F421631

General Info

Members Datasets Scaffolds Average Seq Length
359 221 719 292

Family's Representative Sequence

Representative Sequence 3300046473|Ga0495582_0031486|Ga0495582_0031486_1217_2260
Length 335
Sequence MRVPRVLFSPHRQAARLASAWRTQARFALIRRLHTPLQHVDRTSIRMSLHENHATLASAQPTWRARLELGFVKQDARTTLVHRLHDGPLRVQRTLHPEGQAICHAVIVHPPGGIAGGDQLDIDVALGAGSHAVITTPGATKWYKSNGRAARQQIAVRVGEQAKLDWLPQNNIVFDHANAHLDFSLTLADGATALGWDATQLGRQAAGERWSDGRLRAVSRIVGPQGELLWLERAALDAADPLRNGPQGLAGFPAYGTLWAVGAACDDALAESLTAQLPFDDSLRAAASCVTNGVLLVRAVSRSMETLQHALTRCWLQLRPVVHGVAAKPLRIWST

Samples

Sample ID Description Type Environment
1 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
53 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
74 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
94 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
105 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
111 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
117 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
137 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
147 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
150 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
176 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
183 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
184 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
185 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
186 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
187 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
188 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
189 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
190 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
191 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
192 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
193 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
194 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
195 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
196 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
197 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
198 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
199 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
200 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
201 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
202 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
203 2818991450 Burkholderia sp. 604 Isolate Unclassified
204 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
205 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
206 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
207 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
208 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
209 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
210 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
211 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
212 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
213 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
214 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
215 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
216 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
217 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
218 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
219 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
220 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
221 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.02
Metatranscriptomes 0.84
Isolates 11.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.62
Nodule 4.74
Rhizoplane 5.85
Rhizosphere 70.47
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495582_0031486 3300046473 Bacteria 2915
2 JGI24740J21852_10016952 3300001979 Bacteria 2617
3 JGI24737J22298_10016616 3300001990 Bacteria 2375
4 JGI24738J21930_10000620 3300002075 Bacteria 10208
5 JGI25156J39149_1000568 3300002705 Bacteria 21085
6 JGI25156J39149_1000759 3300002705 Bacteria 16796
7 JGI25156J39149_1004250 3300002705 Bacteria 4413
8 JGI25156J39149_1005064 3300002705 Bacteria 3885
9 JGI25165J46597_1001969 3300003214 Bacteria 7996
10 rootH1_10160416 3300003316 Bacteria 1059
11 rootH1_10160416 3300003323 Bacteria 2562
12 rootH2_10047182 3300003320 Bacteria 2437
13 rootH1_10189435 3300003323 Bacteria 1109
14 rootH1_10207527 3300003323 Bacteria 2660
15 JGI25160J50197_1001200 3300003354 Bacteria 13170
16 Ga0055533_1001245 3300003756 Bacteria 7033
17 Ga0055524_1000008 3300003775 Bacteria 297761
18 Ga0055543_1009371 3300004625 Bacteria 2107
19 Ga0065165_1000791 3300005262 Bacteria 42372
20 Ga0070658_10205000 3300005327 Bacteria 1665
21 Ga0070660_100025714 3300005339 Bacteria 4377
22 Ga0070668_100001419 3300005347 Bacteria 17272
23 Ga0070674_100294861 3300005356 Bacteria 1291
24 Ga0070667_100422371 3300005367 Bacteria 1215
25 Ga0070663_100078177 3300005455 Bacteria 2424
26 Ga0068867_100087352 3300005459 Bacteria 2361
27 Ga0068867_100103303 3300005459 Bacteria 2179
28 Ga0070706_100008049 3300005467 Bacteria 9838
29 Ga0070707_100388586 3300005468 Unclassified 1355
30 Ga0068854_100157488 3300005578 Bacteria 1756
31 Ga0068861_100108370 3300005719 Bacteria 2222
32 Ga0070712_100299519 3300006175 Bacteria 1301
33 Ga0075428_100269293 3300006844 Bacteria 1833
34 Ga0075431_100097712 3300006847 Bacteria 3032
35 Ga0075429_100003181 3300006880 Bacteria 13959
36 Ga0099826_10000001 3300006948 Bacteria 1155201
37 Ga0075435_100088467 3300007076 Bacteria 2553
38 Ga0105251_10000405 3300009011 Bacteria 42135
39 Ga0105240_10006412 3300009093 Bacteria 17301
40 Ga0111539_10566184 3300009094 Bacteria 1323
41 Ga0114129_10020951 3300009147 Bacteria 9286
42 Ga0114129_10801117 3300009147 Bacteria 1202
43 Ga0105241_10152679 3300009174 Bacteria 1891
44 Ga0105248_10172932 3300009177 Bacteria 2435
45 Ga0105238_10252565 3300009551 Bacteria 1742
46 Ga0105238_10582317 3300009551 Bacteria 1126
47 Ga0105239_10068622 3300010375 Bacteria 3897
48 Ga0157371_10165835 3300013102 Bacteria 1577
49 Ga0157370_10157285 3300013104 Bacteria 2114
50 Ga0157369_10000138 3300013105 Bacteria 102776
51 Ga0157369_10040231 3300013105 Bacteria 5104
52 Ga0157372_10030848 3300013307 Bacteria 5865
53 Ga0157375_10432259 3300013308 Bacteria 1482
54 Ga0157380_10069382 3300014326 Bacteria 2844
55 Ga0157380_10105616 3300014326 Bacteria 2354
56 Ga0157380_10250812 3300014326 Bacteria 1602
57 Ga0182007_10001361 3300015262 Bacteria 13171
58 Ga0183361_10018 3300016635 Bacteria 133279
59 Ga0163161_10101141 3300017792 Bacteria 2146
60 Ga0206356_11638527 3300020070 Bacteria 3691
61 Ga0206354_10132849 3300020081 Bacteria 2354
62 Ga0206353_10545878 3300020082 Bacteria 3425
63 Ga0213874_10005996 3300021377 Bacteria 2857
64 Ga0209674_100150 3300025226 Bacteria 96511
65 Ga0209672_101588 3300025228 Bacteria 7659
66 Ga0209759_1000033 3300025256 Bacteria 276117
67 Ga0209759_1000879 3300025256 Bacteria 22944
68 Ga0209759_1014729 3300025256 Bacteria 2052
69 Ga0209233_1000016 3300025261 Bacteria 907830
70 Ga0209130_1013585 3300025284 Bacteria 2080
71 Ga0209564_1007494 3300025295 Bacteria 5628
72 Ga0209256_1000005 3300025299 Bacteria 1315082
73 Ga0207426_1000305 3300025302 Bacteria 96172
74 Ga0207713_1001376 3300025735 Bacteria 19744
75 Ga0207647_10000214 3300025904 Bacteria 47271
76 Ga0207647_10013565 3300025904 Bacteria 5642
77 Ga0207647_10030472 3300025904 Bacteria 3478
78 Ga0207684_10004100 3300025910 Bacteria 13870
79 Ga0207657_10004377 3300025919 Bacteria 14948
80 Ga0207657_10445304 3300025919 Bacteria 1016
81 Ga0207694_10145546 3300025924 Bacteria 1907
82 Ga0207691_10114370 3300025940 Bacteria 2398
83 Ga0207711_10058313 3300025941 Bacteria 3322
84 Ga0207668_10010219 3300025972 Bacteria 5666
85 Ga0207640_10345129 3300025981 Bacteria 1194
86 Ga0207648_10254398 3300026089 Bacteria 1566
87 Ga0207675_100078385 3300026118 Bacteria 3095
88 Ga0207675_100615092 3300026118 Bacteria 1090
89 Ga0209371_1003882 3300027312 Bacteria 6890
90 Ga0209282_1000001 3300027666 Bacteria 2450367
91 Ga0268256_1003667 3300030500 Bacteria 6786
92 Ga0307408_100038440 3300031548 Bacteria 3377
93 Ga0307412_10000005 3300031911 Bacteria 526194
94 Ga0395899_0000637 3300037312 Bacteria 36229
95 Ga0395899_0002108 3300037312 Bacteria 16341
96 Ga0395900_0000252 3300037418 Bacteria 83358
97 Ga0395900_0079269 3300037418 Bacteria 3374
98 Ga0395900_0175902 3300037418 Bacteria 2177
99 Ga0395900_0651741 3300037418 Bacteria 989
100 Ga0395898_0004624 3300037466 Bacteria 15023
101 Ga0395898_0046387 3300037466 Bacteria 4268
102 Ga0395905_0000012 3300037471 Bacteria 420861
103 Ga0395905_0094297 3300037471 Bacteria 2808
104 Ga0436364_1491083 3300037853 Bacteria 1408
105 Ga0395901_0000967 3300038443 Bacteria 31229
106 Ga0395901_0003504 3300038443 Bacteria 15808
107 Ga0395901_0112007 3300038443 Bacteria 2866
108 Ga0436360_0533733 3300039438 Bacteria 4938
109 Ga0436363_1260698 3300039450 Bacteria 11308
110 Ga0439448_0017425 3300042005 Bacteria 2193
111 Ga0466969_0022660 3300044656 Bacteria 3241
112 Ga0466969_0029612 3300044656 Bacteria 2795
113 Ga0466969_0040861 3300044656 Bacteria 2322
114 Ga0466966_0100656 3300044684 Bacteria 1787
115 Ga0466966_0218870 3300044684 Bacteria 1150
116 Ga0466970_0064103 3300044765 Bacteria 1970
117 Ga0466970_0173733 3300044765 Bacteria 1194
118 Ga0451576_0074358 3300045051 Bacteria 3536
119 Ga0466958_0003846 3300045836 Bacteria 7850
120 Ga0495592_0069137 3300046454 Bacteria 2575
121 Ga0495603_0011030 3300046455 Bacteria 5478
122 Ga0495603_0012133 3300046455 Bacteria 5218
123 Ga0495603_0042659 3300046455 Bacteria 2711
124 Ga0495590_0002012 3300046457 Bacteria 8549
125 Ga0495590_0020507 3300046457 Bacteria 2348
126 Ga0495591_006997 3300046458 Bacteria 4870
127 Ga0495591_017447 3300046458 Bacteria 2465
128 Ga0495629_0000099 3300046459 Bacteria 75956
129 Ga0495629_0006170 3300046459 Bacteria 8899
130 Ga0495629_0020025 3300046459 Bacteria 4776
131 Ga0495641_0115992 3300046461 Bacteria 1194
132 Ga0495651_0119505 3300046462 Bacteria 1938
133 Ga0495651_0233149 3300046462 Bacteria 1266
134 Ga0495653_0005336 3300046463 Bacteria 10460
135 Ga0495653_0090023 3300046463 Bacteria 2246
136 Ga0495650_0004829 3300046471 Bacteria 9025
137 Ga0495650_0006041 3300046471 Bacteria 7651
138 Ga0495650_0052185 3300046471 Bacteria 1679
139 Ga0495650_0062364 3300046471 Bacteria 1490
140 Ga0495580_0001906 3300046472 Bacteria 18342
141 Ga0495580_0002192 3300046472 Bacteria 17092
142 Ga0495580_0009661 3300046472 Bacteria 7574
143 Ga0495580_0012871 3300046472 Bacteria 6410
144 Ga0495580_0023337 3300046472 Bacteria 4544
145 Ga0495580_0183043 3300046472 Bacteria 1446
146 Ga0495582_0012720 3300046473 Bacteria 4638
147 Ga0495605_0014120 3300046474 Bacteria 4381
148 Ga0495605_0014928 3300046474 Bacteria 4236
149 Ga0495662_0090543 3300046476 Bacteria 1491
150 Ga0495662_0193574 3300046476 Bacteria 1002
151 Ga0495664_0004599 3300046477 Bacteria 7546
152 Ga0495664_0033855 3300046477 Bacteria 3004
153 Ga0495596_0084065 3300046500 Bacteria 1235
154 Ga0495607_0007794 3300046501 Bacteria 7371
155 Ga0495583_0013204 3300046506 Bacteria 4620
156 Ga0495606_0000798 3300046507 Bacteria 48020
157 Ga0495606_0016393 3300046507 Bacteria 5652
158 Ga0495608_0021645 3300046511 Bacteria 4413
159 Ga0495608_0148991 3300046511 Bacteria 1492
160 Ga0495610_0015358 3300046512 Bacteria 4454
161 Ga0495618_0014690 3300046514 Bacteria 4774
162 Ga0495620_0046012 3300046515 Bacteria 1887
163 Ga0495628_0015448 3300046516 Bacteria 6375
164 Ga0495628_0019014 3300046516 Bacteria 5684
165 Ga0495628_0027356 3300046516 Bacteria 4641
166 Ga0495628_0031780 3300046516 Bacteria 4267
167 Ga0495628_0365563 3300046516 Bacteria 1058
168 Ga0495630_0007458 3300046517 Bacteria 7815
169 Ga0495630_0012798 3300046517 Bacteria 6096
170 Ga0495630_0263914 3300046517 Bacteria 1315
171 Ga0495643_0051547 3300046522 Bacteria 2213
172 Ga0495643_0080381 3300046522 Bacteria 1697
173 Ga0495648_0022104 3300046524 Bacteria 4388
174 Ga0495648_0055745 3300046524 Bacteria 2381
175 Ga0495666_0005808 3300046526 Bacteria 6222
176 Ga0495666_0007415 3300046526 Bacteria 5498
177 Ga0495666_0015910 3300046526 Bacteria 3747
178 Ga0495666_0083935 3300046526 Bacteria 1505
179 Ga0495642_0153408 3300046528 Bacteria 997
180 Ga0495652_0052715 3300046529 Bacteria 3468
181 Ga0495652_0052956 3300046529 Bacteria 3460
182 Ga0495652_0097849 3300046529 Bacteria 2386
183 Ga0495665_0007907 3300046531 Bacteria 5763
184 Ga0495665_0029020 3300046531 Bacteria 2964
185 Ga0495665_0041009 3300046531 Bacteria 2464
186 Ga0495640_0022900 3300046533 Bacteria 4562
187 Ga0495640_0106572 3300046533 Bacteria 1835
188 Ga0495586_0047363 3300046535 Bacteria 2320
189 Ga0495587_0013142 3300046536 Bacteria 5205
190 Ga0495597_0015555 3300046542 Bacteria 3601
191 Ga0495645_0015705 3300046543 Bacteria 5388
192 Ga0495645_0022061 3300046543 Bacteria 4605
193 Ga0495622_0000012 3300046557 Bacteria 189011
194 Ga0495622_0000228 3300046557 Bacteria 44226
195 Ga0495622_0048844 3300046557 Bacteria 1965
196 Ga0495634_0027261 3300046642 Bacteria 3975
197 Ga0495634_0174450 3300046642 Bacteria 1350
198 Ga0495635_0025011 3300046663 Bacteria 4160
199 Ga0495635_0033427 3300046663 Bacteria 3567
200 Ga0495661_0028523 3300046665 Bacteria 3572
201 Ga0495661_0101074 3300046665 Bacteria 1622
202 Ga0495588_0009096 3300046674 Bacteria 4579
203 Ga0495599_0004511 3300046678 Bacteria 8256
204 Ga0495599_0127471 3300046678 Bacteria 1581
205 Ga0495599_0147673 3300046678 Bacteria 1457
206 Ga0495623_0011055 3300046679 Bacteria 5838
207 Ga0495623_0021154 3300046679 Bacteria 4203
208 Ga0495646_0026525 3300046680 Bacteria 3638
209 Ga0495646_0034162 3300046680 Bacteria 3159
210 Ga0495646_0144009 3300046680 Bacteria 1330
211 Ga0495669_0020922 3300046684 Bacteria 2835
212 Ga0495669_0043294 3300046684 Bacteria 2004
213 Ga0495613_0069078 3300046689 Bacteria 2576
214 Ga0495613_0097642 3300046689 Bacteria 2123
215 Ga0495624_0005306 3300046690 Bacteria 9311
216 Ga0495624_0010720 3300046690 Bacteria 6314
217 Ga0495624_0131953 3300046690 Bacteria 1531
218 Ga0495671_0121180 3300046692 Bacteria 1276
219 Ga0495649_0000572 3300046694 Bacteria 31046
220 Ga0495649_0008178 3300046694 Bacteria 6307
221 Ga0495649_0017700 3300046694 Bacteria 4019
222 Ga0495649_0039933 3300046694 Bacteria 2572
223 Ga0495649_0074060 3300046694 Bacteria 1824
224 Ga0495589_0083882 3300046794 Bacteria 1549
225 Ga0495589_0090117 3300046794 Bacteria 1489
226 Ga0495600_0012704 3300046809 Bacteria 5272
227 Ga0495581_0001826 3300047315 Bacteria 11921
228 Ga0495581_0015690 3300047315 Bacteria 4397
229 Ga0495581_0029235 3300047315 Bacteria 3194
230 Ga0495604_0013202 3300047317 Bacteria 6578
231 Ga0495604_0055237 3300047317 Bacteria 3061
232 Ga0495604_0105355 3300047317 Bacteria 2064
233 Ga0495674_0032833 3300047319 Bacteria 4705
234 Ga0495674_0044531 3300047319 Bacteria 3945
235 Ga0495674_0061586 3300047319 Bacteria 3269
236 Ga0495674_0160017 3300047319 Bacteria 1884
237 Ga0495672_0055626 3300047320 Bacteria 2308
238 Ga0495676_0062681 3300047321 Bacteria 2901
239 Ga0495676_0110213 3300047321 Bacteria 2021
240 Ga0495676_0145398 3300047321 Bacteria 1694
241 Ga0495676_0220764 3300047321 Bacteria 1306
242 Ga0495680_0080064 3300047322 Bacteria 2469
243 Ga0495680_0109183 3300047322 Bacteria 2052
244 Ga0495680_0149260 3300047322 Bacteria 1705
245 Ga0495683_0001181 3300047323 Bacteria 17821
246 Ga0495683_0002006 3300047323 Bacteria 12651
247 Ga0495683_0005362 3300047323 Bacteria 7119
248 Ga0495683_0024530 3300047323 Bacteria 3094
249 Ga0495683_0051893 3300047323 Bacteria 2048
250 Ga0495687_007780 3300047443 Bacteria 6240
251 Ga0495687_028332 3300047443 Bacteria 2607
252 Ga0495675_0004581 3300047444 Bacteria 8387
253 Ga0495675_0009144 3300047444 Bacteria 6159
254 Ga0495679_005457 3300047446 Bacteria 5634
255 Ga0495679_027340 3300047446 Bacteria 1883
256 Ga0495679_045809 3300047446 Bacteria 1334
257 Ga0495673_0017315 3300047469 Bacteria 3664
258 Ga0495684_0014962 3300047471 Bacteria 5975
259 Ga0495684_0021582 3300047471 Bacteria 4958
260 Ga0495593_0005363 3300047673 Bacteria 7584
261 Ga0495593_0005441 3300047673 Bacteria 7524
262 Ga0495593_0094427 3300047673 Bacteria 1538
263 Ga0495593_0165294 3300047673 Bacteria 1116
264 Ga0495602_0000856 3300048088 Bacteria 29354
265 Ga0495602_0009621 3300048088 Bacteria 10045
266 Ga0495602_0047595 3300048088 Bacteria 3862
267 Ga0495602_0234677 3300048088 Bacteria 1375
268 Ga0495614_0012294 3300048089 Bacteria 3760
269 Ga0495614_0083931 3300048089 Bacteria 1381
270 Ga0496100_0043946 3300048903 Bacteria 2859
271 Ga0496100_0105422 3300048903 Bacteria 1949
272 Ga0496102_0002066 3300048905 Bacteria 17293
273 Ga0496102_0608242 3300048905 Bacteria 1016
274 Ga0496103_0007349 3300048906 Bacteria 6567
275 Ga0496103_0163211 3300048906 Bacteria 1429
276 Ga0496104_0300469 3300048907 Bacteria 1517
277 Ga0496105_0024698 3300048908 Bacteria 4885
278 Ga0496105_0086685 3300048908 Bacteria 2587
279 Ga0496106_0008273 3300048909 Bacteria 7696
280 Ga0496106_0122746 3300048909 Bacteria 2032
281 Ga0496107_0159130 3300048910 Bacteria 1673
282 Ga0496107_0345007 3300048910 Bacteria 1108
283 Ga0496110_0127402 3300048913 Bacteria 2297
284 Ga0496111_0136980 3300048914 Bacteria 1813
285 Ga0496112_0296910 3300048915 Bacteria 1561
286 Ga0496113_0067240 3300048916 Bacteria 2716
287 Ga0496113_0112459 3300048916 Bacteria 2121
288 Ga0496114_0014050 3300048917 Bacteria 6421
289 Ga0496114_0031286 3300048917 Bacteria 4379
290 Ga0496116_0021683 3300048919 Bacteria 4835
291 Ga0496116_0074037 3300048919 Bacteria 2144
292 Ga0496117_0029596 3300048920 Bacteria 4220
293 Ga0496117_0049092 3300048920 Bacteria 3006
294 Ga0496117_0058142 3300048920 Bacteria 2680
295 Ga0496117_0104260 3300048920 Bacteria 1785
296 Ga0496117_0110329 3300048920 Bacteria 1715
297 Ga0496118_0008029 3300048921 Bacteria 11023
298 Ga0496118_0008938 3300048921 Bacteria 10226
299 Ga0496118_0013114 3300048921 Bacteria 7871
300 Ga0496118_0023850 3300048921 Bacteria 5301
301 Ga0496118_0137860 3300048921 Bacteria 1553
302 Ga0496119_0051128 3300048922 Bacteria 2542
303 Ga0496119_0130041 3300048922 Bacteria 1373
304 Ga0496121_0000729 3300048924 Bacteria 60664
305 Ga0496121_0021261 3300048924 Bacteria 6367
306 Ga0496121_0036339 3300048924 Bacteria 4391
307 Ga0496121_0087874 3300048924 Bacteria 2438
308 Ga0496121_0121818 3300048924 Bacteria 1969
309 Ga0496122_0005686 3300048925 Bacteria 14721
310 Ga0496125_0009075 3300048928 Bacteria 10289
311 Ga0496126_0000882 3300048929 Bacteria 52767
312 Ga0496126_0004838 3300048929 Bacteria 15786
313 Ga0495678_000004 3300049459 Bacteria 532920
314 Ga0495678_029417 3300049459 Bacteria 2307
315 Ga0495682_0014655 3300049460 Bacteria 2971
316 Ga0501035_0002263 3300049822 Bacteria 19027
317 Ga0501044_0068537 3300049823 Bacteria 3614
318 nmdc:mga05p37_5467_c1 3300050507 Bacteria 14916
319 nmdc:mga09592_4770_c1 3300050508 Bacteria 10988
320 nmdc:mga0a205_356609_c1 3300050515 Bacteria 1329
321 2509127475 2508501125 Bacteria 7208311
322 2510250183 2510065045 Bacteria 7761063
323 2512347701 2512047030 Bacteria 9031815
324 2513962180 2513237151 Bacteria 6309801
325 2514053839 2513237166 Bacteria 10373764
326 2515679258 2515154122 Bacteria 8609520
327 2515688460 2515154123 Bacteria 6387382
328 2527076840 2526164713 Bacteria 6780608
329 2600812617 2600255067 Bacteria 6795583
330 2644026684 2643221603 Bacteria 6147767
331 2713477873 2711768613 Bacteria 11048459
332 2719639336 2718217991 Bacteria 7829542
333 2723875896 2721755763 Bacteria 4464185
334 2738819909 2738541296 Bacteria 7285013
335 2738832389 2738541298 Bacteria 7286732
336 2738873916 2738541306 Bacteria 7284992
337 2739185546 2738543002 Bacteria 7284546
338 2739220514 2738543008 Bacteria 7282815
339 2746088725 2744054900 Bacteria 8399525
340 2746099969 2744054901 Bacteria 8397047
341 2753566013 2751185846 Bacteria 7242164
342 2819621055 2818991450 Bacteria 6962147
343 2842331186 2842324504 Bacteria 9364110
344 2842355525 2842348783 Bacteria 9002918
345 2842457877 2842454564 Bacteria 8730687
346 2885278419 2885270888 Bacteria 9831543
347 2900635994 2900634093 Bacteria 10263517
348 2902683269 2902682994 Bacteria 8951596
349 2904484162 2904483920 Bacteria 7545285
350 2904624624 2904615490 Bacteria 10047340
351 2921650600 2921643360 Bacteria 11448031
352 2928109859 2928108538 Bacteria 7360024
353 2928136686 2928135762 Bacteria 7259641
354 2928508934 2928503688 Bacteria 7268108
355 2945935727 2945934425 Bacteria 7444609
356 2990710360 2990703756 Bacteria 7715990
357 642422884 641736151 Bacteria 7477263
358 642594047 642555112 Bacteria 8676562
359 642620509 642555113 Bacteria 8214658
360 8055305046 8055301274 Bacteria 8587385
361 Ga0495582_0031486
362 JGI24740J21852_10016952
363 JGI24737J22298_10016616
364 JGI24738J21930_10000620
365 JGI25156J39149_1000568
366 JGI25156J39149_1000759
367 JGI25156J39149_1004250
368 JGI25156J39149_1005064
369 JGI25165J46597_1001969
370 rootH1_10160416
371 rootH2_10047182
372 rootH1_10189435
373 rootH1_10207527
374 JGI25160J50197_1001200
375 Ga0055533_1001245
376 Ga0055524_1000008
377 Ga0055543_1009371
378 Ga0065165_1000791
379 Ga0070658_10205000
380 Ga0070660_100025714
381 Ga0070668_100001419
382 Ga0070674_100294861
383 Ga0070667_100422371
384 Ga0070663_100078177
385 Ga0068867_100087352
386 Ga0068867_100103303
387 Ga0070706_100008049
388 Ga0070707_100388586
389 Ga0068854_100157488
390 Ga0068861_100108370
391 Ga0070712_100299519
392 Ga0075428_100269293
393 Ga0075431_100097712
394 Ga0075429_100003181
395 Ga0099826_10000001
396 Ga0075435_100088467
397 Ga0105251_10000405
398 Ga0105240_10006412
399 Ga0111539_10566184
400 Ga0114129_10020951
401 Ga0114129_10801117
402 Ga0105241_10152679
403 Ga0105248_10172932
404 Ga0105238_10252565
405 Ga0105238_10582317
406 Ga0105239_10068622
407 Ga0157371_10165835
408 Ga0157370_10157285
409 Ga0157369_10000138
410 Ga0157369_10040231
411 Ga0157372_10030848
412 Ga0157375_10432259
413 Ga0157380_10069382
414 Ga0157380_10105616
415 Ga0157380_10250812
416 Ga0182007_10001361
417 Ga0183361_10018
418 Ga0163161_10101141
419 Ga0206356_11638527
420 Ga0206354_10132849
421 Ga0206353_10545878
422 Ga0213874_10005996
423 Ga0209674_100150
424 Ga0209672_101588
425 Ga0209759_1000033
426 Ga0209759_1000879
427 Ga0209759_1014729
428 Ga0209233_1000016
429 Ga0209130_1013585
430 Ga0209564_1007494
431 Ga0209256_1000005
432 Ga0207426_1000305
433 Ga0207713_1001376
434 Ga0207647_10000214
435 Ga0207647_10013565
436 Ga0207647_10030472
437 Ga0207684_10004100
438 Ga0207657_10004377
439 Ga0207657_10445304
440 Ga0207694_10145546
441 Ga0207691_10114370
442 Ga0207711_10058313
443 Ga0207668_10010219
444 Ga0207640_10345129
445 Ga0207648_10254398
446 Ga0207675_100078385
447 Ga0207675_100615092
448 Ga0209371_1003882
449 Ga0209282_1000001
450 Ga0268256_1003667
451 Ga0307408_100038440
452 Ga0307412_10000005
453 Ga0395899_0000637
454 Ga0395899_0002108
455 Ga0395900_0000252
456 Ga0395900_0079269
457 Ga0395900_0175902
458 Ga0395900_0651741
459 Ga0395898_0004624
460 Ga0395898_0046387
461 Ga0395905_0000012
462 Ga0395905_0094297
463 Ga0436364_1491083
464 Ga0395901_0000967
465 Ga0395901_0003504
466 Ga0395901_0112007
467 Ga0436360_0533733
468 Ga0436363_1260698
469 Ga0439448_0017425
470 Ga0466969_0022660
471 Ga0466969_0029612
472 Ga0466969_0040861
473 Ga0466966_0100656
474 Ga0466966_0218870
475 Ga0466970_0064103
476 Ga0466970_0173733
477 Ga0451576_0074358
478 Ga0466958_0003846
479 Ga0495592_0069137
480 Ga0495603_0011030
481 Ga0495603_0012133
482 Ga0495603_0042659
483 Ga0495590_0002012
484 Ga0495590_0020507
485 Ga0495591_006997
486 Ga0495591_017447
487 Ga0495629_0000099
488 Ga0495629_0006170
489 Ga0495629_0020025
490 Ga0495641_0115992
491 Ga0495651_0119505
492 Ga0495651_0233149
493 Ga0495653_0005336
494 Ga0495653_0090023
495 Ga0495650_0004829
496 Ga0495650_0006041
497 Ga0495650_0052185
498 Ga0495650_0062364
499 Ga0495580_0001906
500 Ga0495580_0002192
501 Ga0495580_0009661
502 Ga0495580_0012871
503 Ga0495580_0023337
504 Ga0495580_0183043
505 Ga0495582_0012720
506 Ga0495605_0014120
507 Ga0495605_0014928
508 Ga0495662_0090543
509 Ga0495662_0193574
510 Ga0495664_0004599
511 Ga0495664_0033855
512 Ga0495596_0084065
513 Ga0495607_0007794
514 Ga0495583_0013204
515 Ga0495606_0000798
516 Ga0495606_0016393
517 Ga0495608_0021645
518 Ga0495608_0148991
519 Ga0495610_0015358
520 Ga0495618_0014690
521 Ga0495620_0046012
522 Ga0495628_0015448
523 Ga0495628_0019014
524 Ga0495628_0027356
525 Ga0495628_0031780
526 Ga0495628_0365563
527 Ga0495630_0007458
528 Ga0495630_0012798
529 Ga0495630_0263914
530 Ga0495643_0051547
531 Ga0495643_0080381
532 Ga0495648_0022104
533 Ga0495648_0055745
534 Ga0495666_0005808
535 Ga0495666_0007415
536 Ga0495666_0015910
537 Ga0495666_0083935
538 Ga0495642_0153408
539 Ga0495652_0052715
540 Ga0495652_0052956
541 Ga0495652_0097849
542 Ga0495665_0007907
543 Ga0495665_0029020
544 Ga0495665_0041009
545 Ga0495640_0022900
546 Ga0495640_0106572
547 Ga0495586_0047363
548 Ga0495587_0013142
549 Ga0495597_0015555
550 Ga0495645_0015705
551 Ga0495645_0022061
552 Ga0495622_0000012
553 Ga0495622_0000228
554 Ga0495622_0048844
555 Ga0495634_0027261
556 Ga0495634_0174450
557 Ga0495635_0025011
558 Ga0495635_0033427
559 Ga0495661_0028523
560 Ga0495661_0101074
561 Ga0495588_0009096
562 Ga0495599_0004511
563 Ga0495599_0127471
564 Ga0495599_0147673
565 Ga0495623_0011055
566 Ga0495623_0021154
567 Ga0495646_0026525
568 Ga0495646_0034162
569 Ga0495646_0144009
570 Ga0495669_0020922
571 Ga0495669_0043294
572 Ga0495613_0069078
573 Ga0495613_0097642
574 Ga0495624_0005306
575 Ga0495624_0010720
576 Ga0495624_0131953
577 Ga0495671_0121180
578 Ga0495649_0000572
579 Ga0495649_0008178
580 Ga0495649_0017700
581 Ga0495649_0039933
582 Ga0495649_0074060
583 Ga0495589_0083882
584 Ga0495589_0090117
585 Ga0495600_0012704
586 Ga0495581_0001826
587 Ga0495581_0015690
588 Ga0495581_0029235
589 Ga0495604_0013202
590 Ga0495604_0055237
591 Ga0495604_0105355
592 Ga0495674_0032833
593 Ga0495674_0044531
594 Ga0495674_0061586
595 Ga0495674_0160017
596 Ga0495672_0055626
597 Ga0495676_0062681
598 Ga0495676_0110213
599 Ga0495676_0145398
600 Ga0495676_0220764
601 Ga0495680_0080064
602 Ga0495680_0109183
603 Ga0495680_0149260
604 Ga0495683_0001181
605 Ga0495683_0002006
