F421730

General Info

Members Datasets Scaffolds Average Seq Length
359 244 718 240

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8008574985|8008575106
Length 267
Sequence GRTFVLRGRDTGAAPGATITRVTAAEPTILATSGGHRAGTRTRLLFDALVHHAVDLSGVHGRRPRVLYVGTATGDAEHVTARVTEAARVAGYDLTPLQLFPMPNVEDVEGTVLAHDVVWVMGGSVANLLAVWRVHGLDAVMRRAWAAGVVLAGVSAGSICWFEGGATDSFGPGLRPVTDGLGLLPYGNGVHYDSDAGRRPLIHRLVAEGAFRTAHCTDDGVGLVYRGTELVEAVAELPGRGAYVVGRSGTGTVEERIEPRLLPAPRF

Samples

Sample ID Description Type Environment
1 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
44 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
45 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
63 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
66 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
67 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
70 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
71 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
72 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
79 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
80 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
81 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
82 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
83 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
84 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
96 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
97 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
104 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
105 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
137 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
141 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
192 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
193 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
194 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
200 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
201 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
202 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
203 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
204 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
205 2643221647 Streptomyces sp. Root369 Isolate Unclassified
206 2643221679 Angustibacter sp. Root456 Isolate Unclassified
207 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
208 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
209 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
210 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
211 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
212 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
213 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
214 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
215 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
216 2867428634 Streptomyces sp. RP5T Isolate Unclassified
217 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
218 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
219 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
220 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
221 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
222 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
223 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
224 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
225 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
226 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
227 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
228 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
229 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
230 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
231 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
232 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
233 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
