F421798

General Info

Members Datasets Scaffolds Average Seq Length
360 179 720 109

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_101313052|Ga0070708_1013130522
Length 114
Sequence LRLGITEFIDCAHFLPGHPKCGQVHGHTYKVEVIIEGEHAPGQGMIVDFNELKLRTREVLQRYDHRNWNDVLEFPSVENICALLASQLRERIAFPMVVRVWEGNGKWAEMELTR

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
133 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
134 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
135 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
139 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
140 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.56
Nodule 0
Rhizoplane 0.56
Rhizosphere 93.89
Stem 0
Stem Tuber 0
Unclassified 28.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_101313052 3300005445 Unclassified 676
2 MRS1b_contig_6114236 2162886011 Bacteria 1921
3 Ga0058863_11553521 3300004799 Bacteria 541
4 Ga0058862_10216684 3300004803 Unclassified 655
5 Ga0058862_12340398 3300004803 Unclassified 968
6 Ga0065712_10082207 3300005290 Bacteria 2905
7 Ga0065707_10748994 3300005295 Unclassified 619
8 Ga0070690_100039455 3300005330 Bacteria 2983
9 Ga0070690_100110575 3300005330 Bacteria 1833
10 Ga0070666_10101719 3300005335 Bacteria 1981
11 Ga0070680_100428119 3300005336 Bacteria 1129
12 Ga0070689_100010103 3300005340 Bacteria 6719
13 Ga0070689_100022537 3300005340 Bacteria 4702
14 Ga0070689_100089189 3300005340 Bacteria 2429
15 Ga0070687_100001040 3300005343 Bacteria 9478
16 Ga0070687_100825799 3300005343 Unclassified 659
17 Ga0070661_100679755 3300005344 Unclassified 837
18 Ga0070692_10267717 3300005345 Bacteria 1030
19 Ga0070668_100201504 3300005347 Bacteria 1634
20 Ga0070669_100088420 3300005353 Bacteria 2319
21 Ga0070669_100711313 3300005353 Unclassified 849
22 Ga0070675_100011607 3300005354 Bacteria 6898
23 Ga0070674_100005128 3300005356 Bacteria 7530
24 Ga0070674_101377648 3300005356 Unclassified 631
25 Ga0070673_100029984 3300005364 Bacteria 4064
26 Ga0070673_100080006 3300005364 Bacteria 2647
27 Ga0070673_100343025 3300005364 Unclassified 1324
28 Ga0070688_100018475 3300005365 Bacteria 4023
29 Ga0070688_100928412 3300005365 Unclassified 688
30 Ga0070659_100191068 3300005366 Bacteria 1683
31 Ga0070667_100088918 3300005367 Bacteria 2653
32 Ga0070703_10044945 3300005406 Bacteria 1391
33 Ga0070703_10049610 3300005406 Bacteria 1337
34 Ga0070709_10832869 3300005434 Bacteria 726
35 Ga0070701_10003190 3300005438 Bacteria 6449
36 Ga0070705_100070494 3300005440 Bacteria 2111
37 Ga0070705_100508581 3300005440 Bacteria 916
38 Ga0070705_100756735 3300005440 Unclassified 769
39 Ga0070700_100115455 3300005441 Bacteria 1791
40 Ga0070700_100776770 3300005441 Unclassified 769
41 Ga0070694_100135556 3300005444 Unclassified 1784
42 Ga0070694_100189037 3300005444 Bacteria 1528
43 Ga0070694_101714837 3300005444 Unclassified 534
44 Ga0070708_100964795 3300005445 Bacteria 800
45 Ga0070663_100006244 3300005455 Bacteria 7145
46 Ga0070678_100106948 3300005456 Bacteria 2181
47 Ga0070662_100371742 3300005457 Bacteria 1175
48 Ga0070662_100805709 3300005457 Bacteria 798
49 Ga0068867_100008364 3300005459 Bacteria 7300
50 Ga0070685_10030042 3300005466 Bacteria 3024
51 Ga0070706_100019216 3300005467 Bacteria 6303
52 Ga0070706_100168771 3300005467 Bacteria 2043
53 Ga0070706_102069658 3300005467 Unclassified 515
54 Ga0070707_100008723 3300005468 Bacteria 9401
55 Ga0070707_100220690 3300005468 Bacteria 1846
56 Ga0070707_100335084 3300005468 Bacteria 1470
57 Ga0070698_100001832 3300005471 Bacteria 23668
58 Ga0070698_100023393 3300005471 Bacteria 6459
59 Ga0070698_100800651 3300005471 Bacteria 886