606 Ga0495683_0005362
607 Ga0495683_0024530
608 Ga0495683_0051893
609 Ga0495687_007780
610 Ga0495687_028332
611 Ga0495675_0004581
612 Ga0495675_0009144
613 Ga0495679_005457
614 Ga0495679_027340
615 Ga0495679_045809
616 Ga0495673_0017315
617 Ga0495684_0014962
618 Ga0495684_0021582
619 Ga0495593_0005363
620 Ga0495593_0005441
621 Ga0495593_0094427
622 Ga0495593_0165294
623 Ga0495602_0000856
624 Ga0495602_0009621
625 Ga0495602_0047595
626 Ga0495602_0234677
627 Ga0495614_0012294
628 Ga0495614_0083931
629 Ga0496100_0043946
630 Ga0496100_0105422
631 Ga0496102_0002066
632 Ga0496102_0608242
633 Ga0496103_0007349
634 Ga0496103_0163211
635 Ga0496104_0300469
636 Ga0496105_0024698
637 Ga0496105_0086685
638 Ga0496106_0008273
639 Ga0496106_0122746
640 Ga0496107_0159130
641 Ga0496107_0345007
642 Ga0496110_0127402
643 Ga0496111_0136980
644 Ga0496112_0296910
645 Ga0496113_0067240
646 Ga0496113_0112459
647 Ga0496114_0014050
648 Ga0496114_0031286
649 Ga0496116_0021683
650 Ga0496116_0074037
651 Ga0496117_0029596
652 Ga0496117_0049092
653 Ga0496117_0058142
654 Ga0496117_0104260
655 Ga0496117_0110329
656 Ga0496118_0008029
657 Ga0496118_0008938
658 Ga0496118_0013114
659 Ga0496118_0023850
660 Ga0496118_0137860
661 Ga0496119_0051128
662 Ga0496119_0130041
663 Ga0496121_0000729
664 Ga0496121_0021261
665 Ga0496121_0036339
666 Ga0496121_0087874
667 Ga0496121_0121818
668 Ga0496122_0005686
669 Ga0496125_0009075
670 Ga0496126_0000882
671 Ga0496126_0004838
672 Ga0495678_000004
673 Ga0495678_029417
674 Ga0495682_0014655
675 Ga0501035_0002263
676 Ga0501044_0068537
677 nmdc:mga05p37_5467_c1
678 nmdc:mga09592_4770_c1
679 nmdc:mga0a205_356609_c1
680 2509127475
681 2510250183
682 2512347701
683 2513962180
684 2514053839
685 2515679258
686 2515688460
687 2527076840
688 2600812617
689 2644026684
690 2713477873
691 2719639336
692 2723875896
693 2738819909
694 2738832389
695 2738873916
696 2739185546
697 2739220514
698 2746088725
699 2746099969
700 2753566013
701 2819621055
702 2842331186
703 2842355525
704 2842457877
705 2885278419
706 2900635994
707 2902683269
708 2904484162
709 2904624624
710 2921650600
711 2928109859
712 2928136686
713 2928508934
714 2945935727
715 2990710360
716 642422884
717 642594047
718 642620509
719 8055305046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01774

UreD

UreD urease accessory protein

106

306

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hcn-assembly1.cif.gz_D cryoem structure of klebsiella pneumoniae ured/urease complex 0.918 21 297
8hcn-assembly1.cif.gz_D cryoem structure of klebsiella pneumoniae ured/urease complex 0.9081 21 297
4hi0-assembly1.cif.gz_D crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.8972 22 287
4hi0-assembly1.cif.gz_D crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.8907 22 287
8hc1-assembly1.cif.gz_W cryoem structure of helicobacter pylori urefd/urease complex 0.8882 22 287
ID Description Score Start End Superfamily
2jpiA00 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.799 240 283 3.30.310.50
1yz6A03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;EIF_2_alpha 0.7375 233 283 3.30.70.1130
af_D3ZPW6_59_143_3.30.310.50 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.7128 217 283 3.30.310.50
af_P78358_82_167_3.30.310.50 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.7024 217 281 3.30.310.50
4wxaA00 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.6888 229 286 3.30.310.50
ID Description Score Start End GO Terms
AF-A2VSB5-F1-model_v4 deleted 0.9947 19 297
AF-A0A2N1WX98-F1-model_v4 deleted 0.99 21 171
AF-A0A7G3EWX2-F1-model_v4 deleted 0.9882 21 160
AF-D5A4V8-F1-model_v4 deleted 0.9844 109 200
AF-A0A832H5G1-F1-model_v4 Urease accessory protein UreD 0.9842 19 168 GO:0016151

Map