234 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
235 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
236 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
237 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
238 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
239 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
240 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
241 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
242 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
243 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
244 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.19
Metatranscriptomes 0.28
Isolates 12.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 8.91
Nodule 0.56
Rhizoplane 4.18
Rhizosphere 76.04
Stem 0
Stem Tuber 0
Unclassified 2.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000271 3300002773 Bacteria 34638
2 rootH1_10043250 3300003316 Bacteria 6144
3 rootL2_10075798 3300003322 Bacteria 2251
4 rootH1_10006596 3300003323 Bacteria 4386
5 Ga0070683_100001417 3300005329 Bacteria 18419
6 Ga0070683_100013413 3300005329 Bacteria 7147
7 Ga0070683_100630875 3300005329 Bacteria 1026
8 Ga0070691_10001416 3300005341 Bacteria 10241
9 Ga0070709_10121866 3300005434 Bacteria 1769
10 Ga0070714_100027816 3300005435 Bacteria 4685
11 Ga0070714_100104784 3300005435 Bacteria 2496
12 Ga0070714_100430265 3300005435 Unclassified 1251
13 Ga0070713_100003395 3300005436 Bacteria 10521
14 Ga0070713_100214549 3300005436 Bacteria 1744
15 Ga0070710_10020144 3300005437 Bacteria 3456
16 Ga0070711_100020981 3300005439 Bacteria 4219
17 Ga0070708_100093747 3300005445 Bacteria 2738
18 Ga0070706_100034244 3300005467 Bacteria 4691
19 Ga0070706_100075440 3300005467 Bacteria 3120
20 Ga0070707_100016758 3300005468 Bacteria 6878
21 Ga0070707_100075147 3300005468 Bacteria 3258
22 Ga0070707_100551622 3300005468 Bacteria 1115
23 Ga0070698_100008024 3300005471 Bacteria 11419
24 Ga0070698_100022484 3300005471 Bacteria 6597
25 Ga0070698_100026653 3300005471 Bacteria 6013
26 Ga0070698_100282425 3300005471 Bacteria 1591
27 Ga0070699_100148613 3300005518 Bacteria 2071
28 Ga0070679_100011657 3300005530 Bacteria 8379
29 Ga0070679_100438085 3300005530 Bacteria 1252
30 Ga0070684_100009011 3300005535 Bacteria 7839
31 Ga0070684_100018687 3300005535 Bacteria 5717
32 Ga0070684_100477039 3300005535 Bacteria 1154
33 Ga0070696_100103028 3300005546 Bacteria 2047
34 Ga0070664_100140394 3300005564 Bacteria 2127
35 Ga0068857_100003600 3300005577 Bacteria 12971
36 Ga0068856_100003421 3300005614 Bacteria 16049
37 Ga0068863_100900082 3300005841 Unclassified 885
38 Ga0068860_100000334 3300005843 Bacteria 63958
39 Ga0081455_10003999 3300005937 Bacteria 16734
40 Ga0075365_10038836 3300006038 Bacteria 3097
41 Ga0075365_10047306 3300006038 Bacteria 2827
42 Ga0075365_10151659 3300006038 Bacteria 1612
43 Ga0075368_10004715 3300006042 Bacteria 4638
44 Ga0075363_100172521 3300006048 Bacteria 1228
45 Ga0075363_100240216 3300006048 Bacteria 1041
46 Ga0075364_10289327 3300006051 Bacteria 1115
47 Ga0075364_10378452 3300006051 Bacteria 965
48 Ga0075432_10024664 3300006058 Bacteria 2062
49 Ga0070712_100008976 3300006175 Bacteria 6300
50 Ga0075370_10350829 3300006353 Bacteria 881
51 Ga0105242_10904747 3300009176 Bacteria 883
52 Ga0105248_10007684 3300009177 Bacteria 11846
53 Ga0105237_10272582 3300009545 Bacteria 1695
54 Ga0105237_10344009 3300009545 Bacteria 1496
55 Ga0105246_10001439 3300011119 Bacteria 14093
56 Ga0105246_10005242 3300011119 Bacteria 7883
57 Ga0157369_10005093 3300013105 Bacteria 15384
58 Ga0157369_10079211 3300013105 Bacteria 3519
59 Ga0157369_10598822 3300013105 Bacteria 1138
60 Ga0157372_10196187 3300013307 Bacteria 2338
61 Ga0163163_10381793 3300014325 Unclassified 1466
62 Ga0157379_10155522 3300014968 Bacteria 2063