60 Ga0070699_100019324 3300005518 Bacteria 5865
61 Ga0070699_100264722 3300005518 Bacteria 1538
62 Ga0070699_101000217 3300005518 Unclassified 767
63 Ga0070699_101496501 3300005518 Bacteria 619
64 Ga0070697_100044710 3300005536 Bacteria 3588
65 Ga0070697_101212659 3300005536 Bacteria 673
66 Ga0070697_101640830 3300005536 Unclassified 575
67 Ga0070672_100712344 3300005543 Unclassified 879
68 Ga0070686_100046632 3300005544 Bacteria 2735
69 Ga0070686_100264405 3300005544 Bacteria 1262
70 Ga0070695_100129705 3300005545 Bacteria 1736
71 Ga0070695_101473383 3300005545 Unclassified 566
72 Ga0070696_100123848 3300005546 Bacteria 1874
73 Ga0070693_100645274 3300005547 Unclassified 769
74 Ga0070704_100381908 3300005549 Bacteria 1197
75 Ga0070704_100417642 3300005549 Unclassified 1148
76 Ga0070704_101183351 3300005549 Unclassified 697
77 Ga0068857_100452630 3300005577 Bacteria 1200
78 Ga0068857_100585828 3300005577 Bacteria 1053
79 Ga0068857_101985551 3300005577 Unclassified 570
80 Ga0070702_100013227 3300005615 Bacteria 4161
81 Ga0070702_100952327 3300005615 Unclassified 676
82 Ga0068859_100016648 3300005617 Bacteria 7380
83 Ga0068859_100025547 3300005617 Bacteria 5924
84 Ga0068864_100827471 3300005618 Unclassified 911
85 Ga0068866_10099478 3300005718 Bacteria 1601
86 Ga0068861_100073787 3300005719 Bacteria 2651
87 Ga0068870_10023421 3300005840 Bacteria 3044
88 Ga0068870_10103387 3300005840 Bacteria 1614
89 Ga0068863_100020146 3300005841 Bacteria 6380
90 Ga0068863_100395485 3300005841 Bacteria 1351
91 Ga0068863_101492689 3300005841 Unclassified 684
92 Ga0068858_100011139 3300005842 Bacteria 8502
93 Ga0068858_100877294 3300005842 Unclassified 877
94 Ga0068860_100058889 3300005843 Bacteria 3652
95 Ga0075365_10134434 3300006038 Bacteria 1713
96 Ga0075365_10479649 3300006038 Unclassified 879
97 Ga0075368_10036628 3300006042 Bacteria 1916
98 Ga0075363_100138293 3300006048 Bacteria 1370
99 Ga0075363_100947304 3300006048 Unclassified 529
100 Ga0075364_10072228 3300006051 Bacteria 2274
101 Ga0075364_10115841 3300006051 Bacteria 1791
102 Ga0075364_10664227 3300006051 Bacteria 712
103 Ga0075432_10217872 3300006058 Bacteria 762
104 Ga0075362_10154815 3300006177 Bacteria 1101
105 Ga0075367_10012959 3300006178 Bacteria 4466
106 Ga0075366_10001093 3300006195 Bacteria 13318
107 Ga0097621_100031791 3300006237 Bacteria 4190
108 Ga0097621_101901335 3300006237 Unclassified 568
109 Ga0075428_100188120 3300006844 Unclassified 2233
110 Ga0075428_100231960 3300006844 Bacteria 1992
111 Ga0075428_100259903 3300006844 Bacteria 1870
112 Ga0075428_100501066 3300006844 Bacteria 1299
113 Ga0075428_100623450 3300006844 Unclassified 1151
114 Ga0075430_100158109 3300006846 Bacteria 1886
115 Ga0075431_100042537 3300006847 Bacteria 4686
116 Ga0075431_100172168 3300006847 Bacteria 2224
117 Ga0075431_100423404 3300006847 Bacteria 1330
118 Ga0075431_100640787 3300006847 Bacteria 1044
119 Ga0075431_101008645 3300006847 Unclassified 799
120 Ga0075433_10007829 3300006852 Bacteria 8497
121 Ga0075433_10051288 3300006852 Bacteria 3592
122 Ga0075433_10078108 3300006852 Bacteria 2917
123 Ga0075433_10113582 3300006852 Bacteria 2403
124 Ga0075433_10123939 3300006852 Bacteria 2296
125 Ga0075433_10209174 3300006852 Bacteria 1734
126 Ga0075433_10515267 3300006852 Bacteria 1052
127 Ga0075434_100012943 3300006871 Bacteria 7924
128 Ga0075434_100038545 3300006871 Unclassified 4733
129 Ga0075434_100059243 3300006871 Bacteria 3807
130 Ga0075434_100069806 3300006871 Unclassified 3503
131 Ga0075434_100071620 3300006871 Bacteria 3457
132 Ga0075434_100084473 3300006871 Bacteria 3173
