F421619

General Info

Members Datasets Scaffolds Average Seq Length
359 242 357 106

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0000034|Ga0451576_0000034_253782_254126
Length 96
Sequence VETLVWVVHVVTAVVLIGLVLIQHGKGADMGAAFGSGSAGNFLSRSTAVAAAVFFVTSLSLTYIYSHPAQQQGVMDRVNPVAANPADDSKSKEIPR

Samples

Sample ID Description Type Environment
1 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
2 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
109 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
114 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
121 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
124 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
127 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
128 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
129 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
130 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
140 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
141 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
142 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
143 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
146 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
147 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
150 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
151 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
214 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
215 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
218 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
221 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
222 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
223 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
224 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
225 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
226 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
227 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
228 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
229 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
230 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
231 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
232 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
233 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
234 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
235 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
236 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
237 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
238 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
239 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
240 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 0.56
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.23
Nodule 0.56
Rhizoplane 3.62
Rhizosphere 61
Stem 0
Stem Tuber 0
Unclassified 10.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10033516 3300003215 Bacteria 1694
2 Ga0055526_1004412 3300003771 Bacteria 8463
3 Ga0065165_1004235 3300005262 Bacteria 9109
4 Ga0070670_100118758 3300005331 Bacteria 2281
5 Ga0070670_100120135 3300005331 Bacteria 2266
6 Ga0070677_10024304 3300005333 Bacteria 2252
7 Ga0070677_10053157 3300005333 Bacteria 1645
8 Ga0070666_10625319 3300005335 Bacteria 787
9 Ga0068868_100046779 3300005338 Bacteria 3387
10 Ga0068868_100150277 3300005338 Bacteria 1918
11 Ga0068868_101235377 3300005338 Bacteria 692
12 Ga0070687_100269432 3300005343 Bacteria 1067
13 Ga0070661_100436020 3300005344 Bacteria 1040
14 Ga0070668_100024055 3300005347 Bacteria 4613
15 Ga0070668_100047696 3300005347 Bacteria 3294
16 Ga0070669_100153967 3300005353 Bacteria 1781
17 Ga0070669_101019735 3300005353 Bacteria 711
18 Ga0070675_100382758 3300005354 Bacteria 1253
19 Ga0070671_100030597 3300005355 Bacteria 4443
