F421745

General Info

Members Datasets Scaffolds Average Seq Length
360 268 322 236

Family's Representative Sequence

Representative Sequence 3300002067|JGI24735J21928_10008845|JGI24735J21928_100088452
Length 273
Sequence VTIAETRPGRPDYERDVPLLVAEGVTRTFETAAGTVTALAEASLTVRPGELVVVKGPSGSGKTTLLNVLSGLDRASGGRVVLDGVDLSTASEAQLVDLRRRSTGFVFQSFGLVPVLSAAENVELPLRLLGVAPAERDARVDALLDSVGLGGHARQRPTELSGGQQQRVGIARALAGEPRILFADEPTGQLDSMTGRAIMDLLVALVHGQGIAAVVTTHDPLLMARADRVLELHDGRLGAGSSRPRGRHAAPLMGGEVADDGGSRGHHRGESER

Samples

Sample ID Description Type Environment
1 2643221616 Leifsonia sp. Root227 Isolate Unclassified
2 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
3 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
4 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
5 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
6 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
7 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
8 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
9 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
10 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
11 2858882152 Micromonospora noduli MED15 Isolate Nodule
12 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
13 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
14 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
15 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
16 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
17 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
18 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
19 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
20 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
21 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
22 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
23 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
24 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
25 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
26 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
27 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
28 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
29 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
30 2928153084 Leifsonia sp. 563 Isolate Unclassified
31 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
32 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
33 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
34 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
35 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
36 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
39 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
40 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
41 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
42 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
160 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
161 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
168 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
169 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
170 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
171 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
186 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
187 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
190 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
191 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
192 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
206 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
207 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
257 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
260 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
261 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
262 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
263 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
264 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
266 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
267 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
268 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.61
Metatranscriptomes 0.83
Isolates 10.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.22
Nodule 0.83
Rhizoplane 8.33
Rhizosphere 71.67
Stem 0
Stem Tuber 0.28
Unclassified 11.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10008845 3300002067 Bacteria 3248
2 JGI25164J39214_1000361 3300002772 Bacteria 27742
3 JGI25406J46586_10010438 3300003203 Bacteria 4121
4 JGI25165J46597_1000061 3300003214 Bacteria 208362
5 Ga0006562J51391_1053814 3300003578 Bacteria 2310
6 Ga0006562J51391_1097213 3300003578 Bacteria 5590
7 Ga0006562J51391_1097214 3300003578 Bacteria 1963
8 Ga0055539_1000006 3300003752 Bacteria 580055
9 Ga0055533_1000002 3300003756 Bacteria 1196393
10 Ga0055525_1000223 3300003759 Bacteria 61497
11 Ga0055541_1000630 3300003841 Bacteria 9304
12 Ga0070658_10042631 3300005327 Bacteria 3665
13 Ga0070690_100254411 3300005330 Bacteria 1243
14 Ga0070690_100560056 3300005330 Bacteria 863
15 Ga0070670_100514917 3300005331 Bacteria 1065
16 Ga0068869_100739297 3300005334 Bacteria 841
17 Ga0070666_10354102 3300005335 Bacteria 1051
18 Ga0070689_100164711 3300005340 Bacteria 1794
19 Ga0070691_10044173 3300005341 Bacteria 2112
20 Ga0070675_100812076 3300005354 Bacteria 855
21 Ga0070671_100217743 3300005355 Bacteria 1620