133 Ga0075434_100104079 3300006871 Unclassified 2848
134 Ga0075434_100408805 3300006871 Unclassified 1378
135 Ga0075434_100717131 3300006871 Bacteria 1017
136 Ga0075434_100968407 3300006871 Unclassified 865
137 Ga0075434_102243445 3300006871 Unclassified 549
138 Ga0075429_100003316 3300006880 Bacteria 13713
139 Ga0075429_100025183 3300006880 Bacteria 5165
140 Ga0075429_100037310 3300006880 Bacteria 4230
141 Ga0075429_100124378 3300006880 Bacteria 2255
142 Ga0075429_100151689 3300006880 Bacteria 2029
143 Ga0075429_100194359 3300006880 Bacteria 1777
144 Ga0075429_101274316 3300006880 Unclassified 641
145 Ga0075429_101355845 3300006880 Unclassified 620
146 Ga0068865_100009785 3300006881 Bacteria 5951
147 Ga0075436_100096729 3300006914 Bacteria 2054
148 Ga0075436_100505690 3300006914 Bacteria 884
149 Ga0097620_100016649 3300006931 Bacteria 7380
150 Ga0097620_100025547 3300006931 Bacteria 5924
151 Ga0075435_100096050 3300007076 Bacteria 2451
152 Ga0075435_100099643 3300007076 Bacteria 2406
153 Ga0099794_10063655 3300007265 Unclassified 1796
154 Ga0111539_10000105 3300009094 Bacteria 90635
155 Ga0111539_10077680 3300009094 Bacteria 3907
156 Ga0111539_10095467 3300009094 Bacteria 3493
157 Ga0111539_10429381 3300009094 Unclassified 1538
158 Ga0111539_10444589 3300009094 Bacteria 1509
159 Ga0111539_11651838 3300009094 Bacteria 743
160 Ga0105245_10466419 3300009098 Bacteria 1274
161 Ga0105245_12597376 3300009098 Unclassified 560
162 Ga0105247_10179749 3300009101 Bacteria 1411
163 Ga0114129_10001312 3300009147 Bacteria 33244
164 Ga0114129_10003737 3300009147 Bacteria 21460
165 Ga0114129_10006961 3300009147 Bacteria 16091
166 Ga0114129_10019886 3300009147 Bacteria 9556
167 Ga0114129_10020125 3300009147 Bacteria 9496
168 Ga0114129_10040627 3300009147 Bacteria 6556
169 Ga0114129_10088424 3300009147 Bacteria 4295
170 Ga0114129_10099888 3300009147 Bacteria 4015
171 Ga0114129_10241500 3300009147 Bacteria 2428
172 Ga0114129_10374487 3300009147 Unclassified 1881
173 Ga0114129_10431738 3300009147 Bacteria 1731
174 Ga0114129_10697356 3300009147 Bacteria 1305
175 Ga0114129_11395127 3300009147 Unclassified 865
176 Ga0114129_11778742 3300009147 Unclassified 750
177 Ga0114129_12843962 3300009147 Bacteria 574
178 Ga0114129_13386464 3300009147 Unclassified 513
179 Ga0105243_10015287 3300009148 Bacteria 5807
180 Ga0105243_10947106 3300009148 Bacteria 860
181 Ga0105242_10169624 3300009176 Bacteria 1917
182 Ga0105242_11247764 3300009176 Unclassified 765
183 Ga0105248_10062254 3300009177 Bacteria 4190
184 Ga0105238_10665015 3300009551 Bacteria 1052
185 Ga0105249_10459088 3300009553 Bacteria 1313
186 Ga0105249_12275997 3300009553 Bacteria 615
187 Ga0105239_11763619 3300010375 Bacteria 717
188 Ga0105239_12329018 3300010375 Bacteria 623
189 Ga0105246_10248473 3300011119 Unclassified 1410
190 Ga0105246_10432036 3300011119 Unclassified 1102
191 Ga0105246_10510821 3300011119 Bacteria 1022
192 Ga0105246_11562368 3300011119 Unclassified 622
193 Ga0157378_12088023 3300013297 Unclassified 617
194 Ga0163162_10128361 3300013306 Bacteria 2643
195 Ga0163162_12226150 3300013306 Unclassified 629
196 Ga0157380_10008812 3300014326 Bacteria 7207
197 Ga0157379_10078380 3300014968 Bacteria 2959
198 Ga0157379_11444946 3300014968 Unclassified 668
199 Ga0157376_10508953 3300014969 Bacteria 1185
200 Ga0163161_10148116 3300017792 Bacteria 1782
201 Ga0207697_10513316 3300025315 Unclassified 529
202 Ga0207653_10055722 3300025885 Unclassified 1324
203 Ga0207642_10043306 3300025899 Bacteria 1984
204 Ga0207680_10129420 3300025903 Bacteria 1662
205 Ga0207699_10712699 3300025906 Bacteria 735