20 Ga0070671_100045516 3300005355 Bacteria 3648
21 Ga0070671_100756851 3300005355 Bacteria 844
22 Ga0070673_100568136 3300005364 Bacteria 1032
23 Ga0070673_100906451 3300005364 Bacteria 818
24 Ga0070688_100887005 3300005365 Bacteria 703
25 Ga0070667_100015086 3300005367 Bacteria 6382
26 Ga0070667_100425219 3300005367 Bacteria 1211
27 Ga0070667_100948051 3300005367 Bacteria 802
28 Ga0070663_100000131 3300005455 Bacteria 35664
29 Ga0070662_100180942 3300005457 Bacteria 1661
30 Ga0070662_100787988 3300005457 Bacteria 808
31 Ga0070681_11713845 3300005458 Bacteria 555
32 Ga0068867_100267381 3300005459 Bacteria 1396
33 Ga0068867_100363786 3300005459 Bacteria 1211
34 Ga0070685_10195796 3300005466 Bacteria 1310
35 Ga0070706_100000822 3300005467 Bacteria 34270
36 Ga0070707_100539279 3300005468 Bacteria 1129
37 Ga0070707_100947948 3300005468 Bacteria 826
38 Ga0070698_101981114 3300005471 Bacteria 536
39 Ga0070699_100138939 3300005518 Bacteria 2144
40 Ga0070679_100024034 3300005530 Bacteria 5969
41 Ga0070672_100180344 3300005543 Bacteria 1760
42 Ga0070665_100008133 3300005548 Bacteria 10616
43 Ga0068857_101311996 3300005577 Bacteria 703
44 Ga0068854_101246610 3300005578 Bacteria 668
45 Ga0070702_100670693 3300005615 Bacteria 787
46 Ga0068852_100275913 3300005616 Bacteria 1619
47 Ga0068852_100948077 3300005616 Bacteria 878
48 Ga0068859_100768823 3300005617 Bacteria 1052
49 Ga0068864_100182063 3300005618 Bacteria 1921
50 Ga0068864_100300917 3300005618 Bacteria 1502
51 Ga0068864_100409122 3300005618 Bacteria 1290
52 Ga0068866_10159005 3300005718 Bacteria 1316
53 Ga0068861_100150764 3300005719 Bacteria 1907
54 Ga0068863_100084874 3300005841 Bacteria 3001
55 Ga0068863_100746191 3300005841 Bacteria 974
56 Ga0068863_101428823 3300005841 Bacteria 700
57 Ga0068860_100221021 3300005843 Bacteria 1839
58 Ga0075365_10549705 3300006038 Bacteria 816
59 Ga0075363_100023901 3300006048 Bacteria 3102
60 Ga0075363_100030185 3300006048 Bacteria 2804
61 Ga0075364_10011459 3300006051 Bacteria 5385
62 Ga0075364_10134392 3300006051 Bacteria 1661
63 Ga0075362_10045705 3300006177 Bacteria 1945
64 Ga0075362_10048259 3300006177 Bacteria 1899
65 Ga0075362_10059483 3300006177 Bacteria 1725
66 Ga0075362_10302705 3300006177 Bacteria 793
67 Ga0075367_10102644 3300006178 Bacteria 1749
68 Ga0075367_10106696 3300006178 Bacteria 1716
69 Ga0075367_10434534 3300006178 Bacteria 831
70 Ga0075369_10074648 3300006186 Bacteria 1496
71 Ga0075366_10006139 3300006195 Bacteria 6552
72 Ga0075366_10012469 3300006195 Bacteria 4822
73 Ga0075366_10055215 3300006195 Bacteria 2359
74 Ga0075366_10062260 3300006195 Bacteria 2218
75 Ga0075366_10703409 3300006195 Bacteria 627
76 Ga0097621_100299663 3300006237 Bacteria 1419
77 Ga0075370_10002549 3300006353 Bacteria 8476
78 Ga0075370_10004785 3300006353 Bacteria 6629
79 Ga0075370_10008782 3300006353 Bacteria 5215
80 Ga0075370_10033308 3300006353 Bacteria 2884
81 Ga0075370_10039730 3300006353 Bacteria 2652
82 Ga0075370_10453501 3300006353 Bacteria 772
83 Ga0075370_10569631 3300006353 Bacteria 685
84 Ga0075429_100017695 3300006880 Bacteria 6163
85 Ga0068865_100183128 3300006881 Bacteria 1614
86 Ga0097620_100768783 3300006931 Bacteria 1052
87 Ga0079104_1000017 3300006946 Bacteria 313784
88 Ga0075435_100627149 3300007076 Bacteria 933
89 Ga0105240_10169222 3300009093 Bacteria 2589
90 Ga0111539_10478949 3300009094 Bacteria 1450
91 Ga0114129_11469413 3300009147 Bacteria 839
92 Ga0105243_11066595 3300009148 Bacteria 814
93 Ga0105248_10000679 3300009177 Bacteria 38513
94 Ga0105248_10793572 3300009177 Bacteria 1069
95 Ga0105237_10000548 3300009545 Bacteria 52739
96 Ga0105237_10018154 3300009545 Bacteria 7284
97 Ga0105237_10811092 3300009545 Bacteria 943
98 Ga0105249_10075040 3300009553 Bacteria 3131
99 Ga0157327_1011888 3300012512 Bacteria 849
100 Ga0157373_10234543 3300013100 Bacteria 1296
101 Ga0157374_10037228 3300013296 Bacteria 4464
102 Ga0157374_11701496 3300013296 Bacteria 655
103 Ga0157378_10143275 3300013297 Bacteria 2221
104 Ga0157378_12160215 3300013297 Bacteria 608
105 Ga0163162_10337087 3300013306 Bacteria 1640
106 Ga0163162_11088687 3300013306 Bacteria 905
107 Ga0157375_10118175 3300013308 Bacteria 2758
108 Ga0157375_10745102 3300013308 Bacteria 1131
109 Ga0163163_11443261 3300014325 Bacteria 750
110 Ga0157380_10712709 3300014326 Bacteria 1010
111 Ga0157380_11024472 3300014326 Bacteria 860
112 Ga0157380_11316174 3300014326 Bacteria 770
113 Ga0157380_12381763 3300014326 Bacteria 594
114 Ga0182008_10677057 3300014497 Bacteria 587
115 Ga0157379_10174006 3300014968 Bacteria 1943
116 Ga0157379_10238931 3300014968 Bacteria 1648
117 Ga0157376_10077996 3300014969 Bacteria 2835
118 Ga0163161_10382980 3300017792 Bacteria 1124
119 Ga0209129_1000369 3300025258 Bacteria 36698
120 Ga0209673_1009129 3300025273 Bacteria 4328
121 Ga0209673_1020957 3300025273 Bacteria 2299
122 Ga0209564_1000046 3300025295 Bacteria 373787
123 Ga0209758_1000369 3300025297 Bacteria 79541
124 Ga0209758_1000709 3300025297 Bacteria 49238
125 Ga0209256_1029129 3300025299 Bacteria 1544
126 Ga0207682_10296824 3300025893 Bacteria 757
127 Ga0207642_10264134 3300025899 Bacteria 983
128 Ga0207680_10394699 3300025903 Bacteria 977
129 Ga0207684_10002827 3300025910 Bacteria 17250
130 Ga0207695_10160543 3300025913 Bacteria 2180
131 Ga0207671_10038843 3300025914 Bacteria 3528
132 Ga0207671_10046010 3300025914 Bacteria 3228
133 Ga0207660_10017230 3300025917 Bacteria 4795
134 Ga0207646_10183986 3300025922 Bacteria 1887
135 Ga0207681_10083935 3300025923 Bacteria 2256
136 Ga0207681_10135362 3300025923 Bacteria 1827
137 Ga0207659_10089977 3300025926 Bacteria 2290
138 Ga0207659_10593760 3300025926 Bacteria 944
139 Ga0207687_10209041 3300025927 Bacteria 1530
140 Ga0207644_10205970 3300025931 Bacteria 1553
141 Ga0207644_10699494 3300025931 Bacteria 845
142 Ga0207706_10023408 3300025933 Bacteria 5546
143 Ga0207669_10044345 3300025937 Bacteria 2612
144 Ga0207704_10242470 3300025938 Bacteria 1348
145 Ga0207704_10490462 3300025938 Bacteria 988
146 Ga0207691_10055811 3300025940 Bacteria 3599
147 Ga0207711_10027473 3300025941 Bacteria 4779
148 Ga0207711_10346045 3300025941 Bacteria 1376
149 Ga0207711_11135436 3300025941 Bacteria 722
150 Ga0207689_10286097 3300025942 Bacteria 1365
151 Ga0207651_10096792 3300025960 Bacteria 2178
152 Ga0207651_11055669 3300025960 Bacteria 727
153 Ga0207712_10131369 3300025961 Bacteria 1909
154 Ga0207668_10063434 3300025972 Bacteria 2607
155 Ga0207668_10192210 3300025972 Bacteria 1618
156 Ga0207658_10009896 3300025986 Bacteria 6479
157 Ga0207677_10031803 3300026023 Bacteria 3383
158 Ga0207677_11362355 3300026023 Bacteria 653
159 Ga0207678_10000500 3300026067 Bacteria 35694
160 Ga0207678_10032714 3300026067 Bacteria 4533
161 Ga0207641_10490748 3300026088 Bacteria 1191
162 Ga0207641_10879580 3300026088 Bacteria 889
163 Ga0207648_10198346 3300026089 Bacteria 1780
164 Ga0207648_10331687 3300026089 Bacteria 1368
165 Ga0207676_10174015 3300026095 Bacteria 1878
166 Ga0207674_10079146 3300026116 Bacteria 3292
167 Ga0207675_100365014 3300026118 Bacteria 1417
168 Ga0209281_1000042 3300027111 Bacteria 344748
169 Ga0209813_10001279 3300027866 Bacteria 5620
170 Ga0268266_10283371 3300028379 Bacteria 1541
171 Ga0268266_11290795 3300028379 Bacteria 705
172 Ga0307517_10000964 3300028786 Bacteria 48825
173 Ga0307517_10066773 3300028786 Bacteria 3304
174 Ga0307517_10140145 3300028786 Bacteria 1701
175 Ga0307517_10226562 3300028786 Bacteria 1128
176 Ga0307515_10012893 3300028794 Bacteria 15679
177 Ga0307515_10385913 3300028794 Bacteria 1031
178 Ga0307512_10115268 3300030522 Bacteria 1750
179 Ga0307512_10258483 3300030522 Bacteria 858
180 Ga0265330_10004765 3300031235 Bacteria 6854