22 Ga0070674_100028913 3300005356 Bacteria 3644
23 Ga0070673_100779723 3300005364 Bacteria 882
24 Ga0070710_10076011 3300005437 Bacteria 1948
25 Ga0070701_10029954 3300005438 Bacteria 2689
26 Ga0070705_100390217 3300005440 Bacteria 1027
27 Ga0070700_100097659 3300005441 Bacteria 1929
28 Ga0070694_100446250 3300005444 Bacteria 1021
29 Ga0070678_100071362 3300005456 Bacteria 2600
30 Ga0070662_100135442 3300005457 Bacteria 1904
31 Ga0070685_10106250 3300005466 Bacteria 1722
32 Ga0070684_100330405 3300005535 Bacteria 1401
33 Ga0070672_100162521 3300005543 Bacteria 1853
34 Ga0070686_100073087 3300005544 Bacteria 2250
35 Ga0070686_100285938 3300005544 Bacteria 1218
36 Ga0070695_100153818 3300005545 Bacteria 1608
37 Ga0070696_100670502 3300005546 Bacteria 843
38 Ga0070664_100563835 3300005564 Bacteria 1054
39 Ga0068857_100002399 3300005577 Bacteria 15278
40 Ga0068857_100494238 3300005577 Bacteria 1147
41 Ga0068854_100039850 3300005578 Bacteria 3311
42 Ga0068856_100679280 3300005614 Bacteria 1050
43 Ga0070702_100013840 3300005615 Bacteria 4082
44 Ga0070702_100030834 3300005615 Bacteria 2927
45 Ga0068864_100331661 3300005618 Bacteria 1432
46 Ga0068866_10209858 3300005718 Bacteria 1168
47 Ga0068861_100130870 3300005719 Bacteria 2036
48 Ga0068858_100109863 3300005842 Bacteria 2575
49 Ga0068858_100660841 3300005842 Bacteria 1016
50 Ga0068862_100372391 3300005844 Bacteria 1330
51 Ga0081455_10008492 3300005937 Bacteria 10673
52 Ga0081455_10176760 3300005937 Bacteria 1620
53 Ga0081538_10006917 3300005981 Bacteria 9866
54 Ga0081539_10000419 3300005985 Bacteria 90362
55 Ga0075365_10020422 3300006038 Bacteria 4106
56 Ga0075365_10174550 3300006038 Bacteria 1501
57 Ga0075432_10101399 3300006058 Bacteria 1064
58 Ga0075428_100015283 3300006844 Bacteria 8514
59 Ga0075430_100016988 3300006846 Bacteria 6196
60 Ga0075431_100021453 3300006847 Bacteria 6606
61 Ga0075431_100615472 3300006847 Bacteria 1069
62 Ga0075429_100017264 3300006880 Bacteria 6241
63 Ga0075429_100244667 3300006880 Bacteria 1571
64 Ga0111539_10002777 3300009094 Bacteria 23238
65 Ga0105245_10039428 3300009098 Bacteria 4204
66 Ga0105245_10170164 3300009098 Bacteria 2074
67 Ga0105245_10438185 3300009098 Bacteria 1313
68 Ga0105247_10276717 3300009101 Bacteria 1156
69 Ga0114129_10029527 3300009147 Bacteria 7766
70 Ga0114129_10054540 3300009147 Bacteria 5604
71 Ga0114129_10780128 3300009147 Bacteria 1221
72 Ga0105243_10434212 3300009148 Bacteria 1228
73 Ga0105241_10333359 3300009174 Bacteria 1312
74 Ga0105242_10359550 3300009176 Bacteria 1347
75 Ga0105242_10394374 3300009176 Bacteria 1290
76 Ga0105248_10144675 3300009177 Bacteria 2682
77 Ga0105248_10223589 3300009177 Bacteria 2119
78 Ga0105238_10974351 3300009551 Bacteria 868
79 Ga0105249_10116052 3300009553 Bacteria 2537
80 Ga0105249_10247782 3300009553 Bacteria 1765
81 Ga0105239_10018764 3300010375 Bacteria 7641
82 Ga0105246_10046226 3300011119 Bacteria 2968
83 Ga0157371_10323361 3300013102 Bacteria 1120
84 Ga0157369_10039380 3300013105 Bacteria 5165
85 Ga0171462_1002 3300013250 Bacteria 1052134
86 Ga0157372_10052790 3300013307 Bacteria 4528
87 Ga0157372_10243033 3300013307 Bacteria 2089
88 Ga0157375_10217285 3300013308 Bacteria 2070
89 Ga0157375_10357278 3300013308 Bacteria 1627
90 Ga0163163_10084160 3300014325 Bacteria 3186
91 Ga0163163_10161346 3300014325 Bacteria 2287
92 Ga0163163_10229304 3300014325 Bacteria 1906
93 Ga0163163_10458599 3300014325 Bacteria 1335
94 Ga0163163_10714099 3300014325 Bacteria 1066
95 Ga0157380_10357437 3300014326 Bacteria 1369
96 Ga0157380_10792031 3300014326 Bacteria 964
97 Ga0157377_10053358 3300014745 Bacteria 2286
98 Ga0213875_10011382 3300021388 Bacteria 4425
99 Ga0209566_100032 3300025225 Bacteria 338313
100 Ga0209674_100001 3300025226 Bacteria 4013750
101 Ga0209563_100001 3300025230 Bacteria 4013775
102 Ga0209563_101165 3300025230 Bacteria 7380
103 Ga0207427_100042 3300025231 Bacteria 254170
104 Ga0209677_100001 3300025253 Bacteria 4013787
105 Ga0209233_1000001 3300025261 Bacteria 2992747
106 Ga0209455_1001253 3300025272 Bacteria 11925
107 Ga0207692_10040944 3300025898 Bacteria 2290
108 Ga0207642_10005967 3300025899 Bacteria 4017
109 Ga0207688_10082833 3300025901 Bacteria 1834
110 Ga0207688_10436014 3300025901 Bacteria 816
111 Ga0207647_10102416 3300025904 Bacteria 1698
112 Ga0207645_10035464 3300025907 Bacteria 3203
113 Ga0207643_10529839 3300025908 Bacteria 755
114 Ga0207705_10045672 3300025909 Bacteria 3147
115 Ga0207660_10126481 3300025917 Bacteria 1941
116 Ga0207687_10110244 3300025927 Bacteria 2041
117 Ga0207687_10134654 3300025927 Bacteria 1867
118 Ga0207700_10093146 3300025928 Bacteria 2384
119 Ga0207644_10238571 3300025931 Bacteria 1447
120 Ga0207706_10254868 3300025933 Bacteria 1532
121 Ga0207706_10510293 3300025933 Bacteria 1037
122 Ga0207686_10137657 3300025934 Bacteria 1683
123 Ga0207709_10370184 3300025935 Bacteria 1087
124 Ga0207670_10362041 3300025936 Bacteria 1151
125 Ga0207670_10561783 3300025936 Bacteria 933
126 Ga0207669_10183952 3300025937 Bacteria 1501
127 Ga0207704_10055060 3300025938 Bacteria 2429
128 Ga0207691_10019804 3300025940 Bacteria 6365
129 Ga0207691_10801745 3300025940 Bacteria 791
130 Ga0207689_10047743 3300025942 Bacteria 3532
131 Ga0207689_10120656 3300025942 Bacteria 2157
132 Ga0207661_10763256 3300025944 Bacteria 890
133 Ga0207679_10028365 3300025945 Bacteria 3883
134 Ga0207658_10278482 3300025986 Bacteria 1433