206 Ga0207645_10047916 3300025907 Bacteria 2729
207 Ga0207643_10047166 3300025908 Bacteria 2436
208 Ga0207684_10008616 3300025910 Bacteria 9062
209 Ga0207684_10010107 3300025910 Bacteria 8313
210 Ga0207660_10449906 3300025917 Bacteria 1041
211 Ga0207662_10020535 3300025918 Bacteria 3770
212 Ga0207662_10809942 3300025918 Unclassified 660
213 Ga0207657_10365987 3300025919 Unclassified 1136
214 Ga0207652_11622981 3300025921 Unclassified 551
215 Ga0207646_10002195 3300025922 Bacteria 23260
216 Ga0207646_10040272 3300025922 Bacteria 4202
217 Ga0207646_10581336 3300025922 Bacteria 1006
218 Ga0207681_10048347 3300025923 Bacteria 2871
219 Ga0207681_10607030 3300025923 Unclassified 904
220 Ga0207659_10164426 3300025926 Bacteria 1745
221 Ga0207706_10033351 3300025933 Bacteria 4584
222 Ga0207706_10469578 3300025933 Unclassified 1087
223 Ga0207709_10152603 3300025935 Bacteria 1602
224 Ga0207670_10090433 3300025936 Bacteria 2163
225 Ga0207670_10462686 3300025936 Bacteria 1024
226 Ga0207669_10017806 3300025937 Bacteria 3655
227 Ga0207704_10265195 3300025938 Bacteria 1297
228 Ga0207691_10104751 3300025940 Bacteria 2521
229 Ga0207691_10528400 3300025940 Bacteria 1001
230 Ga0207711_10099098 3300025941 Bacteria 2576
231 Ga0207689_10073743 3300025942 Bacteria 2804
232 Ga0207651_10024858 3300025960 Bacteria 3713
233 Ga0207651_10231632 3300025960 Bacteria 1500
234 Ga0207668_10148627 3300025972 Bacteria 1811
235 Ga0207640_11706418 3300025981 Bacteria 569
236 Ga0207677_10438927 3300026023 Bacteria 1116
237 Ga0207703_10065933 3300026035 Bacteria 2977
238 Ga0207678_10015489 3300026067 Bacteria 6703
239 Ga0207708_10062915 3300026075 Bacteria 2835
240 Ga0207708_10125082 3300026075 Bacteria 2006
241 Ga0207641_10029171 3300026088 Bacteria 4562
242 Ga0207641_11342065 3300026088 Unclassified 716
243 Ga0207648_10002928 3300026089 Bacteria 18072
244 Ga0207676_10023008 3300026095 Bacteria 4591
245 Ga0207676_10083847 3300026095 Bacteria 2597
246 Ga0207676_11608873 3300026095 Unclassified 647
247 Ga0207674_10126068 3300026116 Bacteria 2526
248 Ga0207675_100006570 3300026118 Bacteria 11004
249 Ga0207675_101222648 3300026118 Unclassified 772
250 Ga0207683_10229964 3300026121 Bacteria 1691
251 Ga0209813_10021733 3300027866 Bacteria 1807
252 Ga0207428_10000056 3300027907 Bacteria 159770
253 Ga0207428_10259285 3300027907 Bacteria 1295
254 Ga0207428_10420564 3300027907 Unclassified 977
255 Ga0268266_10282904 3300028379 Bacteria 1543
256 Ga0268265_10041640 3300028380 Bacteria 3402
257 Ga0268264_10258919 3300028381 Bacteria 1620
258 Ga0373958_0119919 3300034819 Unclassified 635
259 Ga0373961_0224593 3300035241 Bacteria 671
260 Ga0373962_0201161 3300035242 Bacteria 674
261 Ga0316574_0009287 3300035398 Bacteria 5501
262 Ga0373937_0121371 3300036401 Bacteria 2436
263 Ga0436360_1023926 3300039438 Bacteria 646
264 Ga0436362_0202137 3300039453 Bacteria 811
265 Ga0436362_0482449 3300039453 Unclassified 956
266 Ga0451807_2454992 3300041486 Bacteria 535
267 Ga0439459_0183652 3300042438 Unclassified 563
268 Ga0453684_0936000 3300044712 Unclassified 926
269 Ga0451576_2149466 3300045051 Unclassified 574
270 Ga0495638_0005954 3300046460 Bacteria 8949
271 Ga0495586_0208953 3300046535 Unclassified 1107
272 Ga0495587_0831315 3300046536 Unclassified 504
273 Ga0495645_0388033 3300046543 Unclassified 892
274 Ga0495636_0639762 3300047318 Unclassified 522
275 Ga0496104_0252845 3300048907 Bacteria 1675
276 Ga0501036_0303894 3300049572 Bacteria 1334
277 Ga0501039_0671046 3300049575 Bacteria 811
278 Ga0501040_0185947 3300049576 Bacteria 1473
279 Ga0501043_0650269 3300049579 Bacteria 774
280 Ga0501068_0199428 3300049584 Bacteria 1269