63 Ga0206353_10325296 3300020082 Bacteria 1172
64 Ga0213875_10000799 3300021388 Bacteria 23538
65 Ga0213875_10015280 3300021388 Bacteria 3736
66 Ga0209129_1000052 3300025258 Bacteria 265251
67 Ga0209025_1000570 3300025294 Bacteria 67028
68 Ga0209051_1005918 3300025303 Bacteria 7018
69 Ga0209051_1032432 3300025303 Bacteria 1993
70 Ga0207655_1018886 3300025728 Bacteria 3633
71 Ga0207647_10020907 3300025904 Bacteria 4379
72 Ga0207684_10029239 3300025910 Bacteria 4695
73 Ga0207684_10063053 3300025910 Bacteria 3147
74 Ga0207707_10053901 3300025912 Bacteria 3501
75 Ga0207707_10108674 3300025912 Bacteria 2425
76 Ga0207652_10022741 3300025921 Bacteria 5191
77 Ga0207652_10412262 3300025921 Bacteria 1219
78 Ga0207652_10500021 3300025921 Bacteria 1095
79 Ga0207646_10025102 3300025922 Bacteria 5454
80 Ga0207646_10092727 3300025922 Bacteria 2704
81 Ga0207646_10529023 3300025922 Bacteria 1061
82 Ga0207700_10007970 3300025928 Bacteria 6522
83 Ga0207700_10043301 3300025928 Bacteria 3306
84 Ga0207664_10026740 3300025929 Bacteria 4364
85 Ga0207664_10036656 3300025929 Bacteria 3790
86 Ga0207709_10090390 3300025935 Bacteria 1999
87 Ga0207691_10174856 3300025940 Bacteria 1879
88 Ga0207661_10011411 3300025944 Bacteria 6437
89 Ga0207661_10019479 3300025944 Bacteria 5059
90 Ga0207679_10011610 3300025945 Bacteria 5716
91 Ga0207702_10004383 3300026078 Bacteria 12570
92 Ga0207674_10001868 3300026116 Bacteria 26833
93 Ga0207674_10046997 3300026116 Bacteria 4428
94 Ga0268264_10002232 3300028381 Bacteria 17182
95 Ga0307515_10179534 3300028794 Bacteria 2073
96 Ga0268256_1052076 3300030500 Bacteria 857
97 Ga0307512_10021303 3300030522 Bacteria 5848
98 Ga0307513_10017179 3300031456 Bacteria 8683
99 Ga0307513_10155914 3300031456 Bacteria 2183
100 Ga0307508_10006572 3300031616 Bacteria 10920
101 Ga0316576_10148841 3300031727 Bacteria 1764
102 Ga0316578_10018339 3300031728 Bacteria 3833
103 Ga0307409_100010228 3300031995 Bacteria 5817
104 Ga0307507_10003693 3300033179 Bacteria 28918
105 Ga0373954_0415363 3300035118 Bacteria 665
106 Ga0373956_0008077 3300035119 Bacteria 4256
107 Ga0316584_0054636 3300036712 Bacteria 2989
108 Ga0395899_0080295 3300037312 Bacteria 2374
109 Ga0395900_0114543 3300037418 Bacteria 2767
110 Ga0395900_0188000 3300037418 Bacteria 2096
111 Ga0395898_0009697 3300037466 Bacteria 10098
112 Ga0436364_0035390 3300037853 Unclassified 1066
113 Ga0436364_1231306 3300037853 Bacteria 19628
114 Ga0395901_0050140 3300038443 Bacteria 4338
115 Ga0395901_0211858 3300038443 Bacteria 2028
116 Ga0395901_0297843 3300038443 Bacteria 1672
117 Ga0451837_0351649 3300041494 Bacteria 3464
118 Ga0451843_0019628 3300041509 Bacteria 984
119 Ga0439433_0064646 3300041999 Bacteria 876
120 Ga0439448_0002203 3300042005 Bacteria 5266
121 Ga0439457_008248 3300042014 Bacteria 2461
122 Ga0450903_001383 3300042138 Bacteria 4536
123 Ga0450908_023086 3300042184 Bacteria 1089
124 Ga0451577_0265660 3300042876 Unclassified 1554
125 Ga0466965_0170037 3300044683 Bacteria 1146
126 Ga0466961_0366238 3300044693 Unclassified 876
127 Ga0466971_0013128 3300044719 Bacteria 3633
128 Ga0466957_0456802 3300044842 Bacteria 881
129 Ga0466960_0036404 3300044901 Bacteria 2304
130 Ga0466960_0216880 3300044901 Bacteria 1051
131 Ga0495592_0006338 3300046454 Bacteria 8810
132 Ga0495629_0033294 3300046459 Bacteria 3645
133 Ga0495651_0000366 3300046462 Bacteria 34826
134 Ga0495651_0011650 3300046462 Bacteria 6760
135 Ga0495651_0209844 3300046462 Bacteria 1356
136 Ga0495582_0032366 3300046473 Bacteria 2876
137 Ga0495605_0118937 3300046474 Bacteria 1199
138 Ga0495662_0004166 3300046476 Bacteria 7291
139 Ga0495664_0001150 3300046477 Bacteria 13740
140 Ga0495583_0074534 3300046506 Bacteria 1485
141 Ga0495608_0177181 3300046511 Bacteria 1350
142 Ga0495620_0014765 3300046515 Bacteria 3960
143 Ga0495628_0020278 3300046516 Bacteria 5487
144 Ga0495628_0039247 3300046516 Bacteria 3787