135 Ga0207677_10318746 3300026023 Bacteria 1291
136 Ga0207703_10105076 3300026035 Bacteria 2400
137 Ga0207703_10129596 3300026035 Bacteria 2176
138 Ga0207708_10023934 3300026075 Bacteria 4618
139 Ga0207702_10568128 3300026078 Bacteria 1111
140 Ga0207676_10167498 3300026095 Bacteria 1911
141 Ga0207674_10001651 3300026116 Bacteria 28696
142 Ga0207674_10040458 3300026116 Bacteria 4828
143 Ga0207675_100020381 3300026118 Bacteria 6181
144 Ga0207683_10119683 3300026121 Bacteria 2363
145 Ga0207698_10155241 3300026142 Bacteria 1993
146 Ga0209966_1027803 3300027695 Bacteria 1133
147 Ga0207428_10010153 3300027907 Bacteria 8421
148 Ga0207428_10128763 3300027907 Bacteria 1938
149 Ga0307408_100565752 3300031548 Bacteria 1005
150 Ga0307405_10037643 3300031731 Bacteria 2909
151 Ga0307405_10104011 3300031731 Bacteria 1910
152 Ga0307405_10160705 3300031731 Bacteria 1591
153 Ga0307413_10014144 3300031824 Bacteria 4041
154 Ga0307413_10315571 3300031824 Bacteria 1192
155 Ga0307410_10009415 3300031852 Bacteria 5478
156 Ga0307410_10124316 3300031852 Bacteria 1886
157 Ga0307406_10008108 3300031901 Bacteria 5853
158 Ga0307406_10250732 3300031901 Bacteria 1333
159 Ga0307407_10063050 3300031903 Bacteria 2173
160 Ga0307412_10011748 3300031911 Bacteria 5080
161 Ga0307409_100011549 3300031995 Bacteria 5578
162 Ga0307409_100021682 3300031995 Bacteria 4410
163 Ga0307409_100241557 3300031995 Bacteria 1645
164 Ga0307416_100003234 3300032002 Bacteria 9546
165 Ga0307416_100032443 3300032002 Bacteria 3946
166 Ga0307414_10362269 3300032004 Bacteria 1248
167 Ga0307411_10213301 3300032005 Bacteria 1492
168 Ga0307411_10273937 3300032005 Bacteria 1340
169 Ga0307415_100000020 3300032126 Bacteria 67626
170 Ga0307415_100007355 3300032126 Bacteria 6018
171 Ga0307415_100011763 3300032126 Bacteria 5026
172 Ga0373948_0037325 3300034817 Bacteria 1004
173 Ga0373950_0014967 3300034818 Bacteria 1311
174 Ga0373928_0029630 3300035084 Bacteria 1204
175 Ga0373939_0162599 3300035114 Bacteria 821
176 Ga0373941_0004621 3300035115 Bacteria 3192
177 Ga0373942_0000620 3300035207 Bacteria 9955
178 Ga0373931_0067515 3300035691 Bacteria 1944
179 Ga0436363_0475647 3300039450 Bacteria 788
180 Ga0436363_1690868 3300039450 Bacteria 1910
181 Ga0439436_0044729 3300041404 Bacteria 1261
182 Ga0439465_0041609 3300041413 Bacteria 1488
183 Ga0451841_0525210 3300041498 Bacteria 710
184 Ga0439457_031215 3300042014 Bacteria 1181
185 Ga0439462_0030682 3300042015 Bacteria 1422
186 Ga0466969_0098716 3300044656 Bacteria 1377
187 Ga0466972_0026155 3300044658 Bacteria 2891
188 Ga0466972_0086873 3300044658 Bacteria 1486
189 Ga0466972_0129299 3300044658 Bacteria 1189
190 Ga0466966_0116565 3300044684 Bacteria 1644
191 Ga0466961_0022856 3300044693 Bacteria 4022
192 Ga0466961_0067407 3300044693 Bacteria 2273
193 Ga0466964_0001911 3300044706 Bacteria 7283
194 Ga0466971_0042389 3300044719 Bacteria 2045
195 Ga0466968_0023535 3300044735 Bacteria 2511
196 Ga0466970_0002854 3300044765 Bacteria 8350
197 Ga0466970_0127066 3300044765 Bacteria 1398
198 Ga0466957_0044336 3300044842 Bacteria 2695
199 Ga0466960_0323247 3300044901 Bacteria 874
200 Ga0466959_0055856 3300045049 Bacteria 2881
201 Ga0466958_0035004 3300045836 Bacteria 2999
202 Ga0466967_0026290 3300045976 Bacteria 4818
203 Ga0495617_026526 3300046452 Bacteria 1951
204 Ga0495591_052961 3300046458 Bacteria 1102
205 Ga0495605_0072080 3300046474 Bacteria 1630
206 Ga0495584_0100163 3300046491 Bacteria 1464
207 Ga0495596_0102774 3300046500 Bacteria 1110
208 Ga0495632_0099647 3300046519 Bacteria 1370
209 Ga0495637_0019487 3300046520 Bacteria 3136
210 Ga0495644_0131032 3300046523 Bacteria 955
211 Ga0495663_0015744 3300046525 Bacteria 2133
212 Ga0495642_0142437 3300046528 Bacteria 1035
213 Ga0495598_0032989 3300046537 Bacteria 1467
214 Ga0495634_0044764 3300046642 Bacteria 2994
215 Ga0495659_0009841 3300046664 Bacteria 3058
216 Ga0495647_0049701 3300046681 Bacteria 1625
217 Ga0495658_0138606 3300046683 Bacteria 1486
218 Ga0495669_0075920 3300046684 Bacteria 1538
219 Ga0495613_0019075 3300046689 Bacteria 5112
220 Ga0495670_0150068 3300046691 Bacteria 1222
221 Ga0495649_0181232 3300046694 Bacteria 1099
222 Ga0495589_0053135 3300046794 Bacteria 2000
223 Ga0495660_0066513 3300046810 Bacteria 1922
224 Ga0495683_0134596 3300047323 Bacteria 1163
225 Ga0495615_0005923 3300048090 Bacteria 2232
226 Ga0495615_0172753 3300048090 Bacteria 655
227 Ga0496100_0134439 3300048903 Bacteria 1745
228 Ga0496100_0160437 3300048903 Bacteria 1611
229 Ga0496100_0225095 3300048903 Bacteria 1378
230 Ga0496100_0544382 3300048903 Bacteria 897
231 Ga0496101_0020675 3300048904 Bacteria 4512
232 Ga0496101_0349746 3300048904 Bacteria 1161
233 Ga0496102_0055853 3300048905 Bacteria 3601
234 Ga0496102_0136360 3300048905 Bacteria 2300
235 Ga0496102_0689923 3300048905 Bacteria 944
236 Ga0496103_0111145 3300048906 Bacteria 1741
237 Ga0496104_0011612 3300048907 Bacteria 7894
238 Ga0496104_0028280 3300048907 Bacteria 5196
239 Ga0496105_0012212 3300048908 Bacteria 6799
240 Ga0496105_0138051 3300048908 Bacteria 2007
241 Ga0496106_0219555 3300048909 Bacteria 1516
242 Ga0496107_0041623 3300048910 Bacteria 3299
243 Ga0496108_0000020 3300048911 Bacteria 226992
244 Ga0496108_0048481 3300048911 Bacteria 3552
245 Ga0496108_0064601 3300048911 Bacteria 3083
246 Ga0496109_0049173 3300048912 Bacteria 3837
247 Ga0496109_0093779 3300048912 Bacteria 2778
