F421844

General Info

Members Datasets Scaffolds Average Seq Length
360 176 357 149

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10636672|Ga0075433_106366722
Length 170
Sequence VIEEGNDVTLSPWQDMRAVIQRVNEASVTVEEEVVGQIGLGLLVLLGVGRDDGAAEATLLAEKIAAMRIFPDGEGRFNRSALDAGGAVLVVSQFTLYADTRRGRRPSFSDAAPPEAAAPLVDAFADALRQQGLAVATGSFGAHMRVALINDGPVTIVLDSERFREPRRMH

Samples

Sample ID Description Type Environment
1 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
2 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
90 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
93 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
102 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
106 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
107 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
113 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
114 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
115 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
124 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
125 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
126 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
127 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
135 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
176 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.94
Metatranscriptomes 2.22
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.39
Nodule 0
Rhizoplane 1.39
Rhizosphere 95.28
Stem 0
Stem Tuber 0
Unclassified 1.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10037274 3300003316 Bacteria 2414
2 rootH1_10110869 3300003323 Bacteria 3946
3 JGI25407J50210_10030845 3300003373 Bacteria 1388
4 Ga0070683_100791600 3300005329 Bacteria 909
5 Ga0070690_100661472 3300005330 Bacteria 799
6 Ga0068869_100223011 3300005334 Bacteria 1495
7 Ga0070682_100010187 3300005337 Bacteria 5331
8 Ga0070682_100363329 3300005337 Bacteria 1083
9 Ga0070660_100004242 3300005339 Bacteria 9898
10 Ga0070689_100010919 3300005340 Bacteria 6489
11 Ga0070692_10013367 3300005345 Bacteria 3824
12 Ga0070668_100471848 3300005347 Bacteria 1082
13 Ga0070674_101298131 3300005356 Bacteria 649
14 Ga0070659_100076202 3300005366 Bacteria 2675
15 Ga0070667_100198802 3300005367 Bacteria 1778
16 Ga0070705_100395599 3300005440 Bacteria 1022
17 Ga0070700_100056341 3300005441 Unclassified 2463
18 Ga0070700_100511842 3300005441 Bacteria 925
19 Ga0070694_100018718 3300005444 Bacteria 4399
20 Ga0070694_100201726 3300005444 Bacteria 1483
21 Ga0070694_100233824 3300005444 Bacteria 1384
22 Ga0070694_100433900 3300005444 Bacteria 1034
23 Ga0070708_100000866 3300005445 Bacteria 22856
24 Ga0070706_100166767 3300005467 Bacteria 2056
25 Ga0070706_100344557 3300005467 Bacteria 1389
26 Ga0070698_100028261 3300005471 Bacteria 5827
27 Ga0070698_100033046 3300005471 Bacteria 5360
28 Ga0070698_100228919 3300005471 Bacteria 1792
29 Ga0070699_100493130 3300005518 Bacteria 1112
30 Ga0070679_100014924 3300005530 Bacteria 7462
31 Ga0070679_100162724 3300005530 Bacteria 2205
32 Ga0070684_100181636 3300005535 Bacteria 1913
33 Ga0070684_101377468 3300005535 Bacteria 664
34 Ga0070697_100191474 3300005536 Bacteria 1736
35 Ga0070697_100452436 3300005536 Bacteria 1119
36 Ga0070695_100009496 3300005545 Bacteria 5793
37 Ga0070704_100151765 3300005549 Bacteria 1822
38 Ga0070704_100625246 3300005549 Bacteria 948
39 Ga0068857_100006740 3300005577 Bacteria 9876
40 Ga0068854_100770853 3300005578 Bacteria 836
41 Ga0068854_101753540 3300005578 Unclassified 568
42 Ga0068852_100056374 3300005616 Bacteria 3396
43 Ga0068859_100016119 3300005617 Bacteria 7505
44 Ga0068859_100346344 3300005617 Bacteria 1580
45 Ga0068859_100913629 3300005617 Bacteria 962
46 Ga0068864_100892321 3300005618 Bacteria 878
47 Ga0068861_101508848 3300005719 Bacteria 660
48 Ga0068870_10235926 3300005840 Bacteria 1127
49 Ga0068860_100544016 3300005843 Bacteria 1163
50 Ga0068862_100019345 3300005844 Bacteria 5682
51 Ga0068862_100031175 3300005844 Bacteria 4498
52 Ga0068862_100170610 3300005844 Bacteria 1948
53 Ga0068862_100716901 3300005844 Bacteria 970
54 Ga0081455_10058369 3300005937 Bacteria 3265
55 Ga0081538_10000006 3300005981 Bacteria 181056
56 Ga0081539_10012741 3300005985 Bacteria 6432
57 Ga0075364_10084511 3300006051 Bacteria 2102
58 Ga0075366_10016930 3300006195 Bacteria 4190
59 Ga0068871_101889765 3300006358 Unclassified 567
60 Ga0075428_100000709 3300006844 Bacteria 34431
61 Ga0075428_100002340 3300006844 Bacteria 20568
62 Ga0075428_100901533 3300006844 Bacteria 938
63 Ga0075428_101440492 3300006844 Unclassified 722
64 Ga0075428_101682219 3300006844 Bacteria 662
65 Ga0075430_100019347 3300006846 Bacteria 5789
66 Ga0075430_100260606 3300006846 Bacteria 1436
67 Ga0075431_100023362 3300006847 Bacteria 6325
68 Ga0075431_100243616 3300006847 Bacteria 1828
69 Ga0075433_10008456 3300006852 Bacteria 8214
70 Ga0075433_10036433 3300006852 Bacteria 4238
71 Ga0075433_10636672 3300006852 Unclassified 935
72 Ga0075434_100083471 3300006871 Bacteria 3192
73 Ga0075434_100553305 3300006871 Bacteria 1170
74 Ga0075429_100089579 3300006880 Unclassified 2682
75 Ga0075429_100280055 3300006880 Bacteria 1460
76 Ga0075429_100948647 3300006880 Bacteria 752
77 Ga0097620_100016119 3300006931 Bacteria 7505
78 Ga0097620_100346355 3300006931 Bacteria 1580
79 Ga0097620_100913501 3300006931 Bacteria 962
