3300050492 | nmdc:mga0yw44_217223_c1 | nmdc:mga0yw44_217223_c1_417_860 | 147 |
| 177 | 3300060353 | Ga0501082_0049688 | Ga0501082_0049688_1181_1624 | 147 |
| 178 | 3300061734 | Ga0530510_0012391 | Ga0530510_0012391_4742_5185 | 147 |
| 179 | 3300005367 | Ga0070667_100198802 | Ga0070667_1001988022 | 148 |
| 180 | 3300005617 | Ga0068859_100913629 | Ga0068859_1009136292 | 148 |
| 181 | 3300005618 | Ga0068864_100892321 | Ga0068864_1008923211 | 148 |
| 182 | 3300005844 | Ga0068862_100019345 | Ga0068862_1000193453 | 148 |
| 183 | 3300006880 | Ga0075429_100948647 | Ga0075429_1009486471 | 148 |
| 184 | 3300006931 | Ga0097620_100913501 | Ga0097620_1009135012 | 148 |
| 185 | 3300013306 | Ga0163162_10818970 | Ga0163162_108189702 | 148 |
| 186 | 3300020081 | Ga0206354_10806462 | Ga0206354_108064623 | 148 |
| 187 | 3300025941 | Ga0207711_11310075 | Ga0207711_113100751 | 148 |
| 188 | 3300025986 | Ga0207658_10488481 | Ga0207658_104884812 | 148 |
| 189 | 3300026035 | Ga0207703_10253617 | Ga0207703_102536173 | 148 |
| 190 | 3300026088 | Ga0207641_11454920 | Ga0207641_114549202 | 148 |
| 191 | 3300028380 | Ga0268265_10079981 | Ga0268265_100799813 | 148 |
| 192 | 3300031235 | Ga0265330_10012400 | Ga0265330_100124005 | 148 |
| 193 | 3300031235 | Ga0265330_10030228 | Ga0265330_100302283 | 148 |
| 194 | 3300031238 | Ga0265332_10000071 | Ga0265332_1000007166 | 148 |
| 195 | 3300031239 | Ga0265328_10026116 | Ga0265328_100261162 | 148 |
| 196 | 3300031240 | Ga0265320_10026755 | Ga0265320_100267553 | 148 |
| 197 | 3300031242 | Ga0265329_10007586 | Ga0265329_100075865 | 148 |
| 198 | 3300031249 | Ga0265339_10003939 | Ga0265339_100039398 | 148 |
| 199 | 3300031249 | Ga0265339_10101813 | Ga0265339_101018133 | 148 |
| 200 | 3300031250 | Ga0265331_10000051 | Ga0265331_10000051108 | 148 |
| 201 | 3300031250 | Ga0265331_10018225 | Ga0265331_100182253 | 148 |
| 202 | 3300031344 | Ga0265316_10000030 | Ga0265316_1000003050 | 148 |
| 203 | 3300031711 | Ga0265314_10000386 | Ga0265314_1000038624 | 148 |
| 204 | 3300031711 | Ga0265314_10001909 | Ga0265314_1000190917 | 148 |
| 205 | 3300031712 | Ga0265342_10004580 | Ga0265342_1000458012 | 148 |
| 206 | 3300031712 | Ga0265342_10006795 | Ga0265342_1000679510 | 148 |
| 207 | 3300031727 | Ga0316576_11323386 | Ga0316576_113233861 | 148 |
| 208 | 3300035170 | Ga0373943_0374542 | Ga0373943_0374542_206_652 | 148 |
| 209 | 3300036712 | Ga0316584_0501611 | Ga0316584_0501611_19_468 | 148 |
| 210 | 3300039062 | Ga0400483_277133 | Ga0400483_277133_1335_1784 | 148 |
| 211 | 3300039093 | Ga0400489_91703 | Ga0400489_91703_2360_2809 | 148 |
| 212 | 3300044712 | Ga0453684_0020337 | Ga0453684_0020337_6862_7311 | 148 |
| 213 | 3300044712 | Ga0453684_0193952 | Ga0453684_0193952_1168_1620 | 148 |
| 214 | 3300046472 | Ga0495580_0517609 | Ga0495580_0517609_319_765 | 148 |
| 215 | 3300046615 | Ga0495656_0025905 | Ga0495656_0025905_866_1318 | 148 |
| 216 | 3300047318 | Ga0495636_0293330 | Ga0495636_0293330_282_728 | 148 |
| 217 | 3300048912 | Ga0496109_0368542 | Ga0496109_0368542_419_865 | 148 |
| 218 | 3300048913 | Ga0496110_0597181 | Ga0496110_0597181_230_676 | 148 |