145 Ga0495628_0065928 3300046516 Bacteria 2831
146 Ga0495628_0161682 3300046516 Bacteria 1701
147 Ga0495630_0126200 3300046517 Bacteria 1942
148 Ga0495632_0276097 3300046519 Bacteria 749
149 Ga0495643_0016200 3300046522 Bacteria 4383
150 Ga0495648_0038760 3300046524 Bacteria 3042
151 Ga0495666_0125542 3300046526 Bacteria 1200
152 Ga0495652_0030935 3300046529 Bacteria 4691
153 Ga0495652_0045065 3300046529 Bacteria 3795
154 Ga0495652_0187701 3300046529 Bacteria 1580
155 Ga0495652_0702835 3300046529 Bacteria 680
156 Ga0495640_0032722 3300046533 Bacteria 3700
157 Ga0495640_0236679 3300046533 Unclassified 1147
158 Ga0495640_0599289 3300046533 Bacteria 665
159 Ga0495587_0011027 3300046536 Bacteria 5731
160 Ga0495597_0029406 3300046542 Bacteria 2508
161 Ga0495645_0053521 3300046543 Bacteria 2934
162 Ga0495633_0243040 3300046558 Bacteria 822
163 Ga0495667_0499555 3300046559 Bacteria 762
164 Ga0495668_0105354 3300046616 Bacteria 1542
165 Ga0495634_0001449 3300046642 Bacteria 21089
166 Ga0495634_0114954 3300046642 Bacteria 1727
167 Ga0495611_0085678 3300046648 Bacteria 1453
168 Ga0495625_0031110 3300046660 Bacteria 3973
169 Ga0495625_0115048 3300046660 Bacteria 1836
170 Ga0495635_0023506 3300046663 Bacteria 4293
171 Ga0495635_0036255 3300046663 Bacteria 3419
172 Ga0495635_0374074 3300046663 Bacteria 949
173 Ga0495635_0683047 3300046663 Bacteria 666
174 Ga0495588_0104740 3300046674 Bacteria 1488
175 Ga0495657_0009198 3300046675 Bacteria 7499
176 Ga0495657_0019814 3300046675 Bacteria 4849
177 Ga0495623_0315066 3300046679 Bacteria 860
178 Ga0495646_0008001 3300046680 Bacteria 6718
179 Ga0495613_0004846 3300046689 Bacteria 10097
180 Ga0495613_0014371 3300046689 Bacteria 5877
181 Ga0495613_0048426 3300046689 Bacteria 3138
182 Ga0495624_0089485 3300046690 Bacteria 1900
183 Ga0495624_0220884 3300046690 Bacteria 1149
184 Ga0495624_0341110 3300046690 Bacteria 901
185 Ga0495649_0030001 3300046694 Bacteria 3004
186 Ga0495589_0031439 3300046794 Bacteria 2672
187 Ga0495600_0020305 3300046809 Bacteria 4249
188 Ga0495600_0026331 3300046809 Bacteria 3753
189 Ga0495581_0015909 3300047315 Bacteria 4370
190 Ga0495604_0000563 3300047317 Bacteria 32678
191 Ga0495604_0005085 3300047317 Bacteria 10412
192 Ga0495604_0022325 3300047317 Bacteria 5052
193 Ga0495636_0002034 3300047318 Bacteria 7755
194 Ga0495674_0051117 3300047319 Bacteria 3644
195 Ga0495674_0197335 3300047319 Bacteria 1671
196 Ga0495676_0011231 3300047321 Bacteria 8096
197 Ga0495676_0020157 3300047321 Bacteria 5859
198 Ga0495676_0055849 3300047321 Bacteria 3127
199 Ga0495680_0118683 3300047322 Bacteria 1954
200 Ga0495680_0152100 3300047322 Bacteria 1686
201 Ga0495687_015609 3300047443 Bacteria 3854
202 Ga0495675_0087770 3300047444 Bacteria 1954
203 Ga0495677_0030829 3300047445 Bacteria 1952
204 Ga0495685_003974 3300047447 Bacteria 4750
205 Ga0495685_005619 3300047447 Bacteria 4098
206 Ga0495685_016338 3300047447 Bacteria 2535
207 Ga0495685_102077 3300047447 Bacteria 947
208 Ga0495593_0015205 3300047673 Bacteria 4366
209 Ga0495593_0085050 3300047673 Bacteria 1632
210 Ga0495602_0045104 3300048088 Bacteria 3992
211 Ga0495602_0108300 3300048088 Bacteria 2263
212 Ga0495614_0004109 3300048089 Bacteria 6549
213 Ga0495614_0054479 3300048089 Bacteria 1715
214 Ga0495614_0112226 3300048089 Bacteria 1197
215 Ga0495614_0118064 3300048089 Bacteria 1168
216 Ga0495626_0085581 3300048091 Bacteria 1394
217 Ga0496100_0129677 3300048903 Bacteria 1775
218 Ga0496100_0142962 3300048903 Bacteria 1698
219 Ga0496101_0186662 3300048904 Bacteria 1599
220 Ga0496102_0202652 3300048905 Bacteria 1870
221 Ga0496102_0751537 3300048905 Bacteria 898
222 Ga0496103_0058704 3300048906 Bacteria 2390
223 Ga0496107_0044147 3300048910 Bacteria 3204
224 Ga0496109_0265893 3300048912 Bacteria 1616
225 Ga0496111_0461751 3300048914 Bacteria 936
226 Ga0496112_0012213 3300048915 Bacteria 7883