80 Ga0111539_10010924 3300009094 Bacteria 11428
81 Ga0111539_10193249 3300009094 Bacteria 2374
82 Ga0111539_10335747 3300009094 Bacteria 1759
83 Ga0114129_10387460 3300009147 Unclassified 1844
84 Ga0114129_10416244 3300009147 Bacteria 1769
85 Ga0114129_10571828 3300009147 Bacteria 1467
86 Ga0105243_10589069 3300009148 Bacteria 1069
87 Ga0105241_12446181 3300009174 Unclassified 522
88 Ga0105242_10112079 3300009176 Bacteria 2327
89 Ga0105242_10640028 3300009176 Unclassified 1033
90 Ga0105248_10702699 3300009177 Bacteria 1141
91 Ga0105249_10448340 3300009553 Bacteria 1329
92 Ga0105249_10761811 3300009553 Unclassified 1030
93 Ga0105028_102739 3300009993 Unclassified 1852
94 Ga0105246_10014787 3300011119 Unclassified 4915
95 Ga0105246_11460241 3300011119 Unclassified 641
96 Ga0157371_10023244 3300013102 Bacteria 4533
97 Ga0163162_10818970 3300013306 Bacteria 1048
98 Ga0157372_10692311 3300013307 Unclassified 1186
99 Ga0157372_10829027 3300013307 Bacteria 1074
100 Ga0163163_10778933 3300014325 Bacteria 1020
101 Ga0157380_10243276 3300014326 Bacteria 1624
102 Ga0157380_11647841 3300014326 Bacteria 698
103 Ga0206354_10018681 3300020081 Bacteria 1494
104 Ga0206354_10806462 3300020081 Bacteria 1402
105 Ga0206353_11690045 3300020082 Bacteria 6863
106 Ga0207642_10034470 3300025899 Bacteria 2153
107 Ga0207643_10646460 3300025908 Bacteria 682
108 Ga0207684_10683978 3300025910 Unclassified 873
109 Ga0207707_10007237 3300025912 Bacteria 9658
110 Ga0207660_10004447 3300025917 Bacteria 9130
111 Ga0207657_10007354 3300025919 Bacteria 11299
112 Ga0207652_10012154 3300025921 Bacteria 6955
113 Ga0207652_10021094 3300025921 Bacteria 5374
114 Ga0207646_11150428 3300025922 Bacteria 682
115 Ga0207686_10149158 3300025934 Bacteria 1626
116 Ga0207670_10015334 3300025936 Unclassified 4577
117 Ga0207711_11310075 3300025941 Bacteria 666
118 Ga0207689_10353408 3300025942 Bacteria 1222
119 Ga0207712_10117188 3300025961 Bacteria 2008
120 Ga0207712_10245831 3300025961 Bacteria 1443
121 Ga0207658_10488481 3300025986 Bacteria 1095
122 Ga0207703_10253617 3300026035 Bacteria 1587
123 Ga0207708_10318945 3300026075 Unclassified 1268
124 Ga0207708_11267145 3300026075 Unclassified 645
125 Ga0207641_11454920 3300026088 Bacteria 687
126 Ga0207674_10007543 3300026116 Bacteria 12673
127 Ga0207674_10161244 3300026116 Unclassified 2197
128 Ga0207675_100915787 3300026118 Bacteria 893
129 Ga0207675_101572432 3300026118 Bacteria 678
130 Ga0207428_10035807 3300027907 Bacteria 4054
131 Ga0268265_10022224 3300028380 Bacteria 4454
132 Ga0268265_10079981 3300028380 Bacteria 2576
133 Ga0268265_10153130 3300028380 Bacteria 1947
134 Ga0268264_10407730 3300028381 Bacteria 1308
135 Ga0265323_10033292 3300028653 Unclassified 1909
136 Ga0265324_10052856 3300029957 Bacteria 1395
137 Ga0265330_10012400 3300031235 Bacteria 3987
138 Ga0265330_10030228 3300031235 Bacteria 2434
139 Ga0265332_10000071 3300031238 Bacteria 86362
140 Ga0265328_10026116 3300031239 Bacteria 2197
141 Ga0265320_10010947 3300031240 Bacteria 5363
142 Ga0265320_10026755 3300031240 Bacteria 3015
143 Ga0265325_10059881 3300031241 Bacteria 1936
144 Ga0265329_10007586 3300031242 Bacteria 4183
145 Ga0265339_10003939 3300031249 Bacteria 10268
146 Ga0265339_10101813 3300031249 Bacteria 1494
147 Ga0265331_10000051 3300031250 Bacteria 181262
148 Ga0265331_10018225 3300031250 Bacteria 3646
149 Ga0265331_10040566 3300031250 Unclassified 2264
150 Ga0265316_10000030 3300031344 Bacteria 162620
151 Ga0265313_10038183 3300031595 Bacteria 2394
152 Ga0316575_10004204 3300031665 Bacteria 5052
153 Ga0316575_10017319 3300031665 Unclassified 2736
154 Ga0316579_10002620 3300031691 Bacteria 6830
155 Ga0316579_10049842 3300031691 Bacteria 1957
156 Ga0316579_10090389 3300031691 Bacteria 1462
157 Ga0316579_10094344 3300031691 Unclassified 1430
158 Ga0316579_10316298 3300031691 Bacteria 755
159 Ga0265314_10000386 3300031711 Bacteria 59716
160 Ga0265314_10001909 3300031711 Bacteria 22269
161 Ga0265342_10004580 3300031712 Bacteria 10801
162 Ga0265342_10006795 3300031712 Bacteria 8472
163 Ga0316576_10001562 3300031727 Bacteria 12429
164 Ga0316576_10001763 3300031727 Bacteria 11951
165 Ga0316576_10004967 3300031727 Bacteria 8057
166 Ga0316576_10137316 3300031727 Bacteria 1840
167 Ga0316576_10262147 3300031727 Bacteria 1296
168 Ga0316576_10482577 3300031727 Bacteria 913
169 Ga0316576_10492015 3300031727 Unclassified 903
170 Ga0316576_10748883 3300031727 Bacteria 705
171 Ga0316576_11216830 3300031727 Bacteria 532
172 Ga0316576_11323386 3300031727 Unclassified 507
173 Ga0316578_10001355 3300031728 Bacteria 9870
174 Ga0316578_10009992 3300031728 Unclassified 4908
175 Ga0316578_10057734 3300031728 Unclassified 2280
176 Ga0316578_10057855 3300031728 Bacteria 2278
177 Ga0316578_10157602 3300031728 Bacteria 1368
178 Ga0316578_10403894 3300031728 Archaea 809
179 Ga0316577_10000518 3300031733 Bacteria 15462
180 Ga0316577_10002642 3300031733 Bacteria 8899
181 Ga0316577_10032211 3300031733 Bacteria 2928
182 Ga0316577_10303278 3300031733 Unclassified 905
183 Ga0316577_10410311 3300031733 Unclassified 769
184 Ga0316577_10607919 3300031733 Bacteria 622
185 Ga0307406_10367975 3300031901 Bacteria 1129
186 Ga0307409_102072085 3300031995 Bacteria 599
187 Ga0307416_101595005 3300032002 Bacteria 758
188 Ga0307415_101751850 3300032126 Unclassified 600