| 219 | 3300048914 | Ga0496111_0756611 | Ga0496111_0756611_14_460 | 148 |
| 220 | 3300049744 | Ga0501083_0598361 | Ga0501083_0598361_227_673 | 148 |
| 221 | 3300050507 | nmdc:mga05p37_119912_c1 | nmdc:mga05p37_119912_c1_2206_2655 | 148 |
| 222 | 3300005330 | Ga0070690_100661472 | Ga0070690_1006614722 | 149 |
| 223 | 3300005345 | Ga0070692_10013367 | Ga0070692_100133673 | 149 |
| 224 | 3300005356 | Ga0070674_101298131 | Ga0070674_1012981311 | 149 |
| 225 | 3300005444 | Ga0070694_100018718 | Ga0070694_1000187182 | 149 |
| 226 | 3300005444 | Ga0070694_100201726 | Ga0070694_1002017262 | 149 |
| 227 | 3300005471 | Ga0070698_100228919 | Ga0070698_1002289194 | 149 |
| 228 | 3300005518 | Ga0070699_100493130 | Ga0070699_1004931301 | 149 |
| 229 | 3300005530 | Ga0070679_100014924 | Ga0070679_1000149246 | 149 |
| 230 | 3300005549 | Ga0070704_100625246 | Ga0070704_1006252461 | 149 |
| 231 | 3300005577 | Ga0068857_100006740 | Ga0068857_1000067406 | 149 |
| 232 | 3300006195 | Ga0075366_10016930 | Ga0075366_100169303 | 149 |
| 233 | 3300006358 | Ga0068871_101889765 | Ga0068871_1018897651 | 149 |
| 234 | 3300006852 | Ga0075433_10036433 | Ga0075433_100364334 | 149 |
| 235 | 3300006871 | Ga0075434_100083471 | Ga0075434_1000834715 | 149 |
| 236 | 3300009176 | Ga0105242_10640028 | Ga0105242_106400281 | 149 |
| 237 | 3300013307 | Ga0157372_10692311 | Ga0157372_106923112 | 149 |
| 238 | 3300025921 | Ga0207652_10012154 | Ga0207652_100121546 | 149 |
| 239 | 3300026075 | Ga0207708_10318945 | Ga0207708_103189452 | 149 |
| 240 | 3300026116 | Ga0207674_10007543 | Ga0207674_1000754311 | 149 |
| 241 | 3300031240 | Ga0265320_10010947 | Ga0265320_100109471 | 149 |
| 242 | 3300031241 | Ga0265325_10059881 | Ga0265325_100598812 | 149 |
| 243 | 3300031250 | Ga0265331_10040566 | Ga0265331_100405662 | 149 |
| 244 | 3300031595 | Ga0265313_10038183 | Ga0265313_100381833 | 149 |
| 245 | 3300031665 | Ga0316575_10017319 | Ga0316575_100173193 | 149 |
| 246 | 3300031691 | Ga0316579_10049842 | Ga0316579_100498421 | 149 |
| 247 | 3300031691 | Ga0316579_10094344 | Ga0316579_100943442 | 149 |
| 248 | 3300031727 | Ga0316576_10001562 | Ga0316576_100015627 | 149 |
| 249 | 3300031727 | Ga0316576_10262147 | Ga0316576_102621472 | 149 |
| 250 | 3300031727 | Ga0316576_10482577 | Ga0316576_104825772 | 149 |
| 251 | 3300031728 | Ga0316578_10009992 | Ga0316578_100099921 | 149 |
| 252 | 3300031728 | Ga0316578_10403894 | Ga0316578_104038941 | 149 |
| 253 | 3300031733 | Ga0316577_10303278 | Ga0316577_103032781 | 149 |
| 254 | 3300031733 | Ga0316577_10410311 | Ga0316577_104103111 | 149 |
| 255 | 3300031733 | Ga0316577_10607919 | Ga0316577_106079191 | 149 |
| 256 | 3300032137 | Ga0316585_10007039 | Ga0316585_100070392 | 149 |
| 257 | 3300032139 | Ga0316580_10075760 | Ga0316580_100757602 | 149 |
| 258 | 3300035119 | Ga0373956_0197859 | Ga0373956_0197859_462_911 | 149 |
| 259 | 3300035398 | Ga0316574_0223966 | Ga0316574_0223966_277_726 | 149 |
| 260 | 3300036647 | Ga0316582_0060285 | Ga0316582_0060285_1258_1707 | 149 |
| 261 | 3300036647 | Ga0316582_0148339 | Ga0316582_0148339_987_1436 | 149 |