248 Ga0496109_0155189 3300048912 Bacteria 2144
249 Ga0496111_0001385 3300048914 Bacteria 13767
250 Ga0496112_0054911 3300048915 Bacteria 3915
251 Ga0496112_0309152 3300048915 Bacteria 1526
252 Ga0496113_0078282 3300048916 Bacteria 2529
253 Ga0496114_0044497 3300048917 Bacteria 3684
254 Ga0496114_0054034 3300048917 Bacteria 3348
255 Ga0496114_0318314 3300048917 Bacteria 1374
256 Ga0496115_0169367 3300048918 Bacteria 1806
257 Ga0496117_0088153 3300048920 Bacteria 2008
258 Ga0496117_0172697 3300048920 Bacteria 1253
259 Ga0496118_0037476 3300048921 Bacteria 3901
260 Ga0496118_0199141 3300048921 Bacteria 1188
261 Ga0496119_0046541 3300048922 Bacteria 2708
262 Ga0496120_0031610 3300048923 Bacteria 3203
263 Ga0496124_0112025 3300048927 Bacteria 2195
264 Ga0496124_0563869 3300048927 Bacteria 749
265 Ga0496125_0005505 3300048928 Bacteria 14039
266 Ga0496126_0387616 3300048929 Bacteria 1136
267 Ga0501032_0262794 3300049569 Bacteria 1119
268 Ga0501033_0069282 3300049570 Bacteria 2593
269 Ga0501033_0381076 3300049570 Bacteria 985
270 Ga0501034_0305824 3300049571 Bacteria 1526
271 Ga0501037_0116488 3300049573 Bacteria 1923
272 Ga0501039_0183242 3300049575 Bacteria 1646
273 Ga0501040_0408091 3300049576 Bacteria 976
274 Ga0501042_0207850 3300049578 Bacteria 1412
275 Ga0501046_0014691 3300049580 Bacteria 6593
276 Ga0501047_0185869 3300049581 Bacteria 1943
277 Ga0501068_0046391 3300049584 Bacteria 2620
278 Ga0501068_0116817 3300049584 Bacteria 1662
279 Ga0501070_0000076 3300049586 Bacteria 83972
280 Ga0501071_0095358 3300049587 Bacteria 2189
281 Ga0501071_0314724 3300049587 Bacteria 1188
282 Ga0501072_0082387 3300049588 Bacteria 2550
283 Ga0501073_0043237 3300049589 Bacteria 3177
284 Ga0501075_0171397 3300049591 Bacteria 1656
285 Ga0501076_0039001 3300049592 Bacteria 3729
286 Ga0501076_0051514 3300049592 Bacteria 3259
287 Ga0501076_0424049 3300049592 Bacteria 1095
288 Ga0501077_0066158 3300049593 Bacteria 2292
289 Ga0501077_0070278 3300049593 Bacteria 2219
290 Ga0501079_0070962 3300049741 Bacteria 2690
291 Ga0501035_0017244 3300049822 Bacteria 6657
292 Ga0501035_0275891 3300049822 Bacteria 1422
293 Ga0501035_0509237 3300049822 Bacteria 990
294 Ga0501044_0013773 3300049823 Bacteria 8739
295 nmdc:mga0yw44_10972_c1 3300050492 Bacteria 4650
296 nmdc:mga0yw44_147512_c1 3300050492 Bacteria 1532
297 nmdc:mga0yw44_230741_c1 3300050492 Bacteria 1229
298 nmdc:mga0yw44_256159_c1 3300050492 Bacteria 1165
299 nmdc:mga05p37_19940_c1 3300050507 Bacteria 8113
300 nmdc:mga05p37_372508_c1 3300050507 Bacteria 1675
301 nmdc:mga05p37_41_c1 3300050507 Bacteria 108003
302 nmdc:mga09592_22750_c1 3300050508 Bacteria 5172
303 nmdc:mga09592_83748_c1 3300050508 Bacteria 2718
304 nmdc:mga06r32_169702_c1 3300050510 Bacteria 2165
305 nmdc:mga06r32_17731_c1 3300050510 Bacteria 6505
306 nmdc:mga06r32_793777_c1 3300050510 Bacteria 908
307 nmdc:mga08y16_13904_c1 3300050511 Bacteria 8470
308 nmdc:mga08y16_229592_c1 3300050511 Bacteria 1920
309 nmdc:mga0n895_901942_c1 3300050512 Bacteria 869
310 Ga0500635_0000148 3300053080 Bacteria 39620
311 Ga0495655_0017983 3300053083 Bacteria 1547
312 Ga0495619_0161059 3300053085 Bacteria 1550
313 Ga0500644_0055793 3300053088 Bacteria 1373
314 Ga0500651_0444194 3300053093 Bacteria 722
315 Ga0500559_0000121 3300053136 Bacteria 60650
316 Ga0500573_0000001 3300053140 Bacteria 436394
317 Ga0500573_0011801 3300053140 Bacteria 4897
318 Ga0590071_001445 3300059421 Bacteria 6264
319 Ga0590075_006316 3300059424 Bacteria 2812
320 Ga0530510_0087242 3300061734 Bacteria 2274
321 Ga0530510_0464256 3300061734 Bacteria 958
322 Ga0530510_0750033 3300061734 Bacteria 744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048090 Ga0495615_0172753 Ga0495615_0172753_39_641 200
2 3300044656 Ga0466969_0098716 Ga0466969_0098716_146_871 211
3 3300014326 Ga0157380_10357437 Ga0157380_103574372 217
4 3300021388 Ga0213875_10011382 Ga0213875_100113823 218
5 3300034817 Ga0373948_0037325 Ga0373948_0037325_307_966 218
6 3300048903 Ga0496100_0134439 Ga0496100_0134439_861_1535 219
7 3300034818 Ga0373950_0014967 Ga0373950_0014967_171_839 220
8 3300035084 Ga0373928_0029630 Ga0373928_0029630_495_1163 220
9 3300035115 Ga0373941_0004621 Ga0373941_0004621_1334_2002 220
10 3300035207 Ga0373942_0000620 Ga0373942_0000620_5988_6656 220
11 3300035691 Ga0373931_0067515 Ga0373931_0067515_826_1494 220
12 3300039450 Ga0436363_0475647 Ga0436363_0475647_109_771 220
13 3300050492 nmdc:mga0yw44_256159_c1 nmdc:mga0yw44_256159_c1_335_997 220
14 3300041498 Ga0451841_0525210 Ga0451841_0525210_12_677 221
15 3300048927 Ga0496124_0112025 Ga0496124_0112025_691_1356 221
16 3300048927 Ga0496124_0563869 Ga0496124_0563869_23_688 221
17 3300050492 nmdc:mga0yw44_147512_c1 nmdc:mga0yw44_147512_c1_436_1101 221
18 3300050510 nmdc:mga06r32_793777_c1 nmdc:mga06r32_793777_c1_192_857 221
19 3300053085 Ga0495619_0161059 Ga0495619_0161059_767_1432 221
20 3300009553 Ga0105249_10116052 Ga0105249_101160521 222
21 3300048911 Ga0496108_0000020 Ga0496108_0000020_174946_175617 222
22 3300048921 Ga0496118_0199141 Ga0496118_0199141_509_1177 222
23 3300053140 Ga0500573_0000001 Ga0500573_0000001_117513_118181 222
24 3300005330 Ga0070690_100560056 Ga0070690_1005600561 223
25 3300005334 Ga0068869_100739297 Ga0068869_1007392971 223
26 3300005340 Ga0070689_100164711 Ga0070689_1001647111 223
27 3300005341 Ga0070691_10044173 Ga0070691_100441732 223