281 Ga0501071_0052143 3300049587 Unclassified 2950
282 Ga0501074_0135639 3300049590 Unclassified 1761
283 Ga0501075_0056779 3300049591 Unclassified 2948
284 Ga0501076_0023727 3300049592 Bacteria 4731
285 Ga0501079_0161521 3300049741 Bacteria 1747
286 Ga0501079_0992453 3300049741 Unclassified 661
287 Ga0501081_0077813 3300049743 Unclassified 2318
288 Ga0501081_0478200 3300049743 Unclassified 927
289 Ga0501081_1046228 3300049743 Unclassified 617
290 Ga0501081_1050525 3300049743 Unclassified 616
291 Ga0501083_0202877 3300049744 Bacteria 1293
292 Ga0501045_0599626 3300049824 Bacteria 816
293 nmdc:mga03683_57375_c2 3300050489 Bacteria 981
294 nmdc:mga00v17_121309_c1 3300050491 Bacteria 1664
295 nmdc:mga00v17_277903_c1 3300050491 Unclassified 1087
296 nmdc:mga00v17_45909_c1 3300050491 Bacteria 2641
297 nmdc:mga0yw44_431087_c1 3300050492 Bacteria 893
298 nmdc:mga0k408_6705_c1 3300050493 Bacteria 6139
299 nmdc:mga06z11_1011309_c1 3300050494 Bacteria 507
300 nmdc:mga04h51_22001_c1 3300050495 Bacteria 1924
301 nmdc:mga05p37_128830_c1 3300050507 Unclassified 3106
302 nmdc:mga05p37_1711420_c1 3300050507 Bacteria 612
303 nmdc:mga05p37_173856_c1 3300050507 Bacteria 2625
304 nmdc:mga05p37_197871_c1 3300050507 Bacteria 2436
305 nmdc:mga05p37_2194367_c1 3300050507 Unclassified 513
306 nmdc:mga05p37_298773_c1 3300050507 Bacteria 1914
307 nmdc:mga05p37_5760_c1 3300050507 Bacteria 12099
308 nmdc:mga05p37_6115_c1 3300050507 Bacteria 14179
309 nmdc:mga05p37_751617_c1 3300050507 Bacteria 1075
310 nmdc:mga05p37_76454_c1 3300050507 Bacteria 4122
311 nmdc:mga05p37_913972_c1 3300050507 Unclassified 944
312 nmdc:mga05p37_996481_c1 3300050507 Bacteria 891
313 nmdc:mga09592_1143_c1 3300050508 Bacteria 21153
314 nmdc:mga09592_162910_c1 3300050508 Bacteria 1927
315 nmdc:mga09592_185529_c1 3300050508 Bacteria 1800
316 nmdc:mga09592_359697_c1 3300050508 Bacteria 1260
317 nmdc:mga09592_57650_c1 3300050508 Unclassified 3283
318 nmdc:mga09592_98018_c1 3300050508 Bacteria 2509
319 nmdc:mga0qj67_223201_c1 3300050509 Bacteria 1529
320 nmdc:mga0qj67_319844_c1 3300050509 Bacteria 1256
321 nmdc:mga0qj67_766722_c1 3300050509 Unclassified 765
322 nmdc:mga06r32_119441_c1 3300050510 Bacteria 2599
323 nmdc:mga06r32_1493023_c1 3300050510 Bacteria 616
324 nmdc:mga06r32_1687460_c1 3300050510 Bacteria 571
325 nmdc:mga06r32_17871_c1 3300050510 Bacteria 6482
326 nmdc:mga06r32_34603_c1 3300050510 Bacteria 4765
327 nmdc:mga08y16_1172203_c1 3300050511 Bacteria 740
328 nmdc:mga08y16_140874_c1 3300050511 Bacteria 2507
329 nmdc:mga08y16_210645_c1 3300050511 Bacteria 2013
330 nmdc:mga08y16_220602_c1 3300050511 Unclassified 1963
331 nmdc:mga08y16_374375_c1 3300050511 Unclassified 1460
332 nmdc:mga08y16_835601_c1 3300050511 Bacteria 911
333 nmdc:mga08y16_894_c1 3300050511 Bacteria 28792
334 nmdc:mga0n895_112670_c1 3300050512 Bacteria 2737
335 nmdc:mga0n895_1978633_c1 3300050512 Bacteria 541
336 nmdc:mga0n895_2152690_c1 3300050512 Unclassified 514
337 nmdc:mga0n895_517688_c1 3300050512 Unclassified 1201
338 nmdc:mga0n895_59157_c1 3300050512 Unclassified 3781
339 nmdc:mga0n895_637056_c1 3300050512 Unclassified 1066
340 nmdc:mga0n895_700508_c1 3300050512 Bacteria 1009
341 nmdc:mga0n895_748448_c1 3300050512 Bacteria 970
342 nmdc:mga0n895_84172_c1 3300050512 Unclassified 3173
343 nmdc:mga0n895_98799_c1 3300050512 Bacteria 2926
344 nmdc:mga0rr50_120080_c1 3300050513 Bacteria 2091
345 nmdc:mga0rr50_28576_c1 3300050513 Bacteria 3921
346 nmdc:mga08x19_473300_c1 3300050514 Bacteria 883
347 nmdc:mga0a205_1034539_c1 3300050515 Unclassified 668
348 nmdc:mga0a205_152835_c1 3300050515 Bacteria 2207