| 262 | 3300036647 | Ga0316582_1170256 | Ga0316582_1170256_22_471 | 149 |
| 263 | 3300036712 | Ga0316584_0000778 | Ga0316584_0000778_7629_8078 | 149 |
| 264 | 3300036712 | Ga0316584_0282698 | Ga0316584_0282698_236_685 | 149 |
| 265 | 3300036712 | Ga0316584_0314066 | Ga0316584_0314066_301_750 | 149 |
| 266 | 3300044673 | Ga0453683_0000029 | Ga0453683_0000029_214132_214593 | 149 |
| 267 | 3300044673 | Ga0453683_0053416 | Ga0453683_0053416_1576_2025 | 149 |
| 268 | 3300044712 | Ga0453684_0007550 | Ga0453684_0007550_16703_17155 | 149 |
| 269 | 3300044712 | Ga0453684_0046036 | Ga0453684_0046036_2828_3277 | 149 |
| 270 | 3300044712 | Ga0453684_0316493 | Ga0453684_0316493_451_900 | 149 |
| 271 | 3300044712 | Ga0453684_0363221 | Ga0453684_0363221_204_653 | 149 |
| 272 | 3300045051 | Ga0451576_0000078 | Ga0451576_0000078_214110_214571 | 149 |
| 273 | 3300045051 | Ga0451576_0000123 | Ga0451576_0000123_187772_188221 | 149 |
| 274 | 3300045051 | Ga0451576_1348884 | Ga0451576_1348884_54_503 | 149 |
| 275 | 3300049577 | Ga0501041_0307428 | Ga0501041_0307428_242_691 | 149 |
| 276 | 3300049583 | Ga0501067_0065096 | Ga0501067_0065096_1542_1991 | 149 |
| 277 | 3300050493 | nmdc:mga0k408_16223_c1 | nmdc:mga0k408_16223_c1_3194_3643 | 149 |
| 278 | 3300050512 | nmdc:mga0n895_27679_c1 | nmdc:mga0n895_27679_c1_4412_4861 | 149 |
| 279 | 3300050515 | nmdc:mga0a205_231515_c1 | nmdc:mga0a205_231515_c1_549_998 | 149 |
| 280 | 3300053085 | Ga0495619_0003996 | Ga0495619_0003996_5717_6166 | 149 |
| 281 | 3300006844 | Ga0075428_100000709 | Ga0075428_10000070919 | 150 |
| 282 | 3300006846 | Ga0075430_100019347 | Ga0075430_1000193474 | 150 |
| 283 | 3300006871 | Ga0075434_100553305 | Ga0075434_1005533052 | 150 |
| 284 | 3300029957 | Ga0265324_10052856 | Ga0265324_100528562 | 150 |
| 285 | 3300050509 | nmdc:mga0qj67_13736_c1 | nmdc:mga0qj67_13736_c1_3359_3823 | 150 |
| 286 | 3300050510 | nmdc:mga06r32_225770_c1 | nmdc:mga06r32_225770_c1_915_1379 | 150 |
| 287 | 3300050512 | nmdc:mga0n895_802925_c1 | nmdc:mga0n895_802925_c1_10_462 | 150 |
| 288 | 3300009147 | Ga0114129_10416244 | Ga0114129_104162443 | 151 |
| 289 | 3300031691 | Ga0316579_10090389 | Ga0316579_100903892 | 151 |
| 290 | 3300031995 | Ga0307409_102072085 | Ga0307409_1020720851 | 151 |
| 291 | 3300032137 | Ga0316585_10086174 | Ga0316585_100861742 | 151 |
| 292 | 3300032168 | Ga0316593_10010562 | Ga0316593_100105622 | 151 |
| 293 | 3300036647 | Ga0316582_0001992 | Ga0316582_0001992_6031_6486 | 151 |
| 294 | 3300036647 | Ga0316582_0006408 | Ga0316582_0006408_2064_2519 | 151 |
| 295 | 3300036647 | Ga0316582_0028721 | Ga0316582_0028721_1735_2190 | 151 |
| 296 | 3300036712 | Ga0316584_0132670 | Ga0316584_0132670_272_727 | 151 |
| 297 | 3300037588 | Ga0316581_0009838 | Ga0316581_0009838_2005_2460 | 151 |
| 298 | 3300050508 | nmdc:mga09592_1611934_c1 | nmdc:mga09592_1611934_c1_22_477 | 151 |
| 299 | 3300005843 | Ga0068860_100544016 | Ga0068860_1005440162 | 152 |
| 300 | 3300028381 | Ga0268264_10407730 | Ga0268264_104077302 | 152 |
| 301 | 3300049686 | Ga0501257_013612 | Ga0501257_013612_645_1106 | 152 |