227 Ga0496112_0015697 3300048915 Bacteria 7074
228 Ga0496114_0072719 3300048917 Bacteria 2892
229 Ga0496114_0130958 3300048917 Bacteria 2166
230 Ga0496115_0123331 3300048918 Bacteria 2133
231 Ga0496115_0275420 3300048918 Bacteria 1382
232 Ga0496124_0220200 3300048927 Bacteria 1428
233 Ga0496124_0223520 3300048927 Bacteria 1414
234 Ga0496125_0185416 3300048928 Bacteria 1381
235 Ga0496126_0000022 3300048929 Bacteria 464393
236 Ga0495678_069684 3300049459 Bacteria 1293
237 Ga0501031_0013962 3300049568 Bacteria 5231
238 Ga0501033_0005407 3300049570 Bacteria 10123
239 Ga0501034_0191910 3300049571 Bacteria 2005
240 Ga0501034_0466585 3300049571 Bacteria 1179
241 Ga0501036_0016893 3300049572 Bacteria 6096
242 Ga0501037_0005852 3300049573 Bacteria 8981
243 Ga0501038_0028316 3300049574 Bacteria 4978
244 Ga0501039_0017334 3300049575 Bacteria 5526
245 Ga0501039_0088187 3300049575 Bacteria 2417
246 Ga0501040_0013619 3300049576 Bacteria 5348
247 Ga0501040_0087601 3300049576 Bacteria 2162
248 Ga0501040_0185715 3300049576 Bacteria 1474
249 Ga0501041_0031987 3300049577 Bacteria 3179
250 Ga0501041_0096181 3300049577 Bacteria 1830
251 Ga0501042_0009148 3300049578 Bacteria 6587
252 Ga0501042_0018578 3300049578 Bacteria 4815
253 Ga0501042_0020842 3300049578 Bacteria 4564
254 Ga0501043_0060977 3300049579 Bacteria 2962
255 Ga0501047_0000054 3300049581 Bacteria 149749
256 Ga0501048_0024962 3300049582 Bacteria 4360
257 Ga0501068_0420410 3300049584 Bacteria 863
258 Ga0501069_0135404 3300049585 Bacteria 1412
259 Ga0501069_0212150 3300049585 Bacteria 1124
260 Ga0501070_0379938 3300049586 Bacteria 1144
261 Ga0501071_0040071 3300049587 Bacteria 3352
262 Ga0501072_0003802 3300049588 Bacteria 11396
263 Ga0501072_0032544 3300049588 Bacteria 4084
264 Ga0501072_0174623 3300049588 Bacteria 1714
265 Ga0501074_0080656 3300049590 Bacteria 2334
266 Ga0501074_0101481 3300049590 Bacteria 2059
267 Ga0501075_0003949 3300049591 Bacteria 9991
268 Ga0501075_0071788 3300049591 Bacteria 2616
269 Ga0501075_0211603 3300049591 Bacteria 1479
270 Ga0501076_0000790 3300049592 Bacteria 20454
271 Ga0501076_0083352 3300049592 Bacteria 2567
272 Ga0501076_0238794 3300049592 Bacteria 1486
273 Ga0501077_0019221 3300049593 Bacteria 4320
274 Ga0501077_0094893 3300049593 Bacteria 1891
275 Ga0501079_0179727 3300049741 Bacteria 1651
276 Ga0501079_0256587 3300049741 Bacteria 1366
277 Ga0501079_0259045 3300049741 Bacteria 1359
278 Ga0501081_0019511 3300049743 Bacteria 4514
279 Ga0501081_0070463 3300049743 Bacteria 2436
280 Ga0501081_0159340 3300049743 Bacteria 1626
281 Ga0501035_0025093 3300049822 Bacteria 5465
282 Ga0501035_0028001 3300049822 Bacteria 5148
283 Ga0501035_0247331 3300049822 Bacteria 1515
284 Ga0501044_0099820 3300049823 Bacteria 2921
285 Ga0501045_0050810 3300049824 Bacteria 3025
286 Ga0501045_0069138 3300049824 Bacteria 2595
287 nmdc:mga03n38_102573_c1 3300050490 Bacteria 1381
288 nmdc:mga03n38_228163_c1 3300050490 Bacteria 975
289 nmdc:mga03n38_32971_c1 3300050490 Bacteria 2199
290 nmdc:mga03n38_345756_c1 3300050490 Bacteria 808
291 nmdc:mga00v17_200172_c1 3300050491 Bacteria 1291
292 nmdc:mga0yw44_113301_c1 3300050492 Bacteria 1740
293 nmdc:mga0yw44_225158_c1 3300050492 Bacteria 1244
294 nmdc:mga0yw44_238406_c1 3300050492 Bacteria 1208
295 nmdc:mga0yw44_26757_c1 3300050492 Bacteria 3299
296 nmdc:mga06z11_93075_c1 3300050494 Bacteria 1640
297 nmdc:mga07m45_8616_c1 3300050496 Bacteria 5253
298 nmdc:mga0a205_800100_c1 3300050515 Unclassified 790
299 Ga0495612_0083799 3300053078 Unclassified 1342
300 Ga0495612_0132783 3300053078 Bacteria 1076
301 Ga0495619_0032472 3300053085 Bacteria 3388
302 Ga0495619_0246561 3300053085 Bacteria 1238
303 Ga0500644_0000014 3300053088 Bacteria 109650
304 Ga0500640_006183 3300053095 Bacteria 4547
305 Ga0500573_0030491 3300053140 Bacteria 3111
306 Ga0500600_0112256 3300053149 Bacteria 1419
307 Ga0500600_0161971 3300053149 Bacteria 1099
308 Ga0500616_0001840 3300053153 Bacteria 19217
309 Ga0500624_004949 3300053157 Bacteria 1762
310 Ga0501084_0001257 3300054114 Bacteria 19957
311 Ga0501084_0009918 3300054114 Bacteria 7873
312 Ga0501082_0300628 3300060353 Bacteria 1397
313 Ga0530510_0018922 3300061734 Bacteria 4884
314 Ga0530510_0090291 3300061734 Bacteria 2234
315 8008575106 8008574985 Bacteria 7815457
316 2585307261 2582581313 Bacteria 10042643
317 2616699876 2616644814 Bacteria 11555299
318 2643850511 2643221567 Bacteria 4163945
319 2644134268 2643221624 Bacteria 4384879
320 2644264792 2643221647 Bacteria 10741251
321 2644446252 2643221679 Bacteria 3839507
322 2785344095 2784746763 Bacteria 9783172
323 2786673389 2786546132 Bacteria 10419719
324 2812476828 2811994917 Bacteria 7761064
325 2819747158 2818991472 Bacteria 10089953
326 2844850996 2844849076 Bacteria 4091819
327 2857721756 2857720070 Bacteria 3189373
328 2861526173 2861520306 Bacteria 8348283
329 2862383015 2862382967 Bacteria 10317375
330 2863405365 2863404153 Bacteria 9672205
331 2867434697 2867428634 Bacteria 9590268
332 2877678362 2877676314 Bacteria 9512378
333 2887447691 2887443736 Bacteria 4426037
334 2910812409 2910809715 Bacteria 4982797
335 2912728564 2912723979 Bacteria 8557534
336 2919037035 2919034639 Bacteria 4763403
337 2919449902 2919446982 Bacteria 3994487
338 2919541815 2919538618 Bacteria 4677069
339 2928093555 2928090899 Bacteria 3158267
340 2932429375 2932426870 Bacteria 4547726
341 2954010296 2954002825 Bacteria 9173742
342 2954383288 2954380949 Bacteria 10050426
343 2954684461 2954682443 Bacteria 9862841
344 2954693991 2954691527 Bacteria 10720516
345 2954709096 2954701450 Bacteria 10834262
346 2954713611 2954711539 Bacteria 10867210
347 2954723577 2954721474 Bacteria 10456478
348 2954738256 2954731030 Bacteria 10243860
349 2954742480 2954740390 Bacteria 10229294
350 2954757117 2954749733 Bacteria 10366972
351 2954761448 2954759201 Bacteria 9358192
352 2964327168 2964326757 Bacteria 3290868
353 2984582776 2984580707 Bacteria 3351387
354 2990067201 2990059506 Bacteria 9321252
355 3006494874 3006493962 Bacteria 8825450
356 8008559719 8008558824 Bacteria 10610750
357 8023627757 8023623736 Bacteria 8593882
358 8048413359 8048406513 Bacteria 8936924
359 8054164495 8054160619 Bacteria 7783213
360 JGI25152J39213_1000271
361 rootH1_10043250
362 rootL2_10075798
363 rootH1_10006596
364 Ga0070683_100001417
365 Ga0070683_100013413
366 Ga0070683_100630875
367 Ga0070691_10001416
368 Ga0070709_10121866
369 Ga0070714_100027816
370 Ga0070714_100104784
371 Ga0070714_100430265
372 Ga0070713_100003395
373 Ga0070713_100214549
374 Ga0070710_10020144
375 Ga0070711_100020981
376 Ga0070708_100093747
377 Ga0070706_100034244
378 Ga0070706_100075440
379 Ga0070707_100016758
380 Ga0070707_100075147
381 Ga0070707_100551622
382 Ga0070698_100008024
383 Ga0070698_100022484
384 Ga0070698_100026653
385 Ga0070698_100282425
386 Ga0070699_100148613
387 Ga0070679_100011657
388 Ga0070679_100438085
389 Ga0070684_100009011
390 Ga0070684_100018687
391 Ga0070684_100477039
392 Ga0070696_100103028
393 Ga0070664_100140394
394 Ga0068857_100003600
395 Ga0068856_100003421
396 Ga0068863_100900082
397 Ga0068860_100000334
398 Ga0081455_10003999
399 Ga0075365_10038836
400 Ga0075365_10047306
401 Ga0075365_10151659
402 Ga0075368_10004715
403 Ga0075363_100172521
404 Ga0075363_100240216
405 Ga0075364_10289327
406 Ga0075364_10378452
407 Ga0075432_10024664
408 Ga0070712_100008976
409 Ga0075370_10350829
410 Ga0105242_10904747
411 Ga0105248_10007684
412 Ga0105237_10272582
413 Ga0105237_10344009
414 Ga0105246_10001439
415 Ga0105246_10005242
416 Ga0157369_10005093
417 Ga0157369_10079211
418 Ga0157369_10598822
419 Ga0157372_10196187
420 Ga0163163_10381793
421 Ga0157379_10155522
422 Ga0206353_10325296
423 Ga0213875_10000799