189 Ga0316583_10001244 3300032133 Bacteria 8387
190 Ga0316585_10001370 3300032137 Bacteria 6412
191 Ga0316585_10007039 3300032137 Bacteria 3229
192 Ga0316585_10022001 3300032137 Bacteria 1960
193 Ga0316585_10032879 3300032137 Bacteria 1635
194 Ga0316585_10086174 3300032137 Bacteria 1025
195 Ga0316585_10109540 3300032137 Bacteria 907
196 Ga0316580_10000027 3300032139 Bacteria 22899
197 Ga0316580_10011508 3300032139 Bacteria 2687
198 Ga0316580_10040445 3300032139 Bacteria 1441
199 Ga0316580_10075760 3300032139 Archaea 1029
200 Ga0316593_10010562 3300032168 Bacteria 2652
201 Ga0316593_10042463 3300032168 Bacteria 1517
202 Ga0316593_10307757 3300032168 Unclassified 601
203 Ga0316592_1004570 3300033524 Unclassified 2580
204 Ga0316596_1033446 3300033541 Bacteria 1340
205 Ga0373956_0197859 3300035119 Bacteria 952
206 Ga0373943_0374542 3300035170 Unclassified 819
207 Ga0316574_0000009 3300035398 Bacteria 45904
208 Ga0316574_0002126 3300035398 Bacteria 9826
209 Ga0316574_0223966 3300035398 Unclassified 1204
210 Ga0316582_0000243 3300036647 Bacteria 18067
211 Ga0316582_0001992 3300036647 Bacteria 9360
212 Ga0316582_0002441 3300036647 Bacteria 8738
213 Ga0316582_0006408 3300036647 Bacteria 6176
214 Ga0316582_0015911 3300036647 Bacteria 4315
215 Ga0316582_0028721 3300036647 Bacteria 3372
216 Ga0316582_0060285 3300036647 Bacteria 2432
217 Ga0316582_0111953 3300036647 Bacteria 1818
218 Ga0316582_0148339 3300036647 Bacteria 1584
219 Ga0316582_0347775 3300036647 Bacteria 1020
220 Ga0316582_0586484 3300036647 Bacteria 768
221 Ga0316582_0767214 3300036647 Bacteria 661
222 Ga0316582_1170256 3300036647 Unclassified 524
223 Ga0316584_0000778 3300036712 Bacteria 17873
224 Ga0316584_0001053 3300036712 Bacteria 16063
225 Ga0316584_0001256 3300036712 Bacteria 14986
226 Ga0316584_0003201 3300036712 Bacteria 10598
227 Ga0316584_0020594 3300036712 Bacteria 4785
228 Ga0316584_0105680 3300036712 Bacteria 2107
229 Ga0316584_0132670 3300036712 Bacteria 1860
230 Ga0316584_0282698 3300036712 Bacteria 1205
231 Ga0316584_0314066 3300036712 Bacteria 1132
232 Ga0316584_0423848 3300036712 Bacteria 945
233 Ga0316584_0498836 3300036712 Unclassified 855
234 Ga0316584_0501611 3300036712 Unclassified 853
235 Ga0316584_0549520 3300036712 Bacteria 806
236 Ga0316584_0860550 3300036712 Bacteria 613
237 Ga0316581_0001730 3300037588 Bacteria 5026
238 Ga0316581_0004822 3300037588 Bacteria 3471
239 Ga0316581_0009838 3300037588 Bacteria 2638
240 Ga0316581_0083923 3300037588 Bacteria 980
241 Ga0316581_0181348 3300037588 Bacteria 649
242 Ga0400483_277133 3300039062 Bacteria 2078
243 Ga0400489_47960 3300039093 Bacteria 5007
244 Ga0400489_91703 3300039093 Bacteria 3122
245 Ga0451797_1137418 3300041453 Bacteria 993
246 Ga0450913_026620 3300042117 Bacteria 555
247 Ga0451577_0036189 3300042876 Bacteria 4445
248 Ga0451577_0127518 3300042876 Bacteria 2281
249 Ga0453683_0000029 3300044673 Bacteria 243061
250 Ga0453683_0029399 3300044673 Bacteria 3474
251 Ga0453683_0053416 3300044673 Bacteria 2528
252 Ga0453683_0445568 3300044673 Unclassified 837
253 Ga0453683_0536509 3300044673 Bacteria 761
254 Ga0453683_0713949 3300044673 Bacteria 657
255 Ga0453684_0000035 3300044712 Bacteria 725956
256 Ga0453684_0000402 3300044712 Bacteria 178427
257 Ga0453684_0007550 3300044712 Bacteria 19936
258 Ga0453684_0020337 3300044712 Bacteria 10021
259 Ga0453684_0043555 3300044712 Bacteria 6030
260 Ga0453684_0046036 3300044712 Bacteria 5810
261 Ga0453684_0057334 3300044712 Bacteria 5042
262 Ga0453684_0079884 3300044712 Bacteria 4087
263 Ga0453684_0080463 3300044712 Bacteria 4068
264 Ga0453684_0087039 3300044712 Bacteria 3874
265 Ga0453684_0110150 3300044712 Bacteria 3347
266 Ga0453684_0193952 3300044712 Unclassified 2374
267 Ga0453684_0206762 3300044712 Bacteria 2284
268 Ga0453684_0244965 3300044712 Bacteria 2062
269 Ga0453684_0296311 3300044712 Unclassified 1840
270 Ga0453684_0316493 3300044712 Bacteria 1769
271 Ga0453684_0363221 3300044712 Bacteria 1629
272 Ga0453684_0409468 3300044712 Bacteria 1517
273 Ga0453684_0479246 3300044712 Bacteria 1380
274 Ga0453684_0549015 3300044712 Bacteria 1273
275 Ga0453684_0649663 3300044712 Bacteria 1151
276 Ga0453684_0864464 3300044712 Bacteria 971
277 Ga0453684_1142514 3300044712 Bacteria 821
278 Ga0453684_1239068 3300044712 Unclassified 781
279 Ga0453684_1341579 3300044712 Unclassified 744
280 Ga0453684_1667622 3300044712 Bacteria 652
281 Ga0453684_2401220 3300044712 Bacteria 522
282 Ga0451576_0000078 3300045051 Bacteria 243039
283 Ga0451576_0000123 3300045051 Bacteria 196806
284 Ga0451576_0002907 3300045051 Bacteria 24422
285 Ga0451576_0015115 3300045051 Bacteria 8568
286 Ga0451576_0015535 3300045051 Bacteria 8428
287 Ga0451576_0048196 3300045051 Bacteria 4477
288 Ga0451576_0053778 3300045051 Bacteria 4216
289 Ga0451576_0413092 3300045051 Bacteria 1415
290 Ga0451576_0434473 3300045051 Bacteria 1378
291 Ga0451576_0756695 3300045051 Bacteria 1020
292 Ga0451576_1154139 3300045051 Unclassified 810
293 Ga0451576_1348884 3300045051 Bacteria 743
294 Ga0495580_0517609 3300046472 Bacteria 795
295 Ga0495594_0279498 3300046499 Unclassified 951
296 Ga0495656_0025905 3300046615 Bacteria 2330
297 Ga0495636_0293330 3300047318 Unclassified 760
298 Ga0496108_0000059 3300048911 Bacteria 123078
299 Ga0496109_0368542 3300048912 Bacteria 1357
300 Ga0496110_0597181 3300048913 Bacteria 1002
301 Ga0496111_0756611 3300048914 Bacteria 705
302 Ga0501299_155274 3300049522 Unclassified 580
303 Ga0501033_0312933 3300049570 Bacteria 1104
304 Ga0501034_0806817 3300049571 Unclassified 831
305 Ga0501036_0049995 3300049572 Bacteria 3541
306 Ga0501037_0263825 3300049573 Bacteria 1203
307 Ga0501038_0101291 3300049574 Bacteria 2398
308 Ga0501039_0084554 3300049575 Bacteria 2471
309 Ga0501039_1228779 3300049575 Bacteria 579
310 Ga0501040_0060929 3300049576 Bacteria 2594
311 Ga0501041_0071369 3300049577 Bacteria 2132
312 Ga0501041_0307428 3300049577 Bacteria 999
313 Ga0501041_0499421 3300049577 Unclassified 774
314 Ga0501046_0144838 3300049580 Bacteria 1795
315 Ga0501048_0974192 3300049582 Bacteria 610
316 Ga0501067_0065096 3300049583 Bacteria 2018
317 Ga0501068_0172754 3300049584 Bacteria 1364
318 Ga0501071_0679508 3300049587 Bacteria 792
319 Ga0501072_0027139 3300049588 Bacteria 4468
320 Ga0501072_0363321 3300049588 Bacteria 1149
321 Ga0501075_0034845 3300049591 Bacteria 3751
322 Ga0501075_0062754 3300049591 Unclassified 2801
323 Ga0501076_0052471 3300049592 Bacteria 3230
324 Ga0501076_0329769 3300049592 Bacteria 1252
325 Ga0501257_013612 3300049686 Bacteria 1866
326 Ga0501079_0068275 3300049741 Bacteria 2744
327 Ga0501079_0526927 3300049741 Bacteria 929
328 Ga0501080_0046238 3300049742 Bacteria 4054
329 Ga0501080_1311964 3300049742 Bacteria 620
330 Ga0501081_0045111 3300049743 Bacteria 3027
331 Ga0501083_0598361 3300049744 Bacteria 717
332 Ga0501045_0058046 3300049824 Bacteria 2833
333 nmdc:mga00v17_389991_c1 3300050491 Bacteria 905
334 nmdc:mga0yw44_217223_c1 3300050492 Bacteria 1266
335 nmdc:mga0k408_16223_c1 3300050493 Bacteria 4130
336 nmdc:mga05p37_119912_c1 3300050507 Bacteria 3231
337 nmdc:mga09592_1611934_c1 3300050508 Bacteria 525
338 nmdc:mga09592_73480_c1 3300050508 Unclassified 2905
339 nmdc:mga0qj67_13736_c1 3300050509 Bacteria 6111
340 nmdc:mga06r32_1226239_c1 3300050510 Bacteria 696
341 nmdc:mga06r32_225770_c1 3300050510 Bacteria 1861
342 nmdc:mga06r32_33323_c1 3300050510 Bacteria 4851
343 nmdc:mga08y16_1573_c2 3300050511 Bacteria 22644
344 nmdc:mga08y16_266645_c1 3300050511 Bacteria 1768
345 nmdc:mga0n895_27679_c1 3300050512 Bacteria 5387
346 nmdc:mga0n895_802925_c1 3300050512 Bacteria 931
347 nmdc:mga0a205_139931_c1 3300050515 Unclassified 1801
348 nmdc:mga0a205_184098_c1 3300050515 Bacteria 1982
349 nmdc:mga0a205_19109_c1 3300050515 Bacteria 6459
350 nmdc:mga0a205_231515_c1 3300050515 Bacteria 1731
351 Ga0495619_0003996 3300053085 Bacteria 9454
352 Ga0501082_0049688 3300060353 Bacteria 3617
353 Ga0501082_0286098 3300060353 Bacteria 1435
354 Ga0501082_1952181 3300060353 Bacteria 512
355 Ga0530510_0012391 3300061734 Bacteria 5990
356 Ga0530510_0289406 3300061734 Bacteria 1225
357 Ga0530510_0972364 3300061734 Bacteria 649

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0806817 Ga0501034_0806817_358_816 133
2 3300061734 Ga0530510_0289406 Ga0530510_0289406_22_423 133
3 3300014326 Ga0157380_10243276 Ga0157380_102432762 137
4 3300036647 Ga0316582_0111953 Ga0316582_0111953_1352_1765 137
5 3300003323 rootH1_10110869 rootH1_101108693 139
6 3300009147 Ga0114129_10387460 Ga0114129_103874602 140
7 3300014326 Ga0157380_11647841 Ga0157380_116478412 140
8 3300031901 Ga0307406_10367975 Ga0307406_103679751 141
9 3300042117 Ga0450913_026620 Ga0450913_026620_19_501 141
10 iso_pu_bacteria 8054357960 8054358969 141
11 3300032002 Ga0307416_101595005 Ga0307416_1015950051 142
12 3300036647 Ga0316582_0347775 Ga0316582_0347775_206_634 142
13 3300044712 Ga0453684_0549015 Ga0453684_0549015_10_438 142
14 iso_pu_bacteria 2738541299 2738839438 142
15 3300005337 Ga0070682_100010187 Ga0070682_1000101874 143
16 3300005339 Ga0070660_100004242 Ga0070660_1000042425 143
17 3300005366 Ga0070659_100076202 Ga0070659_1000762024 143
18 3300005530 Ga0070679_100162724 Ga0070679_1001627244 143
19 3300005535 Ga0070684_100181636 Ga0070684_1001816363 143
20 3300005616 Ga0068852_100056374 Ga0068852_1000563743 143
21 3300013307 Ga0157372_10829027 Ga0157372_108290272 143
22 3300020081 Ga0206354_10018681 Ga0206354_100186811 143
23 3300020082 Ga0206353_11690045 Ga0206353_116900457 143
24 3300025912 Ga0207707_10007237 Ga0207707_100072374 143
25 3300025917 Ga0207660_10004447 Ga0207660_100044472 143
26 3300025919 Ga0207657_10007354 Ga0207657_100073544 143
27 3300025921 Ga0207652_10021094 Ga0207652_100210942 143
28 3300044712 Ga0453684_1667622 Ga0453684_1667622_46_495 143
29 3300050510 nmdc:mga06r32_33323_c1 nmdc:mga06r32_33323_c1_2728_3159 143
30 iso_pu_bacteria 2837183177 2837183322 143
31 3300005719 Ga0068861_101508848 Ga0068861_1015088481 144
32 3300005844 Ga0068862_100716901 Ga0068862_1007169012 144
33 3300026118 Ga0207675_100915787 Ga0207675_1009157872 144
34 3300060353 Ga0501082_1952181 Ga0501082_1952181_35_502 144
35 3300003373 JGI25407J50210_10030845 JGI25407J50210_100308452 145
36 3300005340 Ga0070689_100010919 Ga0070689_1000109195 145
37 3300005445 Ga0070708_100000866 Ga0070708_10000086612 145
38 3300005467 Ga0070706_100166767 Ga0070706_1001667673 145
39 3300005467 Ga0070706_100344557 Ga0070706_1003445573 145
40 3300005471 Ga0070698_100033046 Ga0070698_1000330464 145
41 3300005536 Ga0070697_100191474 Ga0070697_1001914743 145
42 3300005536 Ga0070697_100452436 Ga0070697_1004524362 145