349 nmdc:mga0a205_3621_c1 3300050515 Bacteria 13828
350 nmdc:mga0a205_514327_c1 3300050515 Bacteria 1054
351 nmdc:mga0a205_587894_c1 3300050515 Unclassified 967
352 nmdc:mga0a205_588140_c1 3300050515 Unclassified 967
353 nmdc:mga0a205_62747_c1 3300050515 Unclassified 3590
354 nmdc:mga0a205_65680_c1 3300050515 Bacteria 3506
355 nmdc:mga0a205_70400_c1 3300050515 Bacteria 3377
356 Ga0501084_0865315 3300054114 Unclassified 760
357 Ga0501084_1575584 3300054114 Unclassified 549
358 Ga0501082_0015027 3300060353 Bacteria 6672
359 Ga0501082_0484826 3300060353 Bacteria 1081
360 Ga0530510_0289254 3300061734 Bacteria 1225
361 Ga0070708_101313052
362 MRS1b_contig_6114236
363 Ga0058863_11553521
364 Ga0058862_10216684
365 Ga0058862_12340398
366 Ga0065712_10082207
367 Ga0065707_10748994
368 Ga0070690_100039455
369 Ga0070690_100110575
370 Ga0070666_10101719
371 Ga0070680_100428119
372 Ga0070689_100010103
373 Ga0070689_100022537
374 Ga0070689_100089189
375 Ga0070687_100001040
376 Ga0070687_100825799
377 Ga0070661_100679755
378 Ga0070692_10267717
379 Ga0070668_100201504
380 Ga0070669_100088420
381 Ga0070669_100711313
382 Ga0070675_100011607
383 Ga0070674_100005128
384 Ga0070674_101377648
385 Ga0070673_100029984
386 Ga0070673_100080006
387 Ga0070673_100343025
388 Ga0070688_100018475
389 Ga0070688_100928412
390 Ga0070659_100191068
391 Ga0070667_100088918
392 Ga0070703_10044945
393 Ga0070703_10049610
394 Ga0070709_10832869
395 Ga0070701_10003190
396 Ga0070705_100070494
397 Ga0070705_100508581
398 Ga0070705_100756735
399 Ga0070700_100115455
400 Ga0070700_100776770
401 Ga0070694_100135556
402 Ga0070694_100189037
403 Ga0070694_101714837
404 Ga0070708_100964795
405 Ga0070663_100006244
406 Ga0070678_100106948
407 Ga0070662_100371742
408 Ga0070662_100805709
409 Ga0068867_100008364
410 Ga0070685_10030042
411 Ga0070706_100019216
412 Ga0070706_100168771
413 Ga0070706_102069658
414 Ga0070707_100008723
415 Ga0070707_100220690
416 Ga0070707_100335084
417 Ga0070698_100001832
418 Ga0070698_100023393
419 Ga0070698_100800651
420 Ga0070699_100019324
421 Ga0070699_100264722
422 Ga0070699_101000217
423 Ga0070699_101496501
424 Ga0070697_100044710
425 Ga0070697_101212659
426 Ga0070697_101640830
427 Ga0070672_100712344
428 Ga0070686_100046632
429 Ga0070686_100264405
430 Ga0070695_100129705
431 Ga0070695_101473383
432 Ga0070696_100123848
433 Ga0070693_100645274
434 Ga0070704_100381908
435 Ga0070704_100417642
436 Ga0070704_101183351
437 Ga0068857_100452630
438 Ga0068857_100585828
439 Ga0068857_101985551
440 Ga0070702_100013227
441 Ga0070702_100952327
442 Ga0068859_100016648
443 Ga0068859_100025547
444 Ga0068864_100827471
445 Ga0068866_10099478
446 Ga0068861_100073787
447 Ga0068870_10023421
448 Ga0068870_10103387
449 Ga0068863_100020146
450 Ga0068863_100395485
451 Ga0068863_101492689
452 Ga0068858_100011139
453 Ga0068858_100877294
454 Ga0068860_100058889
455 Ga0075365_10134434
456 Ga0075365_10479649
457 Ga0075368_10036628
458 Ga0075363_100138293
459 Ga0075363_100947304
460 Ga0075364_10072228
461 Ga0075364_10115841
462 Ga0075364_10664227
463 Ga0075432_10217872
464 Ga0075362_10154815
465 Ga0075367_10012959
466 Ga0075366_10001093
467 Ga0097621_100031791
468 Ga0097621_101901335
469 Ga0075428_100188120
470 Ga0075428_100231960
471 Ga0075428_100259903
472 Ga0075428_100501066
473 Ga0075428_100623450
474 Ga0075430_100158109
475 Ga0075431_100042537
476 Ga0075431_100172168
477 Ga0075431_100423404
478 Ga0075431_100640787
479 Ga0075431_101008645
480 Ga0075433_10007829
481 Ga0075433_10051288
482 Ga0075433_10078108
483 Ga0075433_10113582
484 Ga0075433_10123939
485 Ga0075433_10209174
486 Ga0075433_10515267
487 Ga0075434_100012943
488 Ga0075434_100038545
489 Ga0075434_100059243
490 Ga0075434_100069806
491 Ga0075434_100071620
492 Ga0075434_100084473
493 Ga0075434_100104079
494 Ga0075434_100408805
495 Ga0075434_100717131
496 Ga0075434_100968407
497 Ga0075434_102243445
498 Ga0075429_100003316
499 Ga0075429_100025183
500 Ga0075429_100037310
501 Ga0075429_100124378
502 Ga0075429_100151689
503 Ga0075429_100194359
504 Ga0075429_101274316
505 Ga0075429_101355845
506 Ga0068865_100009785
507 Ga0075436_100096729
508 Ga0075436_100505690
509 Ga0097620_100016649
510 Ga0097620_100025547
511 Ga0075435_100096050
512 Ga0075435_100099643
513 Ga0099794_10063655
514 Ga0111539_10000105
515 Ga0111539_10077680
516 Ga0111539_10095467
517 Ga0111539_10429381
518 Ga0111539_10444589
519 Ga0111539_11651838
520 Ga0105245_10466419
521 Ga0105245_12597376
522 Ga0105247_10179749
523 Ga0114129_10001312
524 Ga0114129_10003737
525 Ga0114129_10006961
526 Ga0114129_10019886
527 Ga0114129_10020125
528 Ga0114129_10040627
529 Ga0114129_10088424
530 Ga0114129_10099888
531 Ga0114129_10241500
532 Ga0114129_10374487
533 Ga0114129_10431738
534 Ga0114129_10697356
535 Ga0114129_11395127
536 Ga0114129_11778742
537 Ga0114129_12843962
538 Ga0114129_13386464
539 Ga0105243_10015287
540 Ga0105243_10947106
541 Ga0105242_10169624
542 Ga0105242_11247764
543 Ga0105248_10062254
544 Ga0105238_10665015
545 Ga0105249_10459088
546 Ga0105249_12275997
547 Ga0105239_11763619
548 Ga0105239_12329018
549 Ga0105246_10248473
550 Ga0105246_10432036
551 Ga0105246_10510821
552 Ga0105246_11562368
553 Ga0157378_12088023
554 Ga0163162_10128361
555 Ga0163162_12226150
556 Ga0157380_10008812
557 Ga0157379_10078380
558 Ga0157379_11444946
559 Ga0157376_10508953
560 Ga0163161_10148116
561 Ga0207697_10513316
562 Ga0207653_10055722
563 Ga0207642_10043306
564 Ga0207680_10129420
565 Ga0207699_10712699
566 Ga0207645_10047916
567 Ga0207643_10047166
568 Ga0207684_10008616
569 Ga0207684_10010107
570 Ga0207660_10449906
571 Ga0207662_10020535
572 Ga0207662_10809942
573 Ga0207657_10365987
574 Ga0207652_11622981
575 Ga0207646_10002195
576 Ga0207646_10040272
577 Ga0207646_10581336
578 Ga0207681_10048347
579 Ga0207681_10607030
580 Ga0207659_10164426
581 Ga0207706_10033351
582 Ga0207706_10469578
583 Ga0207709_10152603
584 Ga0207670_10090433
585 Ga0207670_10462686
586 Ga0207669_10017806
587 Ga0207704_10265195
588 Ga0207691_10104751
589 Ga0207691_10528400
590 Ga0207711_10099098
591 Ga0207689_10073743
592 Ga0207651_10024858
593 Ga0207651_10231632
594 Ga0207668_10148627
595 Ga0207640_11706418
596 Ga0207677_10438927
597 Ga0207703_10065933
598 Ga0207678_10015489
599 Ga0207708_10062915
600 Ga0207708_10125082
601 Ga0207641_10029171
602 Ga0207641_11342065
603 Ga0207648_10002928
604 Ga0207676_10023008
605 Ga0207676_10083847
606 Ga0207676_11608873
607 Ga0207674_10126068
608 Ga0207675_100006570
609 Ga0207675_101222648
610 Ga0207683_10229964
611 Ga0209813_10021733
612 Ga0207428_10000056
613 Ga0207428_10259285
614 Ga0207428_10420564
615 Ga0268266_10282904
616 Ga0268265_10041640
617 Ga0268264_10258919
618 Ga0373958_0119919
619 Ga0373961_0224593
620 Ga0373962_0201161
621 Ga0316574_0009287
622 Ga0373937_0121371
623 Ga0436360_1023926
624 Ga0436362_0202137
625 Ga0436362_0482449
626 Ga0451807_2454992
627 Ga0439459_0183652
628 Ga0453684_0936000
629 Ga0451576_2149466
630 Ga0495638_0005954
631 Ga0495586_0208953
632 Ga0495587_0831315
633 Ga0495645_0388033
634 Ga0495636_0639762
635 Ga0496104_0252845
636 Ga0501036_0303894
637 Ga0501039_0671046
638 Ga0501040_0185947
639 Ga0501043_0650269
640 Ga0501068_0199428
641 Ga0501071_0052143
642 Ga0501074_0135639
643 Ga0501075_0056779