28 3300005355 Ga0070671_100217743 Ga0070671_1002177432 223
29 3300005356 Ga0070674_100028913 Ga0070674_1000289132 223
30 3300005438 Ga0070701_10029954 Ga0070701_100299541 223
31 3300005440 Ga0070705_100390217 Ga0070705_1003902172 223
32 3300005441 Ga0070700_100097659 Ga0070700_1000976592 223
33 3300005444 Ga0070694_100446250 Ga0070694_1004462501 223
34 3300005457 Ga0070662_100135442 Ga0070662_1001354422 223
35 3300005466 Ga0070685_10106250 Ga0070685_101062502 223
36 3300005543 Ga0070672_100162521 Ga0070672_1001625213 223
37 3300005544 Ga0070686_100285938 Ga0070686_1002859381 223
38 3300005545 Ga0070695_100153818 Ga0070695_1001538182 223
39 3300005546 Ga0070696_100670502 Ga0070696_1006705021 223
40 3300005564 Ga0070664_100563835 Ga0070664_1005638352 223
41 3300005577 Ga0068857_100002399 Ga0068857_1000023994 223
42 3300005577 Ga0068857_100494238 Ga0068857_1004942382 223
43 3300005578 Ga0068854_100039850 Ga0068854_1000398503 223
44 3300005615 Ga0070702_100030834 Ga0070702_1000308342 223
45 3300005718 Ga0068866_10209858 Ga0068866_102098582 223
46 3300005719 Ga0068861_100130870 Ga0068861_1001308703 223
47 3300005842 Ga0068858_100660841 Ga0068858_1006608411 223
48 3300005844 Ga0068862_100372391 Ga0068862_1003723912 223
49 3300005937 Ga0081455_10008492 Ga0081455_100084924 223
50 3300005937 Ga0081455_10176760 Ga0081455_101767602 223
51 3300006058 Ga0075432_10101399 Ga0075432_101013992 223
52 3300006844 Ga0075428_100015283 Ga0075428_10001528310 223
53 3300006847 Ga0075431_100021453 Ga0075431_1000214534 223
54 3300009094 Ga0111539_10002777 Ga0111539_100027777 223
55 3300009098 Ga0105245_10039428 Ga0105245_100394284 223
56 3300009098 Ga0105245_10170164 Ga0105245_101701643 223
57 3300009147 Ga0114129_10780128 Ga0114129_107801281 223
58 3300009148 Ga0105243_10434212 Ga0105243_104342122 223
59 3300009176 Ga0105242_10359550 Ga0105242_103595502 223
60 3300009177 Ga0105248_10144675 Ga0105248_101446752 223
61 3300009553 Ga0105249_10247782 Ga0105249_102477822 223
62 3300010375 Ga0105239_10018764 Ga0105239_100187644 223
63 3300011119 Ga0105246_10046226 Ga0105246_100462263 223
64 3300013102 Ga0157371_10323361 Ga0157371_103233612 223
65 3300013308 Ga0157375_10217285 Ga0157375_102172852 223
66 3300014325 Ga0163163_10458599 Ga0163163_104585992 223
67 3300014325 Ga0163163_10714099 Ga0163163_107140992 223
68 3300014745 Ga0157377_10053358 Ga0157377_100533582 223
69 3300025899 Ga0207642_10005967 Ga0207642_100059672 223
70 3300025901 Ga0207688_10082833 Ga0207688_100828332 223
71 3300025907 Ga0207645_10035464 Ga0207645_100354643 223
72 3300025908 Ga0207643_10529839 Ga0207643_105298391 223
73 3300025917 Ga0207660_10126481 Ga0207660_101264813 223
74 3300025927 Ga0207687_10110244 Ga0207687_101102442 223
75 3300025931 Ga0207644_10238571 Ga0207644_102385712 223
76 3300025933 Ga0207706_10254868 Ga0207706_102548682 223
77 3300025934 Ga0207686_10137657 Ga0207686_101376572 223
78 3300025935 Ga0207709_10370184 Ga0207709_103701842 223
79 3300025936 Ga0207670_10362041 Ga0207670_103620412 223
80 3300025937 Ga0207669_10183952 Ga0207669_101839522 223
81 3300025938 Ga0207704_10055060 Ga0207704_100550603 223
82 3300025940 Ga0207691_10019804 Ga0207691_100198043 223
83 3300025940 Ga0207691_10801745 Ga0207691_108017451 223
84 3300025942 Ga0207689_10047743 Ga0207689_100477431 223
85 3300025944 Ga0207661_10763256 Ga0207661_107632562 223
86 3300026035 Ga0207703_10105076 Ga0207703_101050762 223
87 3300026075 Ga0207708_10023934 Ga0207708_100239343 223
88 3300026116 Ga0207674_10001651 Ga0207674_1000165117 223
89 3300026116 Ga0207674_10040458 Ga0207674_100404584 223
90 3300026118 Ga0207675_100020381 Ga0207675_1000203812 223
91 3300026142 Ga0207698_10155241 Ga0207698_101552412 223
92 3300027695 Ga0209966_1027803 Ga0209966_10278032 223
93 3300027907 Ga0207428_10010153 Ga0207428_100101536 223
94 3300027907 Ga0207428_10128763 Ga0207428_101287632 223
95 3300031548 Ga0307408_100565752 Ga0307408_1005657522 223
96 3300031731 Ga0307405_10104011 Ga0307405_101040112 223
97 3300031731 Ga0307405_10160705 Ga0307405_101607052 223
98 3300031824 Ga0307413_10014144 Ga0307413_100141445 223
99 3300031852 Ga0307410_10009415 Ga0307410_100094153 223
100 3300031901 Ga0307406_10250732 Ga0307406_102507322 223
101 3300031903 Ga0307407_10063050 Ga0307407_100630502 223
102 3300031911 Ga0307412_10011748 Ga0307412_100117484 223
103 3300031995 Ga0307409_100021682 Ga0307409_1000216824 223
104 3300031995 Ga0307409_100241557 Ga0307409_1002415572 223
105 3300032002 Ga0307416_100003234 Ga0307416_1000032344 223
106 3300032005 Ga0307411_10213301 Ga0307411_102133012 223
107 3300032126 Ga0307415_100007355 Ga0307415_1000073554 223
108 3300035114 Ga0373939_0162599 Ga0373939_0162599_84_758 223
109 3300046452 Ga0495617_026526 Ga0495617_026526_354_1028 223
110 3300046458 Ga0495591_052961 Ga0495591_052961_56_730 223
111 3300046474 Ga0495605_0072080 Ga0495605_0072080_609_1283 223
112 3300046491 Ga0495584_0100163 Ga0495584_0100163_587_1261 223
113 3300046500 Ga0495596_0102774 Ga0495596_0102774_197_871 223
114 3300046520 Ga0495637_0019487 Ga0495637_0019487_1617_2291 223
115 3300046523 Ga0495644_0131032 Ga0495644_0131032_34_708 223
116 3300046525 Ga0495663_0015744 Ga0495663_0015744_385_1059 223
117 3300046528 Ga0495642_0142437 Ga0495642_0142437_321_995 223
118 3300046537 Ga0495598_0032989 Ga0495598_0032989_245_919 223