| 302 | 3300005329 | Ga0070683_100791600 | Ga0070683_1007916002 | 153 |
| 303 | 3300005337 | Ga0070682_100363329 | Ga0070682_1003633291 | 153 |
| 304 | 3300005441 | Ga0070700_100056341 | Ga0070700_1000563414 | 153 |
| 305 | 3300005441 | Ga0070700_100511842 | Ga0070700_1005118422 | 153 |
| 306 | 3300005444 | Ga0070694_100433900 | Ga0070694_1004339002 | 153 |
| 307 | 3300005535 | Ga0070684_101377468 | Ga0070684_1013774681 | 153 |
| 308 | 3300005549 | Ga0070704_100151765 | Ga0070704_1001517652 | 153 |
| 309 | 3300005985 | Ga0081539_10012741 | Ga0081539_100127412 | 153 |
| 310 | 3300006844 | Ga0075428_100002340 | Ga0075428_10000234021 | 153 |
| 311 | 3300006844 | Ga0075428_100901533 | Ga0075428_1009015332 | 153 |
| 312 | 3300006846 | Ga0075430_100260606 | Ga0075430_1002606062 | 153 |
| 313 | 3300006847 | Ga0075431_100243616 | Ga0075431_1002436162 | 153 |
| 314 | 3300006880 | Ga0075429_100280055 | Ga0075429_1002800552 | 153 |
| 315 | 3300009094 | Ga0111539_10193249 | Ga0111539_101932492 | 153 |
| 316 | 3300009094 | Ga0111539_10335747 | Ga0111539_103357472 | 153 |
| 317 | 3300009147 | Ga0114129_10571828 | Ga0114129_105718281 | 153 |
| 318 | 3300009148 | Ga0105243_10589069 | Ga0105243_105890692 | 153 |
| 319 | 3300009553 | Ga0105249_10448340 | Ga0105249_104483402 | 153 |
| 320 | 3300025899 | Ga0207642_10034470 | Ga0207642_100344701 | 153 |
| 321 | 3300025961 | Ga0207712_10117188 | Ga0207712_101171882 | 153 |
| 322 | 3300026118 | Ga0207675_101572432 | Ga0207675_1015724322 | 153 |
| 323 | 3300050510 | nmdc:mga06r32_1226239_c1 | nmdc:mga06r32_1226239_c1_72_623 | 153 |
| 324 | 3300050511 | nmdc:mga08y16_266645_c1 | nmdc:mga08y16_266645_c1_145_696 | 153 |
| 325 | 3300005347 | Ga0070668_100471848 | Ga0070668_1004718482 | 155 |
| 326 | 3300006844 | Ga0075428_101440492 | Ga0075428_1014404921 | 155 |
| 327 | 3300006852 | Ga0075433_10008456 | Ga0075433_100084567 | 155 |
| 328 | 3300006852 | Ga0075433_10636672 | Ga0075433_106366722 | 155 |
| 329 | 3300031727 | Ga0316576_10001763 | Ga0316576_100017639 | 155 |
| 330 | 3300031728 | Ga0316578_10057734 | Ga0316578_100577342 | 155 |
| 331 | 3300031733 | Ga0316577_10000518 | Ga0316577_100005187 | 155 |
| 332 | 3300032126 | Ga0307415_101751850 | Ga0307415_1017518501 | 155 |
| 333 | 3300032133 | Ga0316583_10001244 | Ga0316583_100012444 | 155 |
| 334 | 3300032137 | Ga0316585_10001370 | Ga0316585_100013702 | 155 |
| 335 | 3300032139 | Ga0316580_10000027 | Ga0316580_1000002710 | 155 |
| 336 | 3300033524 | Ga0316592_1004570 | Ga0316592_10045702 | 155 |
| 337 | 3300035398 | Ga0316574_0000009 | Ga0316574_0000009_12643_13110 | 155 |
| 338 | 3300036647 | Ga0316582_0000243 | Ga0316582_0000243_6450_6917 | 155 |
| 339 | 3300036712 | Ga0316584_0001053 | Ga0316584_0001053_14623_15090 | 155 |
| 340 | 3300037588 | Ga0316581_0001730 | Ga0316581_0001730_233_700 | 155 |
| 341 | 3300041453 | Ga0451797_1137418 | Ga0451797_1137418_246_713 | 155 |
| 342 | 3300048911 | Ga0496108_0000059 | Ga0496108_0000059_99185_99652 | 155 |
| 343 | 3300050515 | nmdc:mga0a205_139931_c1 | nmdc:mga0a205_139931_c1_351_863 | 155 |