43 3300005545 Ga0070695_100009496 Ga0070695_1000094966 145
44 3300005578 Ga0068854_101753540 Ga0068854_1017535402 145
45 3300005617 Ga0068859_100346344 Ga0068859_1003463442 145
46 3300005840 Ga0068870_10235926 Ga0068870_102359261 145
47 3300005844 Ga0068862_100170610 Ga0068862_1001706102 145
48 3300005981 Ga0081538_10000006 Ga0081538_1000000618 145
49 3300006844 Ga0075428_101682219 Ga0075428_1016822192 145
50 3300006847 Ga0075431_100023362 Ga0075431_1000233626 145
51 3300006880 Ga0075429_100089579 Ga0075429_1000895793 145
52 3300006931 Ga0097620_100346355 Ga0097620_1003463552 145
53 3300009174 Ga0105241_12446181 Ga0105241_124461811 145
54 3300009176 Ga0105242_10112079 Ga0105242_101120792 145
55 3300009553 Ga0105249_10761811 Ga0105249_107618112 145
56 3300009993 Ga0105028_102739 Ga0105028_1027393 145
57 3300011119 Ga0105246_10014787 Ga0105246_100147876 145
58 3300011119 Ga0105246_11460241 Ga0105246_114602412 145
59 3300013102 Ga0157371_10023244 Ga0157371_100232444 145
60 3300014325 Ga0163163_10778933 Ga0163163_107789332 145
61 3300025910 Ga0207684_10683978 Ga0207684_106839781 145
62 3300025922 Ga0207646_11150428 Ga0207646_111504281 145
63 3300025934 Ga0207686_10149158 Ga0207686_101491583 145
64 3300025936 Ga0207670_10015334 Ga0207670_100153342 145
65 3300027907 Ga0207428_10035807 Ga0207428_100358073 145
66 3300028380 Ga0268265_10153130 Ga0268265_101531302 145
67 3300028653 Ga0265323_10033292 Ga0265323_100332922 145
68 3300031665 Ga0316575_10004204 Ga0316575_100042042 145
69 3300031691 Ga0316579_10002620 Ga0316579_100026203 145
70 3300031727 Ga0316576_10004967 Ga0316576_100049672 145
71 3300031727 Ga0316576_10137316 Ga0316576_101373163 145
72 3300031727 Ga0316576_10492015 Ga0316576_104920152 145
73 3300031727 Ga0316576_11216830 Ga0316576_112168301 145
74 3300031728 Ga0316578_10001355 Ga0316578_100013554 145
75 3300031728 Ga0316578_10157602 Ga0316578_101576023 145
76 3300031733 Ga0316577_10002642 Ga0316577_100026422 145
77 3300031733 Ga0316577_10032211 Ga0316577_100322114 145
78 3300032137 Ga0316585_10022001 Ga0316585_100220013 145
79 3300032137 Ga0316585_10032879 Ga0316585_100328792 145
80 3300032137 Ga0316585_10109540 Ga0316585_101095402 145
81 3300032139 Ga0316580_10040445 Ga0316580_100404452 145
82 3300032168 Ga0316593_10042463 Ga0316593_100424632 145
83 3300032168 Ga0316593_10307757 Ga0316593_103077572 145
84 3300033541 Ga0316596_1033446 Ga0316596_10334462 145
85 3300035398 Ga0316574_0002126 Ga0316574_0002126_4289_4726 145
86 3300036647 Ga0316582_0002441 Ga0316582_0002441_5282_5719 145
87 3300036647 Ga0316582_0586484 Ga0316582_0586484_268_705 145
88 3300036712 Ga0316584_0001256 Ga0316584_0001256_8956_9393 145
89 3300036712 Ga0316584_0003201 Ga0316584_0003201_8668_9105 145
90 3300036712 Ga0316584_0020594 Ga0316584_0020594_3141_3578 145
91 3300036712 Ga0316584_0105680 Ga0316584_0105680_554_991 145
92 3300036712 Ga0316584_0423848 Ga0316584_0423848_481_918 145
93 3300036712 Ga0316584_0549520 Ga0316584_0549520_98_535 145
94 3300036712 Ga0316584_0860550 Ga0316584_0860550_51_488 145
95 3300037588 Ga0316581_0004822 Ga0316581_0004822_989_1426 145
96 3300037588 Ga0316581_0181348 Ga0316581_0181348_91_528 145
97 3300042876 Ga0451577_0036189 Ga0451577_0036189_3352_3789 145
98 3300042876 Ga0451577_0127518 Ga0451577_0127518_1332_1769 145
99 3300044673 Ga0453683_0029399 Ga0453683_0029399_1951_2388 145
100 3300044673 Ga0453683_0445568 Ga0453683_0445568_130_600 145
101 3300044673 Ga0453683_0536509 Ga0453683_0536509_174_611 145
102 3300044673 Ga0453683_0713949 Ga0453683_0713949_11_448 145
103 3300044712 Ga0453684_0000035 Ga0453684_0000035_649338_649775 145
104 3300044712 Ga0453684_0000402 Ga0453684_0000402_163230_163667 145
105 3300044712 Ga0453684_0043555 Ga0453684_0043555_779_1216 145
106 3300044712 Ga0453684_0057334 Ga0453684_0057334_3505_3942 145
107 3300044712 Ga0453684_0079884 Ga0453684_0079884_2237_2689 145
108 3300044712 Ga0453684_0080463 Ga0453684_0080463_1746_2195 145
109 3300044712 Ga0453684_0087039 Ga0453684_0087039_505_942 145
110 3300044712 Ga0453684_0110150 Ga0453684_0110150_52_489 145
111 3300044712 Ga0453684_0206762 Ga0453684_0206762_1673_2110 145
112 3300044712 Ga0453684_0244965 Ga0453684_0244965_217_654 145
113 3300044712 Ga0453684_0296311 Ga0453684_0296311_776_1213 145
114 3300044712 Ga0453684_0409468 Ga0453684_0409468_891_1328 145
115 3300044712 Ga0453684_0479246 Ga0453684_0479246_689_1198 145
116 3300044712 Ga0453684_0649663 Ga0453684_0649663_59_526 145
117 3300044712 Ga0453684_0864464 Ga0453684_0864464_398_835 145
118 3300044712 Ga0453684_1142514 Ga0453684_1142514_140_589 145
119 3300044712 Ga0453684_1239068 Ga0453684_1239068_141_578 145
120 3300044712 Ga0453684_1341579 Ga0453684_1341579_68_538 145
121 3300044712 Ga0453684_2401220 Ga0453684_2401220_46_495 145
122 3300045051 Ga0451576_0002907 Ga0451576_0002907_14023_14460 145
123 3300045051 Ga0451576_0015115 Ga0451576_0015115_6289_6759 145
124 3300045051 Ga0451576_0048196 Ga0451576_0048196_2658_3095 145
125 3300045051 Ga0451576_0053778 Ga0451576_0053778_1652_2089 145
126 3300045051 Ga0451576_0413092 Ga0451576_0413092_287_796 145
127 3300045051 Ga0451576_0434473 Ga0451576_0434473_468_905 145
128 3300045051 Ga0451576_0756695 Ga0451576_0756695_366_803 145
129 3300045051 Ga0451576_1154139 Ga0451576_1154139_246_683 145
130 3300049522 Ga0501299_155274 Ga0501299_155274_131_568 145
131 3300049575 Ga0501039_1228779 Ga0501039_1228779_67_504 145
132 3300049577 Ga0501041_0499421 Ga0501041_0499421_229_666 145
133 3300049588 Ga0501072_0363321 Ga0501072_0363321_495_932 145
134 3300049591 Ga0501075_0062754 Ga0501075_0062754_408_845 145
135 3300049592 Ga0501076_0329769 Ga0501076_0329769_305_742 145
136 3300049741 Ga0501079_0526927 Ga0501079_0526927_276_713 145
137 3300049742 Ga0501080_1311964 Ga0501080_1311964_172_609 145
138 3300050508 nmdc:mga09592_73480_c1 nmdc:mga09592_73480_c1_1741_2178 145
139 3300050515 nmdc:mga0a205_184098_c1 nmdc:mga0a205_184098_c1_1283_1720 145
140 3300060353 Ga0501082_0286098 Ga0501082_0286098_974_1411 145
141 3300009094 Ga0111539_10010924 Ga0111539_1001092410 146
142 3300036647 Ga0316582_0015911 Ga0316582_0015911_321_761 146
143 3300037588 Ga0316581_0083923 Ga0316581_0083923_323_763 146
144 3300050511 nmdc:mga08y16_1573_c2 nmdc:mga08y16_1573_c2_351_794 146
145 3300061734 Ga0530510_0972364 Ga0530510_0972364_100_540 146
146 3300005471 Ga0070698_100028261 Ga0070698_1000282611 147
147 3300005578 Ga0068854_100770853 Ga0068854_1007708532 147
148 3300006051 Ga0075364_10084511 Ga0075364_100845112 147
149 3300031691 Ga0316579_10316298 Ga0316579_103162981 147
150 3300031727 Ga0316576_10748883 Ga0316576_107488832 147
151 3300031728 Ga0316578_10057855 Ga0316578_100578551 147
152 3300032139 Ga0316580_10011508 Ga0316580_100115082 147
153 3300036647 Ga0316582_0767214 Ga0316582_0767214_134_577 147
154 3300036712 Ga0316584_0498836 Ga0316584_0498836_284_727 147
155 3300039093 Ga0400489_47960 Ga0400489_47960_3727_4170 147
156 3300045051 Ga0451576_0015535 Ga0451576_0015535_1889_2428 147
157 3300049570 Ga0501033_0312933 Ga0501033_0312933_546_989 147
158 3300049572 Ga0501036_0049995 Ga0501036_0049995_1384_1827 147
159 3300049573 Ga0501037_0263825 Ga0501037_0263825_607_1050 147
160 3300049574 Ga0501038_0101291 Ga0501038_0101291_1316_1759 147
161 3300049575 Ga0501039_0084554 Ga0501039_0084554_1068_1511 147
162 3300049576 Ga0501040_0060929 Ga0501040_0060929_953_1396 147
163 3300049577 Ga0501041_0071369 Ga0501041_0071369_1391_1834 147
164 3300049580 Ga0501046_0144838 Ga0501046_0144838_462_905 147
165 3300049582 Ga0501048_0974192 Ga0501048_0974192_132_575 147
166 3300049584 Ga0501068_0172754 Ga0501068_0172754_748_1191 147
167 3300049587 Ga0501071_0679508 Ga0501071_0679508_106_549 147
168 3300049588 Ga0501072_0027139 Ga0501072_0027139_950_1393 147
169 3300049591 Ga0501075_0034845 Ga0501075_0034845_1732_2175 147
170 3300049592 Ga0501076_0052471 Ga0501076_0052471_1434_1877 147
171 3300049741 Ga0501079_0068275 Ga0501079_0068275_1071_1514 147
172 3300049742 Ga0501080_0046238 Ga0501080_0046238_1941_2384 147
173 3300049743 Ga0501081_0045111 Ga0501081_0045111_1403_1846 147
174 3300049824 Ga0501045_0058046 Ga0501045_0058046_633_1076 147
175 3300050491 nmdc:mga00v17_389991_c1 nmdc:mga00v17_389991_c1_79_522 147
176 3300050492 nmdc:mga0yw44_217223_c1 nmdc:mga0yw44_217223_c1_417_860 147
177 3300060353 Ga0501082_0049688 Ga0501082_0049688_1181_1624 147
178 3300061734 Ga0530510_0012391 Ga0530510_0012391_4742_5185 147
179 3300005367 Ga0070667_100198802 Ga0070667_1001988022 148
180 3300005617 Ga0068859_100913629 Ga0068859_1009136292 148
181 3300005618 Ga0068864_100892321 Ga0068864_1008923211 148
182 3300005844 Ga0068862_100019345 Ga0068862_1000193453 148
183 3300006880 Ga0075429_100948647 Ga0075429_1009486471 148
184 3300006931 Ga0097620_100913501 Ga0097620_1009135012 148
185 3300013306 Ga0163162_10818970 Ga0163162_108189702 148
186 3300020081 Ga0206354_10806462 Ga0206354_108064623 148
187 3300025941 Ga0207711_11310075 Ga0207711_113100751 148
188 3300025986 Ga0207658_10488481 Ga0207658_104884812 148
189 3300026035 Ga0207703_10253617 Ga0207703_102536173 148
190 3300026088 Ga0207641_11454920 Ga0207641_114549202 148
191 3300028380 Ga0268265_10079981 Ga0268265_100799813 148
192 3300031235 Ga0265330_10012400 Ga0265330_100124005 148
193 3300031235 Ga0265330_10030228 Ga0265330_100302283 148
194 3300031238 Ga0265332_10000071 Ga0265332_1000007166 148
195 3300031239 Ga0265328_10026116 Ga0265328_100261162 148
196 3300031240 Ga0265320_10026755 Ga0265320_100267553 148
197 3300031242 Ga0265329_10007586 Ga0265329_100075865 148
198 3300031249 Ga0265339_10003939 Ga0265339_100039398 148
199 3300031249 Ga0265339_10101813 Ga0265339_101018133 148
200 3300031250 Ga0265331_10000051 Ga0265331_10000051108 148
201 3300031250 Ga0265331_10018225 Ga0265331_100182253 148
202 3300031344 Ga0265316_10000030 Ga0265316_1000003050 148
203 3300031711 Ga0265314_10000386 Ga0265314_1000038624 148
204 3300031711 Ga0265314_10001909 Ga0265314_1000190917 148
205 3300031712 Ga0265342_10004580 Ga0265342_1000458012 148
206 3300031712 Ga0265342_10006795 Ga0265342_1000679510 148
207 3300031727 Ga0316576_11323386 Ga0316576_113233861 148
208 3300035170 Ga0373943_0374542 Ga0373943_0374542_206_652 148
209 3300036712 Ga0316584_0501611 Ga0316584_0501611_19_468 148
210 3300039062 Ga0400483_277133 Ga0400483_277133_1335_1784 148
211 3300039093 Ga0400489_91703 Ga0400489_91703_2360_2809 148
212 3300044712 Ga0453684_0020337 Ga0453684_0020337_6862_7311 148
213 3300044712 Ga0453684_0193952 Ga0453684_0193952_1168_1620 148
214 3300046472 Ga0495580_0517609 Ga0495580_0517609_319_765 148
215 3300046615 Ga0495656_0025905 Ga0495656_0025905_866_1318 148
216 3300047318 Ga0495636_0293330 Ga0495636_0293330_282_728 148
217 3300048912 Ga0496109_0368542 Ga0496109_0368542_419_865 148
218 3300048913 Ga0496110_0597181 Ga0496110_0597181_230_676 148
219 3300048914 Ga0496111_0756611 Ga0496111_0756611_14_460 148
220 3300049744 Ga0501083_0598361 Ga0501083_0598361_227_673 148
221 3300050507 nmdc:mga05p37_119912_c1 nmdc:mga05p37_119912_c1_2206_2655 148
222 3300005330 Ga0070690_100661472 Ga0070690_1006614722 149
223 3300005345 Ga0070692_10013367 Ga0070692_100133673 149
224 3300005356 Ga0070674_101298131 Ga0070674_1012981311 149
225 3300005444 Ga0070694_100018718 Ga0070694_1000187182 149
226 3300005444 Ga0070694_100201726 Ga0070694_1002017262 149
227 3300005471 Ga0070698_100228919 Ga0070698_1002289194 149
228 3300005518 Ga0070699_100493130 Ga0070699_1004931301 149
229 3300005530 Ga0070679_100014924 Ga0070679_1000149246 149
230 3300005549 Ga0070704_100625246 Ga0070704_1006252461 149
231 3300005577 Ga0068857_100006740 Ga0068857_1000067406 149
232 3300006195 Ga0075366_10016930 Ga0075366_100169303 149
233 3300006358 Ga0068871_101889765 Ga0068871_1018897651 149
234 3300006852 Ga0075433_10036433 Ga0075433_100364334 149
235 3300006871 Ga0075434_100083471 Ga0075434_1000834715 149
236 3300009176 Ga0105242_10640028 Ga0105242_106400281 149
237 3300013307 Ga0157372_10692311 Ga0157372_106923112 149
238 3300025921 Ga0207652_10012154 Ga0207652_100121546 149
239 3300026075 Ga0207708_10318945 Ga0207708_103189452 149
240 3300026116 Ga0207674_10007543 Ga0207674_1000754311 149
241 3300031240 Ga0265320_10010947 Ga0265320_100109471 149
242 3300031241 Ga0265325_10059881 Ga0265325_100598812 149
243 3300031250 Ga0265331_10040566 Ga0265331_100405662 149
244 3300031595 Ga0265313_10038183 Ga0265313_100381833 149
245 3300031665 Ga0316575_10017319 Ga0316575_100173193 149
246 3300031691 Ga0316579_10049842 Ga0316579_100498421 149
247 3300031691 Ga0316579_10094344 Ga0316579_100943442 149
248 3300031727 Ga0316576_10001562 Ga0316576_100015627 149
249 3300031727 Ga0316576_10262147 Ga0316576_102621472 149
250 3300031727 Ga0316576_10482577 Ga0316576_104825772 149
251 3300031728 Ga0316578_10009992 Ga0316578_100099921 149
252 3300031728 Ga0316578_10403894 Ga0316578_104038941 149
253 3300031733 Ga0316577_10303278 Ga0316577_103032781 149
254 3300031733 Ga0316577_10410311 Ga0316577_104103111 149
255 3300031733 Ga0316577_10607919 Ga0316577_106079191 149
256 3300032137 Ga0316585_10007039 Ga0316585_100070392 149
257 3300032139 Ga0316580_10075760 Ga0316580_100757602 149
258 3300035119 Ga0373956_0197859 Ga0373956_0197859_462_911 149
259 3300035398 Ga0316574_0223966 Ga0316574_0223966_277_726 149
260 3300036647 Ga0316582_0060285 Ga0316582_0060285_1258_1707 149
261 3300036647 Ga0316582_0148339 Ga0316582_0148339_987_1436 149
262 3300036647 Ga0316582_1170256 Ga0316582_1170256_22_471 149
263 3300036712 Ga0316584_0000778 Ga0316584_0000778_7629_8078 149
264 3300036712 Ga0316584_0282698 Ga0316584_0282698_236_685 149
265 3300036712 Ga0316584_0314066 Ga0316584_0314066_301_750 149
266 3300044673 Ga0453683_0000029 Ga0453683_0000029_214132_214593 149
267 3300044673 Ga0453683_0053416 Ga0453683_0053416_1576_2025 149
268 3300044712 Ga0453684_0007550 Ga0453684_0007550_16703_17155 149
269 3300044712 Ga0453684_0046036 Ga0453684_0046036_2828_3277 149
270 3300044712 Ga0453684_0316493 Ga0453684_0316493_451_900 149
271 3300044712 Ga0453684_0363221 Ga0453684_0363221_204_653 149
272 3300045051 Ga0451576_0000078 Ga0451576_0000078_214110_214571 149
273 3300045051 Ga0451576_0000123 Ga0451576_0000123_187772_188221 149
274 3300045051 Ga0451576_1348884 Ga0451576_1348884_54_503 149
275 3300049577 Ga0501041_0307428 Ga0501041_0307428_242_691 149
276 3300049583 Ga0501067_0065096 Ga0501067_0065096_1542_1991 149
277 3300050493 nmdc:mga0k408_16223_c1 nmdc:mga0k408_16223_c1_3194_3643 149
278 3300050512 nmdc:mga0n895_27679_c1 nmdc:mga0n895_27679_c1_4412_4861 149
279 3300050515 nmdc:mga0a205_231515_c1 nmdc:mga0a205_231515_c1_549_998 149
280 3300053085 Ga0495619_0003996 Ga0495619_0003996_5717_6166 149
281 3300006844 Ga0075428_100000709 Ga0075428_10000070919 150
282 3300006846 Ga0075430_100019347 Ga0075430_1000193474 150
283 3300006871 Ga0075434_100553305 Ga0075434_1005533052 150
284 3300029957 Ga0265324_10052856 Ga0265324_100528562 150
285 3300050509 nmdc:mga0qj67_13736_c1 nmdc:mga0qj67_13736_c1_3359_3823 150
286 3300050510 nmdc:mga06r32_225770_c1 nmdc:mga06r32_225770_c1_915_1379 150
287 3300050512 nmdc:mga0n895_802925_c1 nmdc:mga0n895_802925_c1_10_462 150
288 3300009147 Ga0114129_10416244 Ga0114129_104162443 151
289 3300031691 Ga0316579_10090389 Ga0316579_100903892 151
290 3300031995 Ga0307409_102072085 Ga0307409_1020720851 151
291 3300032137 Ga0316585_10086174 Ga0316585_100861742 151
292 3300032168 Ga0316593_10010562 Ga0316593_100105622 151
293 3300036647 Ga0316582_0001992 Ga0316582_0001992_6031_6486 151
294 3300036647 Ga0316582_0006408 Ga0316582_0006408_2064_2519 151
295 3300036647 Ga0316582_0028721 Ga0316582_0028721_1735_2190 151
296 3300036712 Ga0316584_0132670 Ga0316584_0132670_272_727 151
297 3300037588 Ga0316581_0009838 Ga0316581_0009838_2005_2460 151
298 3300050508 nmdc:mga09592_1611934_c1 nmdc:mga09592_1611934_c1_22_477 151
299 3300005843 Ga0068860_100544016 Ga0068860_1005440162 152
300 3300028381 Ga0268264_10407730 Ga0268264_104077302 152