119 3300046664 Ga0495659_0009841 Ga0495659_0009841_1737_2411 223
120 3300046684 Ga0495669_0075920 Ga0495669_0075920_789_1463 223
121 3300046691 Ga0495670_0150068 Ga0495670_0150068_354_1028 223
122 3300046694 Ga0495649_0181232 Ga0495649_0181232_348_1022 223
123 3300046794 Ga0495589_0053135 Ga0495589_0053135_846_1520 223
124 3300046810 Ga0495660_0066513 Ga0495660_0066513_72_746 223
125 3300047323 Ga0495683_0134596 Ga0495683_0134596_414_1088 223
126 3300048090 Ga0495615_0005923 Ga0495615_0005923_1422_2096 223
127 3300048905 Ga0496102_0689923 Ga0496102_0689923_64_738 223
128 3300048906 Ga0496103_0111145 Ga0496103_0111145_878_1552 223
129 3300049584 Ga0501068_0046391 Ga0501068_0046391_753_1427 223
130 3300049587 Ga0501071_0314724 Ga0501071_0314724_28_702 223
131 3300050492 nmdc:mga0yw44_10972_c1 nmdc:mga0yw44_10972_c1_3649_4344 223
132 3300050492 nmdc:mga0yw44_230741_c1 nmdc:mga0yw44_230741_c1_117_800 223
133 3300050507 nmdc:mga05p37_372508_c1 nmdc:mga05p37_372508_c1_560_1234 223
134 3300050510 nmdc:mga06r32_17731_c1 nmdc:mga06r32_17731_c1_281_955 223
135 3300050511 nmdc:mga08y16_13904_c1 nmdc:mga08y16_13904_c1_7230_7904 223
136 3300050511 nmdc:mga08y16_229592_c1 nmdc:mga08y16_229592_c1_1164_1838 223
137 3300053083 Ga0495655_0017983 Ga0495655_0017983_167_841 223
138 3300053093 Ga0500651_0444194 Ga0500651_0444194_12_683 223
139 3300003203 JGI25406J46586_10010438 JGI25406J46586_100104382 224
140 3300005437 Ga0070710_10076011 Ga0070710_100760112 224
141 3300005985 Ga0081539_10000419 Ga0081539_1000041962 224
142 3300006038 Ga0075365_10020422 Ga0075365_100204222 224
143 3300006038 Ga0075365_10174550 Ga0075365_101745502 224
144 3300025898 Ga0207692_10040944 Ga0207692_100409442 224
145 3300025928 Ga0207700_10093146 Ga0207700_100931462 224
146 3300046519 Ga0495632_0099647 Ga0495632_0099647_40_717 224
147 3300048912 Ga0496109_0155189 Ga0496109_0155189_392_1078 224
148 3300053088 Ga0500644_0055793 Ga0500644_0055793_514_1200 224
149 iso_pu_bacteria 2811994872 2812324890 224
150 3300003578 Ga0006562J51391_1053814 Ga0006562J51391_10538141 225
151 3300039450 Ga0436363_1690868 Ga0436363_1690868_1161_1853 225
152 3300041404 Ga0439436_0044729 Ga0439436_0044729_240_935 225
153 3300042014 Ga0439457_031215 Ga0439457_031215_267_962 225
154 3300042015 Ga0439462_0030682 Ga0439462_0030682_411_1106 225
155 3300048928 Ga0496125_0005505 Ga0496125_0005505_863_1543 225
156 iso_pu_bacteria 2784746763 2785346144 225
157 iso_pu_bacteria 2863404153 2863407223 225
158 3300005981 Ga0081538_10006917 Ga0081538_100069176 226
159 3300061734 Ga0530510_0464256 Ga0530510_0464256_91_771 226
160 iso_pu_bacteria 2818991463 2819697663 226
161 iso_pu_bacteria 2884693830 2884696139 226
162 iso_pu_bacteria 2884693830 2884699767 226
163 iso_pu_bacteria 2895427314 2895432294 226
164 iso_pu_bacteria 2895442618 2895443031 226
165 iso_pu_bacteria 2895442618 2895449493 226
166 3300049592 Ga0501076_0039001 Ga0501076_0039001_3005_3697 227
167 3300049593 Ga0501077_0070278 Ga0501077_0070278_23_715 227
168 3300006846 Ga0075430_100016988 Ga0075430_1000169884 228
169 3300006880 Ga0075429_100017264 Ga0075429_1000172647 228
170 3300009147 Ga0114129_10054540 Ga0114129_100545407 228
171 3300009174 Ga0105241_10333359 Ga0105241_103333591 228
172 3300049576 Ga0501040_0408091 Ga0501040_0408091_208_903 228
173 3300049584 Ga0501068_0116817 Ga0501068_0116817_121_816 228
174 3300049587 Ga0501071_0095358 Ga0501071_0095358_1310_2005 228
175 3300049588 Ga0501072_0082387 Ga0501072_0082387_834_1529 228
176 3300049589 Ga0501073_0043237 Ga0501073_0043237_925_1620 228
177 3300049591 Ga0501075_0171397 Ga0501075_0171397_803_1498 228
178 3300049592 Ga0501076_0051514 Ga0501076_0051514_422_1117 228
179 3300049593 Ga0501077_0066158 Ga0501077_0066158_925_1620 228
180 3300049741 Ga0501079_0070962 Ga0501079_0070962_146_841 228
181 3300050507 nmdc:mga05p37_19940_c1 nmdc:mga05p37_19940_c1_900_1592 228
182 3300050508 nmdc:mga09592_22750_c1 nmdc:mga09592_22750_c1_498_1190 228
183 3300050510 nmdc:mga06r32_169702_c1 nmdc:mga06r32_169702_c1_326_1018 228
184 3300053140 Ga0500573_0011801 Ga0500573_0011801_2950_3642 228
185 3300061734 Ga0530510_0750033 Ga0530510_0750033_38_733 228
186 iso_pu_bacteria 2884994152 2884995437 228
187 iso_pu_bacteria 2855676851 2855682990 229
188 iso_pu_bacteria 2857288857 2857294874 229
189 iso_pu_bacteria 2858848962 2858855432 229
190 iso_pu_bacteria 2858882152 2858885483 229
191 iso_pu_bacteria 2858888857 2858889621 229
192 iso_pu_bacteria 2858895516 2858902034 229
193 iso_pu_bacteria 2866065130 2866067074 229
194 iso_pu_bacteria 2869048445 2869054847 229
195 iso_pu_bacteria 2869061728 2869064430 229
196 iso_pu_bacteria 2869068681 2869072549 229
197 iso_pu_bacteria 2880489317 2880492728 229
198 iso_pu_bacteria 2880495981 2880499587 229
199 iso_pu_bacteria 2887443736 2887444700 229
200 iso_pu_bacteria 2895660088 2895660540 229
201 iso_pu_bacteria 2929226422 2929228178 229
202 iso_pu_bacteria 8054704163 8054705949 229
203 iso_pu_bacteria 8054727385 8054732228 229
204 3300025901 Ga0207688_10436014 Ga0207688_104360141 230
205 3300046642 Ga0495634_0044764 Ga0495634_0044764_1816_2535 230
206 3300046681 Ga0495647_0049701 Ga0495647_0049701_378_1097 230
207 3300046683 Ga0495658_0138606 Ga0495658_0138606_423_1142 230
208 3300046689 Ga0495613_0019075 Ga0495613_0019075_3457_4176 230
209 3300048903 Ga0496100_0225095 Ga0496100_0225095_473_1195 230