| 344 | 3300050515 | nmdc:mga0a205_19109_c1 | nmdc:mga0a205_19109_c1_2754_3221 | 155 |
| 345 | 3300026075 | Ga0207708_11267145 | Ga0207708_112671451 | 156 |
| 346 | 3300003316 | rootH1_10037274 | rootH1_100372743 | 157 |
| 347 | 3300005334 | Ga0068869_100223011 | Ga0068869_1002230112 | 157 |
| 348 | 3300005440 | Ga0070705_100395599 | Ga0070705_1003955991 | 157 |
| 349 | 3300005444 | Ga0070694_100233824 | Ga0070694_1002338242 | 157 |
| 350 | 3300005617 | Ga0068859_100016119 | Ga0068859_1000161194 | 157 |
| 351 | 3300005844 | Ga0068862_100031175 | Ga0068862_1000311753 | 157 |
| 352 | 3300005937 | Ga0081455_10058369 | Ga0081455_100583694 | 157 |
| 353 | 3300006931 | Ga0097620_100016119 | Ga0097620_1000161194 | 157 |
| 354 | 3300009177 | Ga0105248_10702699 | Ga0105248_107026992 | 157 |
| 355 | 3300025908 | Ga0207643_10646460 | Ga0207643_106464601 | 157 |
| 356 | 3300025942 | Ga0207689_10353408 | Ga0207689_103534082 | 157 |
| 357 | 3300025961 | Ga0207712_10245831 | Ga0207712_102458312 | 157 |
| 358 | 3300026116 | Ga0207674_10161244 | Ga0207674_101612443 | 157 |
| 359 | 3300028380 | Ga0268265_10022224 | Ga0268265_100222243 | 157 |
| 360 | 3300046499 | Ga0495594_0279498 | Ga0495594_0279498_243_716 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1j7g-assembly1.cif.gz_A-2 | structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase | 0.978 | 1 | 144 |
| 2dbo-assembly1.cif.gz_A-2 | crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus | 0.9776 | 1 | 146 |
| 1j7g-assembly1.cif.gz_A-2 | structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase | 0.9647 | 1 | 144 |
| 3lmv-assembly2.cif.gz_C | d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes | 0.9615 | 1 | 146 |
| 3knf-assembly2.cif.gz_D | crystal structure of d-tyr-trna(tyr) deacylase from plasmodium falciparum | 0.9607 | 1 | 147 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXU2_1_149_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9833 | 1 | 144 | 3.50.80.10 |
| af_Q07648_1_150_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9793 | 1 | 146 | 3.50.80.10 |
| 1j7gA00 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.978 | 1 | 144 | 3.50.80.10 |
| 2dboA00 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9776 | 1 | 146 | 3.50.80.10 |
| af_O14274_1_149_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9729 | 1 | 146 | 3.50.80.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A524H0K9-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9988 | 1 | 144 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A520Y269-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9988 | 1 | 144 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A0P9FGD0-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9985 | 1 | 149 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-F6B2Z3-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9985 | 2 | 146 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A3C0XMB6-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9978 | 5 | 141 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar