F421685

General Info

Members Datasets Scaffolds Average Seq Length
359 193 718 145

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0798957|Ga0501045_0798957_180_653
Length 157
Sequence MWKEFRDFIARGNVMDLAVGVIIGAAFGKIVTTLVEGILMPPLGLVLGRVDFASLFFVLDSSQGVPASLADAKARGIPVIAYGQLLNDMVGFLIVALAVFLLVKQVNRIKSAVDRPAPAASPTTKDCPFCASTISIKATRCPQCTSALTGQGEVAIR

Samples

Sample ID Description Type Environment
1 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
125 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
134 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
135 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
136 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
139 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
155 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
156 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
157 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
158 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
164 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
165 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
166 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
167 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
168 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
169 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
170 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
171 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
174 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
175 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
176 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.74
Nodule 0
Rhizoplane 1.39
Rhizosphere 93.31
Stem 0
Stem Tuber 0
Unclassified 1.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501045_0798957 3300049824 Bacteria 695
2 SwRhRL2b_contig_137699 2162886007 Bacteria 1350
3 SwRhRL2b_contig_634079 2162886007 Bacteria 1105
4 JGI25406J46586_10011498 3300003203 Bacteria 3881
5 Ga0065704_10132993 3300005289 Bacteria 1605
6 Ga0065712_10003127 3300005290 Bacteria 4529
7 Ga0065712_10310650 3300005290 Bacteria 844
8 Ga0065712_10426684 3300005290 Unclassified 707
9 Ga0065715_10019935 3300005293 Bacteria 1747
10 Ga0065715_10169138 3300005293 Bacteria 1561
11 Ga0065715_10202856 3300005293 Bacteria 1311
12 Ga0065715_10273690 3300005293 Bacteria 1104
13 Ga0065707_10002589 3300005295 Bacteria 4444
14 Ga0065707_10299888 3300005295 Bacteria 1005
15 Ga0065707_10394385 3300005295 Bacteria 860
16 Ga0070676_10151481 3300005328 Bacteria 1485
17 Ga0070690_100013597 3300005330 Bacteria 4814
18 Ga0070670_100051327 3300005331 Bacteria 3542
19 Ga0070670_101606532 3300005331 Bacteria 598
20 Ga0070680_100176842 3300005336 Bacteria 1797
21 Ga0070682_101394501 3300005337 Bacteria 599
22 Ga0070660_100342131 3300005339 Bacteria 1231
23 Ga0070689_100003341 3300005340 Bacteria 10663
24 Ga0070689_100487173 3300005340 Bacteria 1054
25 Ga0070691_10416441 3300005341 Bacteria 760
26 Ga0070661_100192274 3300005344 Bacteria 1557
27 Ga0070692_10022700 3300005345 Bacteria 3068
28 Ga0070668_100107457 3300005347 Bacteria 2218
29 Ga0070669_100004298 3300005353 Bacteria 10300
30 Ga0070669_100774812 3300005353 Bacteria 814
31 Ga0070675_100003136 3300005354 Bacteria 12501
32 Ga0070675_100037201 3300005354 Bacteria 3963
33 Ga0070675_100421664 3300005354 Bacteria 1193
34 Ga0070675_100445298 3300005354 Bacteria 1161
35 Ga0070675_100451948 3300005354 Bacteria 1152
36 Ga0070671_100022083 3300005355 Bacteria 5199
37 Ga0070674_100231573 3300005356 Bacteria 1442
38 Ga0070674_101811022 3300005356 Bacteria 554
39 Ga0070673_100511631 3300005364 Bacteria 1087
40 Ga0070673_101324799 3300005364 Bacteria 677
41 Ga0070688_100011635 3300005365 Bacteria 4896
42 Ga0070688_100079961 3300005365 Bacteria 2113
43 Ga0070659_100820310 3300005366 Bacteria 810
44 Ga0070667_100266152 3300005367 Bacteria 1536
45 Ga0070701_10015774 3300005438 Bacteria 3498
46 Ga0070701_10142726 3300005438 Bacteria 1371
47 Ga0070701_10697206 3300005438 Bacteria 683
48 Ga0070705_100655015 3300005440 Bacteria 819
49 Ga0070700_100006483 3300005441 Bacteria 6265
50 Ga0070700_100053012 3300005441 Bacteria 2531
51 Ga0070700_100680960 3300005441 Bacteria 815
52 Ga0070694_100006247 3300005444 Bacteria 7231
53 Ga0070694_100574826 3300005444 Bacteria 905
54 Ga0070708_100758077 3300005445 Bacteria 913
55 Ga0070678_101119126 3300005456 Bacteria 728
56 Ga0070662_100246239 3300005457 Bacteria 1435
57 Ga0070681_10004958 3300005458 Bacteria 12802
58 Ga0068867_100009773 3300005459 Bacteria 6760
59 Ga0070706_100205608 3300005467 Bacteria 1839
60 Ga0070707_100064710 3300005468 Bacteria 3511
61 Ga0070707_100153709 3300005468 Bacteria 2241
62 Ga0070699_100005045 3300005518 Bacteria 11620
63 Ga0070699_100005251 3300005518 Bacteria 11375
64 Ga0070699_100298789 3300005518 Bacteria 1444
65 Ga0070699_101552266 3300005518 Bacteria 607
66 Ga0070697_100270820 3300005536 Bacteria 1455
67 Ga0070672_100153206 3300005543 Bacteria 1908
68 Ga0070672_100196530 3300005543 Bacteria 1685
69 Ga0070686_100479238 3300005544 Bacteria 962
70 Ga0070695_100140746 3300005545 Bacteria 1673
71 Ga0070704_100004001 3300005549 Bacteria 8502
72 Ga0070704_101337091 3300005549 Bacteria 656
73 Ga0070664_100178900 3300005564 Bacteria 1884
74 Ga0070664_100196044 3300005564 Bacteria 1800
75 Ga0068857_100036285 3300005577 Bacteria 4369
76 Ga0068857_101195896 3300005577 Bacteria 736
77 Ga0068854_100964560 3300005578 Bacteria 753
78 Ga0068859_100000382 3300005617 Bacteria 44169
79 Ga0068859_100061169 3300005617 Bacteria 3794
80 Ga0068859_100264332 3300005617 Bacteria 1812
81 Ga0068864_100002751 3300005618 Bacteria 14502
82 Ga0068861_100017131 3300005719 Bacteria 5137
83 Ga0068861_100333358 3300005719 Bacteria 1325
84 Ga0068870_10000772 3300005840 Bacteria 12330
85 Ga0068870_10101052 3300005840 Bacteria 1630
86 Ga0068863_100153831 3300005841 Bacteria 2201
87 Ga0068862_100000192 3300005844 Bacteria 67711
88 Ga0068862_100034950 3300005844 Bacteria 4254
89 Ga0068862_100065620 3300005844 Bacteria 3127
90 Ga0068862_101141505 3300005844 Bacteria 776
91 Ga0081539_10000024 3300005985 Bacteria 354702
92 Ga0081539_10002914 3300005985 Bacteria 22601
93 Ga0081539_10016513 3300005985 Bacteria 5261
94 Ga0075368_10001475 3300006042 Bacteria 7534
95 Ga0075363_100450658 3300006048 Bacteria 760
96 Ga0075364_10003705 3300006051 Bacteria 8722
97 Ga0075367_10008117 3300006178 Bacteria 5420
98 Ga0075367_10055291 3300006178 Bacteria 2355
99 Ga0075370_10005513 3300006353 Bacteria 6303
100 Ga0075428_100001800 3300006844 Bacteria 22936
101 Ga0075428_100007870 3300006844 Bacteria 11818
102 Ga0075428_100013614 3300006844 Bacteria 9058
103 Ga0075428_100043291 3300006844 Bacteria 4949
104 Ga0075428_101932308 3300006844 Bacteria 613
105 Ga0075430_100006015 3300006846 Bacteria 10238
106 Ga0075430_100025200 3300006846 Bacteria 5059
107 Ga0075430_100119291 3300006846 Bacteria 2199
108 Ga0075430_100186850 3300006846 Bacteria 1723
109 Ga0075430_100339696 3300006846 Bacteria 1240
110 Ga0075431_100003611 3300006847 Bacteria 14989
111 Ga0075431_100064876 3300006847 Bacteria 3771
112 Ga0075431_100438255 3300006847 Bacteria 1304
113 Ga0075431_101330578 3300006847 Bacteria 679
114 Ga0075433_10019094 3300006852 Bacteria 5703
115 Ga0075433_10032717 3300006852 Bacteria 4456
116 Ga0075433_10125249 3300006852 Bacteria 2282
117 Ga0075433_10419310 3300006852 Bacteria 1180
118 Ga0075433_10609096 3300006852 Bacteria 959
119 Ga0075433_10804321 3300006852 Bacteria 821
120 Ga0075434_100060180 3300006871 Bacteria 3777
121 Ga0075434_100136297 3300006871 Bacteria 2474
122 Ga0075434_101156317 3300006871 Bacteria 786
123 Ga0075429_100007157 3300006880 Bacteria 9682
124 Ga0075429_100039055 3300006880 Bacteria 4132
125 Ga0075429_100049729 3300006880 Bacteria 3646
126 Ga0075429_100240462 3300006880 Bacteria 1586
127 Ga0075429_100381802 3300006880 Bacteria 1234
128 Ga0097620_100000382 3300006931 Bacteria 44169
129 Ga0097620_100061167 3300006931 Bacteria 3794
130 Ga0097620_100264330 3300006931 Bacteria 1812
131 Ga0097620_101772817 3300006931 Bacteria 682
132 Ga0075435_100026448 3300007076 Bacteria 4527
133 Ga0075435_100144006 3300007076 Bacteria 2001
134 Ga0105240_11215380 3300009093 Bacteria 798
135 Ga0111539_10000037 3300009094 Bacteria 143023
136 Ga0111539_10052345 3300009094 Bacteria 4860
137 Ga0111539_10464194 3300009094 Bacteria 1474
138 Ga0105245_11935848 3300009098 Bacteria 643
139 Ga0114129_10000019 3300009147 Bacteria 124932
140 Ga0114129_10006078 3300009147 Bacteria 17112
141 Ga0114129_10034977 3300009147 Bacteria 7097
142 Ga0114129_10765910 3300009147 Bacteria 1234
143 Ga0114129_11024747 3300009147 Bacteria 1038
144 Ga0105243_10067302 3300009148 Bacteria 2883
145 Ga0105248_10222056 3300009177 Bacteria 2127
146 Ga0105249_10001009 3300009553 Bacteria 24911
147 Ga0105249_10050824 3300009553 Bacteria 3779
148 Ga0105249_12590214 3300009553 Unclassified 579
149 Ga0105239_11502649 3300010375 Unclassified 778
150 Ga0157371_10526465 3300013102 Bacteria 875
151 Ga0157378_10015069 3300013297 Bacteria 6765
152 Ga0157378_10282523 3300013297 Bacteria 1600
153 Ga0157378_12024501 3300013297 Bacteria 626
154 Ga0157375_10014872 3300013308 Bacteria 6954
155 Ga0157375_11060936 3300013308 Bacteria 947
156 Ga0163163_10577448 3300014325 Bacteria 1187
157 Ga0163163_11138777 3300014325 Bacteria 843
158 Ga0157380_10421875 3300014326 Bacteria 1273
159 Ga0163161_10240957 3300017792 Bacteria 1406
160 Ga0207697_10047688 3300025315 Bacteria 1766
161 Ga0207688_10140149 3300025901 Bacteria 1423
162 Ga0207688_10219416 3300025901 Bacteria 1145
163 Ga0207645_10064291 3300025907 Bacteria 2344
164 Ga0207645_10533800 3300025907 Bacteria 795
165 Ga0207643_10001042 3300025908 Bacteria 16460
166 Ga0207643_10333810 3300025908 Bacteria 949
167 Ga0207684_10106183 3300025910 Bacteria 2402
168 Ga0207707_10034080 3300025912 Bacteria 4455
169 Ga0207660_10338009 3300025917 Bacteria 1205
170 Ga0207646_10093947 3300025922 Bacteria 2686
171 Ga0207681_10001565 3300025923 Bacteria 14713
172 Ga0207681_10181273 3300025923 Bacteria 1604
173 Ga0207650_10043331 3300025925 Bacteria 3303
174 Ga0207650_11222480 3300025925 Bacteria 640
175 Ga0207650_11650459 3300025925 Bacteria 544
176 Ga0207659_10120056 3300025926 Bacteria 2013
177 Ga0207659_10561410 3300025926 Bacteria 971
178 Ga0207659_11334083 3300025926 Bacteria 616
179 Ga0207644_10026792 3300025931 Bacteria 3977
180 Ga0207706_10497728 3300025933 Bacteria 1052
181 Ga0207709_10039932 3300025935 Bacteria 2806
182 Ga0207691_10005590 3300025940 Bacteria 12148
183 Ga0207691_10019785 3300025940 Bacteria 6367
184 Ga0207679_11617761 3300025945 Bacteria 593
185 Ga0207651_10272354 3300025960 Unclassified 1395
186 Ga0207651_10468061 3300025960 Bacteria 1084
187 Ga0207651_10859945 3300025960 Bacteria 806
188 Ga0207712_10002515 3300025961 Bacteria 11796
189 Ga0207712_10438937 3300025961 Bacteria 1105
190 Ga0207668_10077654 3300025972 Bacteria 2395
191 Ga0207658_10288762 3300025986 Bacteria 1409
192 Ga0207678_10238670 3300026067 Bacteria 1557
193 Ga0207708_10011738 3300026075 Bacteria 6528
194 Ga0207708_10130489 3300026075 Bacteria 1964
195 Ga0207708_10618284 3300026075 Bacteria 919
196 Ga0207708_10999750 3300026075 Bacteria 727
197 Ga0207708_11137707 3300026075 Bacteria 681
198 Ga0207648_10001036 3300026089 Bacteria 31197
199 Ga0207648_10089277 3300026089 Bacteria 2692
200 Ga0207676_10011090 3300026095 Bacteria 6433
201 Ga0207674_10009240 3300026116 Bacteria 11299
202 Ga0207675_100002908 3300026118 Bacteria 16850
203 Ga0207675_100395205 3300026118 Bacteria 1361
204 Ga0207675_101256862 3300026118 Bacteria 761
205 Ga0207683_10045146 3300026121 Bacteria 3853
206 Ga0210002_1083412 3300027617 Bacteria 570
207 Ga0209813_10010779 3300027866 Bacteria 2373
208 Ga0209813_10059223 3300027866 Bacteria 1219
209 Ga0207428_10007145 3300027907 Bacteria 10216
210 Ga0207428_10007276 3300027907 Bacteria 10117
211 Ga0207428_10312713 3300027907 Bacteria 1161
212 Ga0268265_10000185 3300028380 Bacteria 73947
213 Ga0268265_10895001 3300028380 Bacteria 871
214 Ga0307408_100038950 3300031548 Bacteria 3356
215 Ga0307408_101272295 3300031548 Bacteria 688
216 Ga0307405_10126299 3300031731 Bacteria 1759
217 Ga0307405_10405710 3300031731 Bacteria 1068
218 Ga0307405_10579827 3300031731 Bacteria 912
219 Ga0307413_10137392 3300031824 Bacteria 1683
220 Ga0307413_10318469 3300031824 Bacteria 1187
221 Ga0307413_11544215 3300031824 Bacteria 588
222 Ga0307410_10088478 3300031852 Bacteria 2193
223 Ga0307406_10200127 3300031901 Bacteria 1469
224 Ga0307406_10201541 3300031901 Bacteria 1465
225 Ga0307407_10002374 3300031903 Bacteria 7346
226 Ga0307407_11262677 3300031903 Bacteria 579
227 Ga0307407_11655271 3300031903 Bacteria 509
228 Ga0307412_10015312 3300031911 Bacteria 4543
229 Ga0307412_10094758 3300031911 Bacteria 2097
230 Ga0307412_10228609 3300031911 Bacteria 1431
231 Ga0307412_11070010 3300031911 Bacteria 716
232 Ga0307409_100004253 3300031995 Bacteria 7996
233 Ga0307409_100813106 3300031995 Bacteria 943
234 Ga0307409_100990250 3300031995 Bacteria 858
235 Ga0307409_102415570 3300031995 Bacteria 555
236 Ga0307416_100092162 3300032002 Bacteria 2605
237 Ga0307416_100652588 3300032002 Bacteria 1137
238 Ga0307416_101464882 3300032002 Bacteria 788
239 Ga0307416_103605801 3300032002 Bacteria 518
240 Ga0307414_10891251 3300032004 Bacteria 815
241 Ga0307411_10014409 3300032005 Bacteria 4397
242 Ga0307411_10045475 3300032005 Bacteria 2824
243 Ga0307411_10421250 3300032005 Bacteria 1109
244 Ga0307415_100126247 3300032126 Bacteria 1929
245 Ga0307415_100627009 3300032126 Bacteria 961
246 Ga0373948_0014499 3300034817 Bacteria 1437
247 Ga0373941_0440103 3300035115 Bacteria 545
248 Ga0373943_0051959 3300035170 Bacteria 2020
249 Ga0373946_0099071 3300035171 Bacteria 1304
250 Ga0373962_0013440 3300035242 Bacteria 2074
251 Ga0373947_0153966 3300035725 Bacteria 1482
252 Ga0436365_0185432 3300039437 Bacteria 574
253 Ga0451802_2024860 3300041460 Bacteria 1053
254 Ga0451853_3540108 3300041512 Bacteria 892
255 Ga0439433_0025680 3300041999 Bacteria 1331
256 Ga0439449_0078132 3300042007 Bacteria 1220
257 Ga0439462_0197591 3300042015 Bacteria 572
258 Ga0439446_0005298 3300042156 Bacteria 3313
259 Ga0439434_0040604 3300042435 Bacteria 1429
260 Ga0439435_0094904 3300042436 Bacteria 910
261 Ga0439435_0118349 3300042436 Bacteria 828
262 Ga0439464_0212664 3300042439 Bacteria 619
263 Ga0451577_0591205 3300042876 Bacteria 1007
264 Ga0451577_0752281 3300042876 Bacteria 881
265 Ga0451576_0024323 3300045051 Bacteria 6542
266 Ga0451576_0043559 3300045051 Bacteria 4735
267 Ga0451576_0102750 3300045051 Bacteria 2973
268 Ga0451576_0177636 3300045051 Bacteria 2223
269 Ga0495584_0146693 3300046491 Bacteria 1199
270 Ga0495621_0000885 3300046539 Bacteria 7644
271 Ga0495633_0282815 3300046558 Bacteria 754
272 Ga0495667_0304891 3300046559 Bacteria 1009
273 Ga0495659_0002310 3300046664 Bacteria 6171
274 Ga0495659_0003088 3300046664 Bacteria 5349
275 Ga0495659_0100581 3300046664 Bacteria 1119
276 Ga0495659_0223007 3300046664 Bacteria 779
277 Ga0495659_0282599 3300046664 Unclassified 698
278 Ga0495669_0018107 3300046684 Bacteria 3026
279 Ga0495670_0042920 3300046691 Bacteria 2257
280 Ga0495677_0167464 3300047445 Bacteria 849
281 Ga0496100_1267700 3300048903 Bacteria 582
282 Ga0496106_0567569 3300048909 Bacteria 910
283 Ga0496112_0426869 3300048915 Bacteria 1264
284 Ga0496114_1476289 3300048917 Bacteria 568
285 Ga0501291_090169 3300049514 Bacteria 624
286 Ga0501292_010169 3300049515 Bacteria 1405
287 Ga0501295_089732 3300049518 Bacteria 709
288 Ga0501298_009828 3300049521 Bacteria 1634
289 Ga0501299_006110 3300049522 Bacteria 1878
290 Ga0501299_045449 3300049522 Bacteria 893
291 Ga0501031_0773266 3300049568 Bacteria 616
292 Ga0501037_0266339 3300049573 Bacteria 1197
293 Ga0501039_0362867 3300049575 Bacteria 1138
294 Ga0501041_0359211 3300049577 Bacteria 921
295 Ga0501202_117343 3300049652 Bacteria 665
296 Ga0501217_177100 3300049661 Bacteria 652
297 Ga0501233_122035 3300049668 Bacteria 705
298 Ga0501235_074828 3300049669 Unclassified 805
299 Ga0501247_009567 3300049677 Bacteria 1145
300 Ga0501249_133114 3300049679 Bacteria 615
301 Ga0501261_067744 3300049690 Bacteria 620
302 Ga0501221_054183 3300049704 Bacteria 911
303 Ga0501221_129559 3300049704 Bacteria 651
304 Ga0501221_154672 3300049704 Bacteria 610
305 Ga0501245_044438 3300049708 Bacteria 772
306 Ga0501081_0721024 3300049743 Bacteria 749
307 Ga0501263_042927 3300049760 Bacteria 669
308 Ga0501268_031569 3300049765 Bacteria 961
309 nmdc:mga03683_31958_c1 3300050489 Bacteria 2115
310 nmdc:mga03n38_377271_c1 3300050490 Bacteria 776
311 nmdc:mga00v17_155043_c1 3300050491 Bacteria 1473
312 nmdc:mga0yw44_106015_c1 3300050492 Bacteria 1796
313 nmdc:mga0yw44_884391_c1 3300050492 Bacteria 606
314 nmdc:mga06z11_16263_c1 3300050494 Bacteria 3346
315 nmdc:mga06z11_699632_c1 3300050494 Bacteria 617
316 nmdc:mga04h51_15293_c1 3300050495 Bacteria 2208
317 nmdc:mga07m45_128693_c1 3300050496 Bacteria 1465
318 nmdc:mga05p37_1426629_c1 3300050507 Bacteria 695
319 nmdc:mga05p37_1814039_c1 3300050507 Bacteria 588
320 nmdc:mga05p37_25561_c2 3300050507 Bacteria 6115
321 nmdc:mga05p37_402_c1 3300050507 Bacteria 46999
322 nmdc:mga05p37_61083_c1 3300050507 Bacteria 4640
323 nmdc:mga05p37_9025_c1 3300050507 Bacteria 11792
324 nmdc:mga09592_11160_c1 3300050508 Bacteria 7311
325 nmdc:mga09592_213229_c1 3300050508 Bacteria 1673
326 nmdc:mga09592_359068_c1 3300050508 Bacteria 1261
327 nmdc:mga09592_48424_c1 3300050508 Bacteria 3583
328 nmdc:mga09592_538_c1 3300050508 Bacteria 28675
329 nmdc:mga0qj67_18140_c1 3300050509 Bacteria 5362
330 nmdc:mga0qj67_223426_c1 3300050509 Bacteria 1529
331 nmdc:mga0qj67_2545_c1 3300050509 Bacteria 13032
332 nmdc:mga0qj67_58570_c1 3300050509 Bacteria 3054
333 nmdc:mga0qj67_62946_c1 3300050509 Bacteria 2949
334 nmdc:mga06r32_1113236_c1 3300050510 Bacteria 738
335 nmdc:mga06r32_1477467_c1 3300050510 Bacteria 620
336 nmdc:mga06r32_21934_c1 3300050510 Bacteria 5897
337 nmdc:mga06r32_331902_c1 3300050510 Bacteria 1506
338 nmdc:mga06r32_3597_c1 3300050510 Bacteria 13833
339 nmdc:mga06r32_538527_c1 3300050510 Bacteria 1142
340 nmdc:mga08y16_161_c1 3300050511 Bacteria 58034
341 nmdc:mga08y16_2511_c1 3300050511 Bacteria 18864
342 nmdc:mga08y16_495496_c1 3300050511 Bacteria 1242
343 nmdc:mga08y16_79476_c1 3300050511 Bacteria 3418
344 nmdc:mga08y16_817660_c1 3300050511 Bacteria 923
345 nmdc:mga0n895_45187_c1 3300050512 Bacteria 4297
346 nmdc:mga0n895_457358_c1 3300050512 Bacteria 1288
347 nmdc:mga0n895_4916_c1 3300050512 Bacteria 11080
348 nmdc:mga0n895_617155_c1 3300050512 Bacteria 1086
349 nmdc:mga0rr50_120585_c1 3300050513 Bacteria 2087
350 nmdc:mga0rr50_136929_c1 3300050513 Bacteria 1966
351 nmdc:mga0rr50_70430_c1 3300050513 Bacteria 2665
352 nmdc:mga0rr50_74158_c1 3300050513 Bacteria 2604
353 nmdc:mga0a205_140227_c1 3300050515 Bacteria 2318
354 nmdc:mga0a205_203743_c1 3300050515 Bacteria 1868
355 nmdc:mga0a205_337681_c1 3300050515 Bacteria 1375
356 Ga0495655_0080898 3300053083 Bacteria 928
357 Ga0501084_0240024 3300054114 Bacteria 1530
358 Ga0590071_005924 3300059421 Bacteria 2931
359 Ga0590077_011581 3300059426 Bacteria 1822
360 Ga0501045_0798957
361 SwRhRL2b_contig_137699
362 SwRhRL2b_contig_634079
363 JGI25406J46586_10011498
364 Ga0065704_10132993
365 Ga0065712_10003127
366 Ga0065712_10310650
367 Ga0065712_10426684
368 Ga0065715_10019935
369 Ga0065715_10169138
370 Ga0065715_10202856
371 Ga0065715_10273690
372 Ga0065707_10002589
373 Ga0065707_10299888
374 Ga0065707_10394385
375 Ga0070676_10151481
376 Ga0070690_100013597
377 Ga0070670_100051327
378 Ga0070670_101606532
379 Ga0070680_100176842
380 Ga0070682_101394501
381 Ga0070660_100342131
382 Ga0070689_100003341
383 Ga0070689_100487173
384 Ga0070691_10416441
385 Ga0070661_100192274
386 Ga0070692_10022700
387 Ga0070668_100107457
388 Ga0070669_100004298
389 Ga0070669_100774812
390 Ga0070675_100003136
391 Ga0070675_100037201
392 Ga0070675_100421664
393 Ga0070675_100445298
394 Ga0070675_100451948
395 Ga0070671_100022083
396 Ga0070674_100231573
397 Ga0070674_101811022
398 Ga0070673_100511631
399 Ga0070673_101324799
400 Ga0070688_100011635
401 Ga0070688_100079961
402 Ga0070659_100820310
403 Ga0070667_100266152
404 Ga0070701_10015774
405 Ga0070701_10142726
406 Ga0070701_10697206
407 Ga0070705_100655015
408 Ga0070700_100006483
409 Ga0070700_100053012
410 Ga0070700_100680960
411 Ga0070694_100006247
412 Ga0070694_100574826
413 Ga0070708_100758077
414 Ga0070678_101119126
415 Ga0070662_100246239
416 Ga0070681_10004958
417 Ga0068867_100009773
418 Ga0070706_100205608
419 Ga0070707_100064710
420 Ga0070707_100153709
421 Ga0070699_100005045
422 Ga0070699_100005251
423 Ga0070699_100298789
424 Ga0070699_101552266
425 Ga0070697_100270820
426 Ga0070672_100153206
427 Ga0070672_100196530
428 Ga0070686_100479238
429 Ga0070695_100140746
430 Ga0070704_100004001
431 Ga0070704_101337091
432 Ga0070664_100178900
433 Ga0070664_100196044
434 Ga0068857_100036285
435 Ga0068857_101195896
436 Ga0068854_100964560
437 Ga0068859_100000382
438 Ga0068859_100061169
439 Ga0068859_100264332
440 Ga0068864_100002751
441 Ga0068861_100017131
442 Ga0068861_100333358
443 Ga0068870_10000772
444 Ga0068870_10101052
445 Ga0068863_100153831
446 Ga0068862_100000192
447 Ga0068862_100034950
448 Ga0068862_100065620
449 Ga0068862_101141505
450 Ga0081539_10000024
451 Ga0081539_10002914
452 Ga0081539_10016513
453 Ga0075368_10001475
454 Ga0075363_100450658
455 Ga0075364_10003705
456 Ga0075367_10008117
457 Ga0075367_10055291
458 Ga0075370_10005513
459 Ga0075428_100001800
460 Ga0075428_100007870
461 Ga0075428_100013614
462 Ga0075428_100043291
463 Ga0075428_101932308
464 Ga0075430_100006015
465 Ga0075430_100025200
466 Ga0075430_100119291
467 Ga0075430_100186850
468 Ga0075430_100339696
469 Ga0075431_100003611
470 Ga0075431_100064876
471 Ga0075431_100438255
472 Ga0075431_101330578
473 Ga0075433_10019094
474 Ga0075433_10032717
475 Ga0075433_10125249
476 Ga0075433_10419310
477 Ga0075433_10609096
478 Ga0075433_10804321
479 Ga0075434_100060180
480 Ga0075434_100136297
481 Ga0075434_101156317
482 Ga0075429_100007157
483 Ga0075429_100039055
484 Ga0075429_100049729
485 Ga0075429_100240462
486 Ga0075429_100381802
487 Ga0097620_100000382
488 Ga0097620_100061167
489 Ga0097620_100264330
490 Ga0097620_101772817
491 Ga0075435_100026448
492 Ga0075435_100144006
493 Ga0105240_11215380
494 Ga0111539_10000037
495 Ga0111539_10052345
496 Ga0111539_10464194
497 Ga0105245_11935848
498 Ga0114129_10000019
499 Ga0114129_10006078
500 Ga0114129_10034977
501 Ga0114129_10765910
502 Ga0114129_11024747
503 Ga0105243_10067302
504 Ga0105248_10222056
505 Ga0105249_10001009
506 Ga0105249_10050824
507 Ga0105249_12590214
508 Ga0105239_11502649
509 Ga0157371_10526465
510 Ga0157378_10015069
511 Ga0157378_10282523
512 Ga0157378_12024501
513 Ga0157375_10014872
514 Ga0157375_11060936
515 Ga0163163_10577448
516 Ga0163163_11138777
517 Ga0157380_10421875
518 Ga0163161_10240957
519 Ga0207697_10047688
520 Ga0207688_10140149
521 Ga0207688_10219416
522 Ga0207645_10064291
523 Ga0207645_10533800
524 Ga0207643_10001042
525 Ga0207643_10333810
526 Ga0207684_10106183
527 Ga0207707_10034080
528 Ga0207660_10338009
529 Ga0207646_10093947
530 Ga0207681_10001565
531 Ga0207681_10181273
532 Ga0207650_10043331
533 Ga0207650_11222480
534 Ga0207650_11650459
535 Ga0207659_10120056
536 Ga0207659_10561410
537 Ga0207659_11334083
538 Ga0207644_10026792
539 Ga0207706_10497728
540 Ga0207709_10039932
541 Ga0207691_10005590
542 Ga0207691_10019785
543 Ga0207679_11617761
544 Ga0207651_10272354
545 Ga0207651_10468061
546 Ga0207651_10859945
547 Ga0207712_10002515
548 Ga0207712_10438937
549 Ga0207668_10077654
550 Ga0207658_10288762
551 Ga0207678_10238670
552 Ga0207708_10011738
553 Ga0207708_10130489
554 Ga0207708_10618284
555 Ga0207708_10999750
556 Ga0207708_11137707
557 Ga0207648_10001036
558 Ga0207648_10089277
559 Ga0207676_10011090
560 Ga0207674_10009240
561 Ga0207675_100002908
562 Ga0207675_100395205
563 Ga0207675_101256862
564 Ga0207683_10045146
565 Ga0210002_1083412
566 Ga0209813_10010779
567 Ga0209813_10059223
568 Ga0207428_10007145
569 Ga0207428_10007276
570 Ga0207428_10312713
571 Ga0268265_10000185
572 Ga0268265_10895001
573 Ga0307408_100038950
574 Ga0307408_101272295
575 Ga0307405_10126299
576 Ga0307405_10405710
577 Ga0307405_10579827
578 Ga0307413_10137392
579 Ga0307413_10318469
580 Ga0307413_11544215
581 Ga0307410_10088478
582 Ga0307406_10200127
583 Ga0307406_10201541
584 Ga0307407_10002374
585 Ga0307407_11262677
586 Ga0307407_11655271
587 Ga0307412_10015312
588 Ga0307412_10094758
589 Ga0307412_10228609
590 Ga0307412_11070010
591 Ga0307409_100004253
592 Ga0307409_100813106
593 Ga0307409_100990250
594 Ga0307409_102415570
595 Ga0307416_100092162
596 Ga0307416_100652588
597 Ga0307416_101464882
598 Ga0307416_103605801
599 Ga0307414_10891251
600 Ga0307411_10014409
601 Ga0307411_10045475
602 Ga0307411_10421250
603 Ga0307415_100126247
604 Ga0307415_100627009
605 Ga0373948_0014499
606 Ga0373941_0440103
607 Ga0373943_0051959
608 Ga0373946_0099071
609 Ga0373962_0013440
610 Ga0373947_0153966
611 Ga0436365_0185432
612 Ga0451802_2024860
613 Ga0451853_3540108
614 Ga0439433_0025680
615 Ga0439449_0078132
616 Ga0439462_0197591
617 Ga0439446_0005298
618 Ga0439434_0040604
619 Ga0439435_0094904
620 Ga0439435_0118349
621 Ga0439464_0212664
622 Ga0451577_0591205
623 Ga0451577_0752281
624 Ga0451576_0024323
625 Ga0451576_0043559
626 Ga0451576_0102750
627 Ga0451576_0177636
628 Ga0495584_0146693
629 Ga0495621_0000885
630 Ga0495633_0282815
631 Ga0495667_0304891
632 Ga0495659_0002310
633 Ga0495659_0003088
634 Ga0495659_0100581
635 Ga0495659_0223007
636 Ga0495659_0282599
637 Ga0495669_0018107
638 Ga0495670_0042920
639 Ga0495677_0167464
640 Ga0496100_1267700
641 Ga0496106_0567569
642 Ga0496112_0426869
643 Ga0496114_1476289
644 Ga0501291_090169
645 Ga0501292_010169
646 Ga0501295_089732
647 Ga0501298_009828
648 Ga0501299_006110
649 Ga0501299_045449
650 Ga0501031_0773266
651 Ga0501037_0266339
652 Ga0501039_0362867
653 Ga0501041_0359211
654 Ga0501202_117343
655 Ga0501217_177100
656 Ga0501233_122035
657 Ga0501235_074828
658 Ga0501247_009567
659 Ga0501249_133114
660 Ga0501261_067744
661 Ga0501221_054183
662 Ga0501221_129559
663 Ga0501221_154672
664 Ga0501245_044438
665 Ga0501081_0721024
666 Ga0501263_042927
667 Ga0501268_031569
668 nmdc:mga03683_31958_c1
669 nmdc:mga03n38_377271_c1
670 nmdc:mga00v17_155043_c1
671 nmdc:mga0yw44_106015_c1
672 nmdc:mga0yw44_884391_c1
673 nmdc:mga06z11_16263_c1
674 nmdc:mga06z11_699632_c1
675 nmdc:mga04h51_15293_c1
676 nmdc:mga07m45_128693_c1
677 nmdc:mga05p37_1426629_c1
678 nmdc:mga05p37_1814039_c1
679 nmdc:mga05p37_25561_c2
680 nmdc:mga05p37_402_c1
681 nmdc:mga05p37_61083_c1
682 nmdc:mga05p37_9025_c1
683 nmdc:mga09592_11160_c1
684 nmdc:mga09592_213229_c1
685 nmdc:mga09592_359068_c1
686 nmdc:mga09592_48424_c1
687 nmdc:mga09592_538_c1
688 nmdc:mga0qj67_18140_c1
689 nmdc:mga0qj67_223426_c1
690 nmdc:mga0qj67_2545_c1
691 nmdc:mga0qj67_58570_c1
692 nmdc:mga0qj67_62946_c1
693 nmdc:mga06r32_1113236_c1
694 nmdc:mga06r32_1477467_c1
695 nmdc:mga06r32_21934_c1
696 nmdc:mga06r32_331902_c1
697 nmdc:mga06r32_3597_c1
698 nmdc:mga06r32_538527_c1
699 nmdc:mga08y16_161_c1
700 nmdc:mga08y16_2511_c1
701 nmdc:mga08y16_495496_c1
702 nmdc:mga08y16_79476_c1
703 nmdc:mga08y16_817660_c1
704 nmdc:mga0n895_45187_c1
705 nmdc:mga0n895_457358_c1
706 nmdc:mga0n895_4916_c1
707 nmdc:mga0n895_617155_c1
708 nmdc:mga0rr50_120585_c1
709 nmdc:mga0rr50_136929_c1
710 nmdc:mga0rr50_70430_c1
711 nmdc:mga0rr50_74158_c1
712 nmdc:mga0a205_140227_c1
713 nmdc:mga0a205_203743_c1
714 nmdc:mga0a205_337681_c1
715 Ga0495655_0080898
716 Ga0501084_0240024
717 Ga0590071_005924
718 Ga0590077_011581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01741

MscL

Large-conductance mechanosensitive channel, MscL

1

136

0.87

Map