210 3300048907 Ga0496104_0028280 Ga0496104_0028280_825_1547 230
211 3300048915 Ga0496112_0309152 Ga0496112_0309152_256_957 230
212 3300048917 Ga0496114_0044497 Ga0496114_0044497_1296_2018 230
213 iso_pu_bacteria 2939657138 2939660294 230
214 3300044706 Ga0466964_0001911 Ga0466964_0001911_2551_3267 233
215 3300044901 Ga0466960_0323247 Ga0466960_0323247_119_835 233
216 3300045976 Ga0466967_0026290 Ga0466967_0026290_1436_2152 233
217 3300048921 Ga0496118_0037476 Ga0496118_0037476_3021_3764 233
218 3300005354 Ga0070675_100812076 Ga0070675_1008120761 234
219 3300049569 Ga0501032_0262794 Ga0501032_0262794_49_756 234
220 3300049570 Ga0501033_0069282 Ga0501033_0069282_345_1052 234
221 3300049571 Ga0501034_0305824 Ga0501034_0305824_598_1305 234
222 3300049573 Ga0501037_0116488 Ga0501037_0116488_159_866 234
223 3300049580 Ga0501046_0014691 Ga0501046_0014691_2334_3041 234
224 3300049581 Ga0501047_0185869 Ga0501047_0185869_710_1417 234
225 3300049822 Ga0501035_0275891 Ga0501035_0275891_298_1005 234
226 3300049823 Ga0501044_0013773 Ga0501044_0013773_4310_5017 234
227 iso_pu_bacteria 8055172936 8055180620 234
228 iso_pu_bacteria 2808606447 2809226165 235
229 iso_pu_bacteria 2852632344 2852632422 235
230 iso_pu_bacteria 3006486233 3006493283 235
231 3300014325 Ga0163163_10161346 Ga0163163_101613462 236
232 3300014325 Ga0163163_10229304 Ga0163163_102293041 236
233 3300048912 Ga0496109_0049173 Ga0496109_0049173_1410_2147 236
234 3300049570 Ga0501033_0381076 Ga0501033_0381076_127_855 236
235 iso_pu_bacteria 2675903060 2676488570 236
236 3300006847 Ga0075431_100615472 Ga0075431_1006154722 237
237 3300006880 Ga0075429_100244667 Ga0075429_1002446672 237
238 3300009147 Ga0114129_10029527 Ga0114129_100295274 237
239 3300050507 nmdc:mga05p37_41_c1 nmdc:mga05p37_41_c1_103976_104734 237
240 3300050508 nmdc:mga09592_83748_c1 nmdc:mga09592_83748_c1_765_1523 237
241 3300005364 Ga0070673_100779723 Ga0070673_1007797231 238
242 3300025933 Ga0207706_10510293 Ga0207706_105102931 238
243 3300049578 Ga0501042_0207850 Ga0501042_0207850_661_1386 238
244 3300049592 Ga0501076_0424049 Ga0501076_0424049_348_1073 238
245 3300049822 Ga0501035_0509237 Ga0501035_0509237_255_980 238
246 3300061734 Ga0530510_0087242 Ga0530510_0087242_52_777 238
247 3300013250 Ga0171462_1002 Ga0171462_1002391 239
248 3300041413 Ga0439465_0041609 Ga0439465_0041609_377_1099 239
249 3300031824 Ga0307413_10315571 Ga0307413_103155711 240
250 3300032005 Ga0307411_10273937 Ga0307411_102739372 240
251 3300032126 Ga0307415_100011763 Ga0307415_1000117632 240
252 3300005327 Ga0070658_10042631 Ga0070658_100426312 241
253 3300025909 Ga0207705_10045672 Ga0207705_100456722 241
254 3300005330 Ga0070690_100254411 Ga0070690_1002544112 242
255 3300005331 Ga0070670_100514917 Ga0070670_1005149171 242
256 3300005335 Ga0070666_10354102 Ga0070666_103541022 242
257 3300005456 Ga0070678_100071362 Ga0070678_1000713622 242
258 3300005544 Ga0070686_100073087 Ga0070686_1000730872 242
259 3300005615 Ga0070702_100013840 Ga0070702_1000138403 242
260 3300005618 Ga0068864_100331661 Ga0068864_1003316612 242
261 3300005842 Ga0068858_100109863 Ga0068858_1001098632 242
262 3300009098 Ga0105245_10438185 Ga0105245_104381852 242
263 3300009176 Ga0105242_10394374 Ga0105242_103943742 242
264 3300013308 Ga0157375_10357278 Ga0157375_103572782 242
265 3300014325 Ga0163163_10084160 Ga0163163_100841605 242
266 3300025927 Ga0207687_10134654 Ga0207687_101346541 242
267 3300025936 Ga0207670_10561783 Ga0207670_105617831 242
268 3300025942 Ga0207689_10120656 Ga0207689_101206562 242
269 3300025945 Ga0207679_10028365 Ga0207679_100283653 242
270 3300025986 Ga0207658_10278482 Ga0207658_102784822 242
271 3300026023 Ga0207677_10318746 Ga0207677_103187462 242
272 3300026095 Ga0207676_10167498 Ga0207676_101674982 242
273 3300026121 Ga0207683_10119683 Ga0207683_101196832 242
274 3300048911 Ga0496108_0048481 Ga0496108_0048481_1388_2128 242
275 3300048915 Ga0496112_0054911 Ga0496112_0054911_960_1700 242
276 3300050512 nmdc:mga0n895_901942_c1 nmdc:mga0n895_901942_c1_47_790 242
277 3300053080 Ga0500635_0000148 Ga0500635_0000148_22250_22987 243
278 3300053136 Ga0500559_0000121 Ga0500559_0000121_20800_21531 243
279 3300059421 Ga0590071_001445 Ga0590071_001445_712_1455 243
280 3300059424 Ga0590075_006316 Ga0590075_006316_361_1104 243
281 3300048917 Ga0496114_0318314 Ga0496114_0318314_42_782 244
282 3300048918 Ga0496115_0169367 Ga0496115_0169367_277_1017 244
283 3300048929 Ga0496126_0387616 Ga0496126_0387616_307_1047 244
284 3300009101 Ga0105247_10276717 Ga0105247_102767172 245
285 3300009177 Ga0105248_10223589 Ga0105248_102235892 245
286 3300014326 Ga0157380_10792031 Ga0157380_107920311 245
287 3300026035 Ga0207703_10129596 Ga0207703_101295962 245
288 3300031731 Ga0307405_10037643 Ga0307405_100376433 245
289 3300031852 Ga0307410_10124316 Ga0307410_101243162 245
290 3300031901 Ga0307406_10008108 Ga0307406_100081083 245
291 3300031995 Ga0307409_100011549 Ga0307409_1000115494 245
292 3300032002 Ga0307416_100032443 Ga0307416_1000324433 245
293 3300032004 Ga0307414_10362269 Ga0307414_103622692 245
294 3300032126 Ga0307415_100000020 Ga0307415_1000000207 245
295 3300048907 Ga0496104_0011612 Ga0496104_0011612_6852_7619 245
296 3300048911 Ga0496108_0064601 Ga0496108_0064601_241_1008 245
297 3300048914 Ga0496111_0001385 Ga0496111_0001385_12649_13416 245