644 Ga0501076_0023727
645 Ga0501079_0161521
646 Ga0501079_0992453
647 Ga0501081_0077813
648 Ga0501081_0478200
649 Ga0501081_1046228
650 Ga0501081_1050525
651 Ga0501083_0202877
652 Ga0501045_0599626
653 nmdc:mga03683_57375_c2
654 nmdc:mga00v17_121309_c1
655 nmdc:mga00v17_277903_c1
656 nmdc:mga00v17_45909_c1
657 nmdc:mga0yw44_431087_c1
658 nmdc:mga0k408_6705_c1
659 nmdc:mga06z11_1011309_c1
660 nmdc:mga04h51_22001_c1
661 nmdc:mga05p37_128830_c1
662 nmdc:mga05p37_1711420_c1
663 nmdc:mga05p37_173856_c1
664 nmdc:mga05p37_197871_c1
665 nmdc:mga05p37_2194367_c1
666 nmdc:mga05p37_298773_c1
667 nmdc:mga05p37_5760_c1
668 nmdc:mga05p37_6115_c1
669 nmdc:mga05p37_751617_c1
670 nmdc:mga05p37_76454_c1
671 nmdc:mga05p37_913972_c1
672 nmdc:mga05p37_996481_c1
673 nmdc:mga09592_1143_c1
674 nmdc:mga09592_162910_c1
675 nmdc:mga09592_185529_c1
676 nmdc:mga09592_359697_c1
677 nmdc:mga09592_57650_c1
678 nmdc:mga09592_98018_c1
679 nmdc:mga0qj67_223201_c1
680 nmdc:mga0qj67_319844_c1
681 nmdc:mga0qj67_766722_c1
682 nmdc:mga06r32_119441_c1
683 nmdc:mga06r32_1493023_c1
684 nmdc:mga06r32_1687460_c1
685 nmdc:mga06r32_17871_c1
686 nmdc:mga06r32_34603_c1
687 nmdc:mga08y16_1172203_c1
688 nmdc:mga08y16_140874_c1
689 nmdc:mga08y16_210645_c1
690 nmdc:mga08y16_220602_c1
691 nmdc:mga08y16_374375_c1
692 nmdc:mga08y16_835601_c1
693 nmdc:mga08y16_894_c1
694 nmdc:mga0n895_112670_c1
695 nmdc:mga0n895_1978633_c1
696 nmdc:mga0n895_2152690_c1
697 nmdc:mga0n895_517688_c1
698 nmdc:mga0n895_59157_c1
699 nmdc:mga0n895_637056_c1
700 nmdc:mga0n895_700508_c1
701 nmdc:mga0n895_748448_c1
702 nmdc:mga0n895_84172_c1
703 nmdc:mga0n895_98799_c1
704 nmdc:mga0rr50_120080_c1
705 nmdc:mga0rr50_28576_c1
706 nmdc:mga08x19_473300_c1
707 nmdc:mga0a205_1034539_c1
708 nmdc:mga0a205_152835_c1
709 nmdc:mga0a205_3621_c1
710 nmdc:mga0a205_514327_c1
711 nmdc:mga0a205_587894_c1
712 nmdc:mga0a205_588140_c1
713 nmdc:mga0a205_62747_c1
714 nmdc:mga0a205_65680_c1
715 nmdc:mga0a205_70400_c1
716 Ga0501084_0865315
717 Ga0501084_1575584
718 Ga0501082_0015027
719 Ga0501082_0484826
720 Ga0530510_0289254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

2

113

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oba-assembly1.cif.gz_D pseudomonas aeruginosa 6-pyruvoyl tetrahydrobiopterin synthase 0.8818 1 108
4ntm-assembly1.cif.gz_C qued soaked with sepiapterin (selenomethionine substituted protein) 0.8793 1 108
4ntk-assembly1.cif.gz_D qued from e. coli 0.877 1 108
2oba-assembly1.cif.gz_D pseudomonas aeruginosa 6-pyruvoyl tetrahydrobiopterin synthase 0.8743 1 108
4ntm-assembly1.cif.gz_C qued soaked with sepiapterin (selenomethionine substituted protein) 0.8719 1 108
ID Description Score Start End Superfamily
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8603 1 108 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.853 1 108 3.30.479.10
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8409 1 108 3.30.479.10
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8339 1 108 3.30.479.10
1y13C00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8158 1 108 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A3N5EEI0-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9259 1 108 GO:0046872
GO:0070497
AF-A0A2V8MXB6-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9191 1 81 GO:0046872
GO:0070497
AF-A0A7V2V189-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9181 1 108 GO:0008616
GO:0016829
GO:0046872
AF-A0A3N5EEI0-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9178 1 108 GO:0046872
GO:0070497
AF-A0A645CS02-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase 0.9146 1 108 GO:0016829
GO:0046872

Map