424 Ga0213875_10015280
425 Ga0209129_1000052
426 Ga0209025_1000570
427 Ga0209051_1005918
428 Ga0209051_1032432
429 Ga0207655_1018886
430 Ga0207647_10020907
431 Ga0207684_10029239
432 Ga0207684_10063053
433 Ga0207707_10053901
434 Ga0207707_10108674
435 Ga0207652_10022741
436 Ga0207652_10412262
437 Ga0207652_10500021
438 Ga0207646_10025102
439 Ga0207646_10092727
440 Ga0207646_10529023
441 Ga0207700_10007970
442 Ga0207700_10043301
443 Ga0207664_10026740
444 Ga0207664_10036656
445 Ga0207709_10090390
446 Ga0207691_10174856
447 Ga0207661_10011411
448 Ga0207661_10019479
449 Ga0207679_10011610
450 Ga0207702_10004383
451 Ga0207674_10001868
452 Ga0207674_10046997
453 Ga0268264_10002232
454 Ga0307515_10179534
455 Ga0268256_1052076
456 Ga0307512_10021303
457 Ga0307513_10017179
458 Ga0307513_10155914
459 Ga0307508_10006572
460 Ga0316576_10148841
461 Ga0316578_10018339
462 Ga0307409_100010228
463 Ga0307507_10003693
464 Ga0373954_0415363
465 Ga0373956_0008077
466 Ga0316584_0054636
467 Ga0395899_0080295
468 Ga0395900_0114543
469 Ga0395900_0188000
470 Ga0395898_0009697
471 Ga0436364_0035390
472 Ga0436364_1231306
473 Ga0395901_0050140
474 Ga0395901_0211858
475 Ga0395901_0297843
476 Ga0451837_0351649
477 Ga0451843_0019628
478 Ga0439433_0064646
479 Ga0439448_0002203
480 Ga0439457_008248
481 Ga0450903_001383
482 Ga0450908_023086
483 Ga0451577_0265660
484 Ga0466965_0170037
485 Ga0466961_0366238
486 Ga0466971_0013128
487 Ga0466957_0456802
488 Ga0466960_0036404
489 Ga0466960_0216880
490 Ga0495592_0006338
491 Ga0495629_0033294
492 Ga0495651_0000366
493 Ga0495651_0011650
494 Ga0495651_0209844
495 Ga0495582_0032366
496 Ga0495605_0118937
497 Ga0495662_0004166
498 Ga0495664_0001150
499 Ga0495583_0074534
500 Ga0495608_0177181
501 Ga0495620_0014765
502 Ga0495628_0020278
503 Ga0495628_0039247
504 Ga0495628_0065928
505 Ga0495628_0161682
506 Ga0495630_0126200
507 Ga0495632_0276097
508 Ga0495643_0016200
509 Ga0495648_0038760
510 Ga0495666_0125542
511 Ga0495652_0030935
512 Ga0495652_0045065
513 Ga0495652_0187701
514 Ga0495652_0702835
515 Ga0495640_0032722
516 Ga0495640_0236679
517 Ga0495640_0599289
518 Ga0495587_0011027
519 Ga0495597_0029406
520 Ga0495645_0053521
521 Ga0495633_0243040
522 Ga0495667_0499555
523 Ga0495668_0105354
524 Ga0495634_0001449
525 Ga0495634_0114954
526 Ga0495611_0085678
527 Ga0495625_0031110
528 Ga0495625_0115048
529 Ga0495635_0023506
530 Ga0495635_0036255
531 Ga0495635_0374074
532 Ga0495635_0683047
533 Ga0495588_0104740
534 Ga0495657_0009198
535 Ga0495657_0019814
536 Ga0495623_0315066
537 Ga0495646_0008001
538 Ga0495613_0004846
539 Ga0495613_0014371
540 Ga0495613_0048426
541 Ga0495624_0089485
542 Ga0495624_0220884
543 Ga0495624_0341110
544 Ga0495649_0030001
545 Ga0495589_0031439
546 Ga0495600_0020305
547 Ga0495600_0026331
548 Ga0495581_0015909
549 Ga0495604_0000563
550 Ga0495604_0005085
551 Ga0495604_0022325
552 Ga0495636_0002034
553 Ga0495674_0051117
554 Ga0495674_0197335
555 Ga0495676_0011231
556 Ga0495676_0020157
557 Ga0495676_0055849
558 Ga0495680_0118683
559 Ga0495680_0152100
560 Ga0495687_015609
561 Ga0495675_0087770
562 Ga0495677_0030829
563 Ga0495685_003974
564 Ga0495685_005619
565 Ga0495685_016338
566 Ga0495685_102077
567 Ga0495593_0015205
568 Ga0495593_0085050
569 Ga0495602_0045104
570 Ga0495602_0108300
571 Ga0495614_0004109
572 Ga0495614_0054479
573 Ga0495614_0112226
574 Ga0495614_0118064
575 Ga0495626_0085581
576 Ga0496100_0129677
577 Ga0496100_0142962
578 Ga0496101_0186662
579 Ga0496102_0202652
580 Ga0496102_0751537
581 Ga0496103_0058704
582 Ga0496107_0044147
583 Ga0496109_0265893
584 Ga0496111_0461751
585 Ga0496112_0012213
586 Ga0496112_0015697
587 Ga0496114_0072719
588 Ga0496114_0130958
589 Ga0496115_0123331
590 Ga0496115_0275420
591 Ga0496124_0220200
592 Ga0496124_0223520
593 Ga0496125_0185416
594 Ga0496126_0000022
595 Ga0495678_069684
596 Ga0501031_0013962
597 Ga0501033_0005407