298 3300048920 Ga0496117_0088153 Ga0496117_0088153_456_1199 245
299 3300025272 Ga0209455_1001253 Ga0209455_10012534 248
300 3300044693 Ga0466961_0022856 Ga0466961_0022856_2048_2800 248
301 3300003752 Ga0055539_1000006 Ga0055539_100000635 249
302 3300003756 Ga0055533_1000002 Ga0055533_1000002119 249
303 3300003759 Ga0055525_1000223 Ga0055525_100022312 249
304 3300003841 Ga0055541_1000630 Ga0055541_10006304 249
305 3300025225 Ga0209566_100032 Ga0209566_100032120 249
306 3300025226 Ga0209674_100001 Ga0209674_1000013445 249
307 3300025230 Ga0209563_100001 Ga0209563_1000013445 249
308 3300025230 Ga0209563_101165 Ga0209563_1011653 249
309 3300025253 Ga0209677_100001 Ga0209677_1000013445 249
310 3300044658 Ga0466972_0026155 Ga0466972_0026155_439_1188 249
311 3300044658 Ga0466972_0086873 Ga0466972_0086873_517_1266 249
312 3300044658 Ga0466972_0129299 Ga0466972_0129299_387_1163 249
313 3300044684 Ga0466966_0116565 Ga0466966_0116565_339_1088 249
314 3300044693 Ga0466961_0067407 Ga0466961_0067407_892_1668 249
315 3300044719 Ga0466971_0042389 Ga0466971_0042389_848_1597 249
316 3300044735 Ga0466968_0023535 Ga0466968_0023535_225_974 249
317 3300044765 Ga0466970_0002854 Ga0466970_0002854_541_1290 249
318 3300044765 Ga0466970_0127066 Ga0466970_0127066_343_1092 249
319 3300044842 Ga0466957_0044336 Ga0466957_0044336_354_1130 249
320 3300045049 Ga0466959_0055856 Ga0466959_0055856_60_809 249
321 3300045836 Ga0466958_0035004 Ga0466958_0035004_2098_2847 249
322 3300049575 Ga0501039_0183242 Ga0501039_0183242_19_810 250
323 3300005535 Ga0070684_100330405 Ga0070684_1003304052 251
324 3300005614 Ga0068856_100679280 Ga0068856_1006792801 251
325 3300009551 Ga0105238_10974351 Ga0105238_109743511 251
326 3300013105 Ga0157369_10039380 Ga0157369_100393806 251
327 3300013307 Ga0157372_10052790 Ga0157372_100527906 251
328 3300013307 Ga0157372_10243033 Ga0157372_102430333 251
329 3300025904 Ga0207647_10102416 Ga0207647_101024161 251
330 3300026078 Ga0207702_10568128 Ga0207702_105681282 251
331 3300048903 Ga0496100_0160437 Ga0496100_0160437_175_984 251
332 3300048903 Ga0496100_0544382 Ga0496100_0544382_93_848 251
333 3300048904 Ga0496101_0020675 Ga0496101_0020675_2531_3340 251
334 3300048904 Ga0496101_0349746 Ga0496101_0349746_216_971 251
335 3300048905 Ga0496102_0055853 Ga0496102_0055853_934_1743 251
336 3300048905 Ga0496102_0136360 Ga0496102_0136360_652_1407 251
337 3300048908 Ga0496105_0012212 Ga0496105_0012212_340_1095 251
338 3300048908 Ga0496105_0138051 Ga0496105_0138051_801_1610 251
339 3300048909 Ga0496106_0219555 Ga0496106_0219555_453_1262 251
340 3300048910 Ga0496107_0041623 Ga0496107_0041623_1651_2460 251
341 3300048912 Ga0496109_0093779 Ga0496109_0093779_1423_2232 251
342 3300048916 Ga0496113_0078282 Ga0496113_0078282_1170_1979 251
343 3300048917 Ga0496114_0054034 Ga0496114_0054034_2120_2929 251
344 3300048922 Ga0496119_0046541 Ga0496119_0046541_1098_1907 251
345 3300048923 Ga0496120_0031610 Ga0496120_0031610_1631_2440 251
346 3300049586 Ga0501070_0000076 Ga0501070_0000076_59159_59914 251
347 3300049822 Ga0501035_0017244 Ga0501035_0017244_4494_5249 251
348 iso_pu_bacteria 2919523602 2919524508 251
349 iso_pu_bacteria 2643221616 2644096542 253
350 iso_pu_bacteria 2884763398 2884766253 254
351 3300002772 JGI25164J39214_1000361 JGI25164J39214_100036112 255
352 3300003214 JGI25165J46597_1000061 JGI25165J46597_1000061181 255
353 3300025231 Ga0207427_100042 Ga0207427_100042176 255
354 3300025261 Ga0209233_1000001 Ga0209233_10000011262 255
355 iso_pu_bacteria 2919055335 2919056867 269
356 iso_pu_bacteria 2928153084 2928154559 269
357 3300002067 JGI24735J21928_10008845 JGI24735J21928_100088452 273
358 3300003578 Ga0006562J51391_1097213 Ga0006562J51391_10972134 273
359 3300003578 Ga0006562J51391_1097214 Ga0006562J51391_10972142 273
360 3300048920 Ga0496117_0172697 Ga0496117_0172697_132_953 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

39

188

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9692 20 237
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9658 19 243
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.961 17 243
7w7b-assembly2.cif.gz_G heme exporter hrtba in complex with protoporphyrin ix containing manganese(iii), high resolution data 0.9562 17 240
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9562 18 236
ID Description Score Start End Superfamily
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9731 16 237 3.40.50.300
af_P9WQK5_1_219_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9711 17 232 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9704 17 242 3.40.50.300
3tujC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9683 20 243 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9651 18 238 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3C1D688-F1-model_v4 ABC transporter 0.9904 18 210 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A842VYH2-F1-model_v4 ATP-binding cassette domain-containing protein 0.9766 18 153 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7Y4YMX3-F1-model_v4 ABC transporter ATP-binding protein 0.976 20 215 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A353M4F4-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD 0.9749 56 215 GO:0005524
GO:0005886
GO:0016887
AF-H8FG51-F1-model_v4 deleted 0.9745 17 220

Feature Viewer

pLDDT pTM Quality
83.34 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map