301 3300049686 Ga0501257_013612 Ga0501257_013612_645_1106 152
302 3300005329 Ga0070683_100791600 Ga0070683_1007916002 153
303 3300005337 Ga0070682_100363329 Ga0070682_1003633291 153
304 3300005441 Ga0070700_100056341 Ga0070700_1000563414 153
305 3300005441 Ga0070700_100511842 Ga0070700_1005118422 153
306 3300005444 Ga0070694_100433900 Ga0070694_1004339002 153
307 3300005535 Ga0070684_101377468 Ga0070684_1013774681 153
308 3300005549 Ga0070704_100151765 Ga0070704_1001517652 153
309 3300005985 Ga0081539_10012741 Ga0081539_100127412 153
310 3300006844 Ga0075428_100002340 Ga0075428_10000234021 153
311 3300006844 Ga0075428_100901533 Ga0075428_1009015332 153
312 3300006846 Ga0075430_100260606 Ga0075430_1002606062 153
313 3300006847 Ga0075431_100243616 Ga0075431_1002436162 153
314 3300006880 Ga0075429_100280055 Ga0075429_1002800552 153
315 3300009094 Ga0111539_10193249 Ga0111539_101932492 153
316 3300009094 Ga0111539_10335747 Ga0111539_103357472 153
317 3300009147 Ga0114129_10571828 Ga0114129_105718281 153
318 3300009148 Ga0105243_10589069 Ga0105243_105890692 153
319 3300009553 Ga0105249_10448340 Ga0105249_104483402 153
320 3300025899 Ga0207642_10034470 Ga0207642_100344701 153
321 3300025961 Ga0207712_10117188 Ga0207712_101171882 153
322 3300026118 Ga0207675_101572432 Ga0207675_1015724322 153
323 3300050510 nmdc:mga06r32_1226239_c1 nmdc:mga06r32_1226239_c1_72_623 153
324 3300050511 nmdc:mga08y16_266645_c1 nmdc:mga08y16_266645_c1_145_696 153
325 3300005347 Ga0070668_100471848 Ga0070668_1004718482 155
326 3300006844 Ga0075428_101440492 Ga0075428_1014404921 155
327 3300006852 Ga0075433_10008456 Ga0075433_100084567 155
328 3300006852 Ga0075433_10636672 Ga0075433_106366722 155
329 3300031727 Ga0316576_10001763 Ga0316576_100017639 155
330 3300031728 Ga0316578_10057734 Ga0316578_100577342 155
331 3300031733 Ga0316577_10000518 Ga0316577_100005187 155
332 3300032126 Ga0307415_101751850 Ga0307415_1017518501 155
333 3300032133 Ga0316583_10001244 Ga0316583_100012444 155
334 3300032137 Ga0316585_10001370 Ga0316585_100013702 155
335 3300032139 Ga0316580_10000027 Ga0316580_1000002710 155
336 3300033524 Ga0316592_1004570 Ga0316592_10045702 155
337 3300035398 Ga0316574_0000009 Ga0316574_0000009_12643_13110 155
338 3300036647 Ga0316582_0000243 Ga0316582_0000243_6450_6917 155
339 3300036712 Ga0316584_0001053 Ga0316584_0001053_14623_15090 155
340 3300037588 Ga0316581_0001730 Ga0316581_0001730_233_700 155
341 3300041453 Ga0451797_1137418 Ga0451797_1137418_246_713 155
342 3300048911 Ga0496108_0000059 Ga0496108_0000059_99185_99652 155
343 3300050515 nmdc:mga0a205_139931_c1 nmdc:mga0a205_139931_c1_351_863 155
344 3300050515 nmdc:mga0a205_19109_c1 nmdc:mga0a205_19109_c1_2754_3221 155
345 3300026075 Ga0207708_11267145 Ga0207708_112671451 156
346 3300003316 rootH1_10037274 rootH1_100372743 157
347 3300005334 Ga0068869_100223011 Ga0068869_1002230112 157
348 3300005440 Ga0070705_100395599 Ga0070705_1003955991 157
349 3300005444 Ga0070694_100233824 Ga0070694_1002338242 157
350 3300005617 Ga0068859_100016119 Ga0068859_1000161194 157
351 3300005844 Ga0068862_100031175 Ga0068862_1000311753 157
352 3300005937 Ga0081455_10058369 Ga0081455_100583694 157
353 3300006931 Ga0097620_100016119 Ga0097620_1000161194 157
354 3300009177 Ga0105248_10702699 Ga0105248_107026992 157
355 3300025908 Ga0207643_10646460 Ga0207643_106464601 157
356 3300025942 Ga0207689_10353408 Ga0207689_103534082 157
357 3300025961 Ga0207712_10245831 Ga0207712_102458312 157
358 3300026116 Ga0207674_10161244 Ga0207674_101612443 157
359 3300028380 Ga0268265_10022224 Ga0268265_100222243 157
360 3300046499 Ga0495594_0279498 Ga0495594_0279498_243_716 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

17

159

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.978 1 144
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.9776 1 146
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9647 1 144
3lmv-assembly2.cif.gz_C d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.9615 1 146
3knf-assembly2.cif.gz_D crystal structure of d-tyr-trna(tyr) deacylase from plasmodium falciparum 0.9607 1 147
ID Description Score Start End Superfamily
af_Q2FXU2_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9833 1 144 3.50.80.10
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9793 1 146 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.978 1 144 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9776 1 146 3.50.80.10
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9729 1 146 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A524H0K9-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9988 1 144 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A520Y269-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9988 1 144 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A0P9FGD0-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9985 1 149 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-F6B2Z3-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9985 2 146 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A3C0XMB6-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9978 5 141 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026

Feature Viewer

pLDDT pTM Quality
94.44 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map