598 Ga0501034_0191910
599 Ga0501034_0466585
600 Ga0501036_0016893
601 Ga0501037_0005852
602 Ga0501038_0028316
603 Ga0501039_0017334
604 Ga0501039_0088187
605 Ga0501040_0013619
606 Ga0501040_0087601
607 Ga0501040_0185715
608 Ga0501041_0031987
609 Ga0501041_0096181
610 Ga0501042_0009148
611 Ga0501042_0018578
612 Ga0501042_0020842
613 Ga0501043_0060977
614 Ga0501047_0000054
615 Ga0501048_0024962
616 Ga0501068_0420410
617 Ga0501069_0135404
618 Ga0501069_0212150
619 Ga0501070_0379938
620 Ga0501071_0040071
621 Ga0501072_0003802
622 Ga0501072_0032544
623 Ga0501072_0174623
624 Ga0501074_0080656
625 Ga0501074_0101481
626 Ga0501075_0003949
627 Ga0501075_0071788
628 Ga0501075_0211603
629 Ga0501076_0000790
630 Ga0501076_0083352
631 Ga0501076_0238794
632 Ga0501077_0019221
633 Ga0501077_0094893
634 Ga0501079_0179727
635 Ga0501079_0256587
636 Ga0501079_0259045
637 Ga0501081_0019511
638 Ga0501081_0070463
639 Ga0501081_0159340
640 Ga0501035_0025093
641 Ga0501035_0028001
642 Ga0501035_0247331
643 Ga0501044_0099820
644 Ga0501045_0050810
645 Ga0501045_0069138
646 nmdc:mga03n38_102573_c1
647 nmdc:mga03n38_228163_c1
648 nmdc:mga03n38_32971_c1
649 nmdc:mga03n38_345756_c1
650 nmdc:mga00v17_200172_c1
651 nmdc:mga0yw44_113301_c1
652 nmdc:mga0yw44_225158_c1
653 nmdc:mga0yw44_238406_c1
654 nmdc:mga0yw44_26757_c1
655 nmdc:mga06z11_93075_c1
656 nmdc:mga07m45_8616_c1
657 nmdc:mga0a205_800100_c1
658 Ga0495612_0083799
659 Ga0495612_0132783
660 Ga0495619_0032472
661 Ga0495619_0246561
662 Ga0500644_0000014
663 Ga0500640_006183
664 Ga0500573_0030491
665 Ga0500600_0112256
666 Ga0500600_0161971
667 Ga0500616_0001840
668 Ga0500624_004949
669 Ga0501084_0001257
670 Ga0501084_0009918
671 Ga0501082_0300628
672 Ga0530510_0018922
673 Ga0530510_0090291
674 8008575106
675 2585307261
676 2616699876
677 2643850511
678 2644134268
679 2644264792
680 2644446252
681 2785344095
682 2786673389
683 2812476828
684 2819747158
685 2844850996
686 2857721756
687 2861526173
688 2862383015
689 2863405365
690 2867434697
691 2877678362
692 2887447691
693 2910812409
694 2912728564
695 2919037035
696 2919449902
697 2919541815
698 2928093555
699 2932429375
700 2954010296
701 2954383288
702 2954684461
703 2954693991
704 2954709096
705 2954713611
706 2954723577
707 2954738256
708 2954742480
709 2954757117
710 2954761448
711 2964327168
712 2984582776
713 2990067201
714 3006494874
715 8008559719
716 8023627757
717 8048413359
718 8054164495

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03575

Peptidase_S51

Peptidase family S51

29

233

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uqv-assembly2.cif.gz_C pseudobacteroides cellulosolvens pseudo-cphb 0.8047 8 236
7uqv-assembly1.cif.gz_A pseudobacteroides cellulosolvens pseudo-cphb 0.7892 7 239
2ywd-assembly1.cif.gz_A crystal structure of glutamine amidotransferase 0.7798 45 165
7uqv-assembly1.cif.gz_B pseudobacteroides cellulosolvens pseudo-cphb 0.7778 7 239
7c9b-assembly1.cif.gz_A-2 crystal structure of dipeptidase-e from xenopus laevis 0.7761 1 236
ID Description Score Start End Superfamily
af_Q4DS63_13_305_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.847 28 234 3.40.50.880
af_Q9VYH3_5_230_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8058 7 238 3.40.50.880
af_Q9VYH3_5_230_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7993 7 238 3.40.50.880
2ywjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.79 45 165 3.40.50.880
2ywdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7798 45 165 3.40.50.880
ID Description Score Start End GO Terms
AF-M3E469-F1-model_v4 Peptidase E 0.9978 1 242 GO:0006508
GO:0008236
AF-A0A6I5DBD2-F1-model_v4 deleted 0.9972 1 242
AF-A0A0M8W6C3-F1-model_v4 Peptidase 0.9969 1 242 GO:0006508
GO:0008236
AF-A0A5N8XXK1-F1-model_v4 Peptidase E 0.9969 1 219 GO:0006508
GO:0008236
AF-A0A0C2AFH1-F1-model_v4 deleted 0.9966 1 242

Map