181 Ga0265331_10055063 3300031250 Bacteria 1892
182 Ga0265331_10147558 3300031250 Bacteria 1068
183 Ga0265327_10000083 3300031251 Bacteria 204923
184 Ga0307513_10032115 3300031456 Bacteria 5926
185 Ga0307513_10137063 3300031456 Bacteria 2381
186 Ga0307513_10216102 3300031456 Bacteria 1743
187 Ga0307509_10017129 3300031507 Bacteria 8350
188 Ga0307509_10049537 3300031507 Bacteria 4502
189 Ga0307509_10119015 3300031507 Bacteria 2623
190 Ga0307509_10122250 3300031507 Bacteria 2578
191 Ga0307509_10143782 3300031507 Bacteria 2315
192 Ga0307508_10000078 3300031616 Bacteria 113416
193 Ga0307508_10005233 3300031616 Bacteria 12395
194 Ga0307508_10094553 3300031616 Bacteria 2579
195 Ga0307508_10630602 3300031616 Bacteria 675
196 Ga0307514_10011202 3300031649 Bacteria 7461
197 Ga0307514_10096740 3300031649 Bacteria 2132
198 Ga0307514_10322728 3300031649 Bacteria 846
199 Ga0316575_10000032 3300031665 Bacteria 33845
200 Ga0307516_10000234 3300031730 Bacteria 71156
201 Ga0307516_10054355 3300031730 Bacteria 3913
202 Ga0307516_10235920 3300031730 Bacteria 1530
203 Ga0307518_10115006 3300031838 Bacteria 1912
204 Ga0307507_10142993 3300033179 Bacteria 1827
205 Ga0307510_10053088 3300033180 Bacteria 4265
206 Ga0307510_10239032 3300033180 Bacteria 1312
207 Ga0307510_10560744 3300033180 Bacteria 589
208 Ga0373959_0077835 3300034820 Bacteria 759
209 Ga0373952_0187720 3300035092 Bacteria 599
210 Ga0373932_0049702 3300035112 Bacteria 1240
211 Ga0373939_0156138 3300035114 Bacteria 834
212 Ga0373953_0032617 3300035117 Bacteria 2033
213 Ga0373946_0065967 3300035171 Bacteria 1551
214 Ga0373931_0156494 3300035691 Bacteria 1332
215 Ga0373935_0151870 3300035692 Bacteria 1572
216 Ga0373927_0443674 3300035695 Bacteria 857
217 Ga0373927_0550157 3300035695 Bacteria 763
218 Ga0316582_0680897 3300036647 Bacteria 707
219 Ga0373925_0003838 3300037068 Bacteria 11524
220 Ga0373925_0140294 3300037068 Bacteria 1891
221 Ga0373925_0202210 3300037068 Bacteria 1580
222 Ga0395900_0000109 3300037418 Bacteria 146053
223 Ga0395898_0001070 3300037466 Bacteria 42389
224 Ga0451789_0487526 3300041443 Bacteria 1348
225 Ga0451791_1187348 3300041451 Bacteria 627
226 Ga0451793_1752054 3300041452 Bacteria 1539
227 Ga0451798_0629940 3300041458 Bacteria 613
228 Ga0451802_1521315 3300041460 Bacteria 1424
229 Ga0451807_2013634 3300041486 Bacteria 1218
230 Ga0451839_1552783 3300041496 Bacteria 573
231 Ga0451841_0817953 3300041498 Bacteria 2524
232 Ga0451849_0737829 3300041505 Bacteria 1075
233 Ga0451853_1349710 3300041512 Bacteria 1127
234 Ga0439437_044567 3300042000 Bacteria 580
235 Ga0439464_0004025 3300042439 Bacteria 3742
236 Ga0439460_0011251 3300042461 Bacteria 2305
237 Ga0451577_0090289 3300042876 Bacteria 2734
238 Ga0451577_0748301 3300042876 Bacteria 884
239 Ga0466969_0032441 3300044656 Bacteria 2655
240 Ga0466972_0031619 3300044658 Bacteria 2602
241 Ga0453683_0180467 3300044673 Bacteria 1339
242 Ga0466965_0013493 3300044683 Bacteria 3856
243 Ga0466965_0031532 3300044683 Bacteria 2585
244 Ga0466966_0029784 3300044684 Bacteria 3549
245 Ga0466961_0034201 3300044693 Bacteria 3263
246 Ga0453684_0138923 3300044712 Bacteria 2905
247 Ga0466960_0060102 3300044901 Bacteria 1861
248 Ga0466960_0086820 3300044901 Bacteria 1587
249 Ga0466959_0032290 3300045049 Bacteria 3875
250 Ga0451576_0000034 3300045051 Bacteria 390778
251 Ga0451576_1063779 3300045051 Bacteria 847
252 Ga0495592_0019070 3300046454 Bacteria 5221
253 Ga0495603_0334042 3300046455 Bacteria 870
254 Ga0495638_0297234 3300046460 Bacteria 871
255 Ga0495650_0305252 3300046471 Bacteria 532
256 Ga0495664_0056318 3300046477 Bacteria 2339
257 Ga0495583_0113900 3300046506 Bacteria 1144
258 Ga0495608_0247258 3300046511 Bacteria 1113
259 Ga0495610_0039633 3300046512 Bacteria 2381
260 Ga0495630_0731855 3300046517 Bacteria 756
261 Ga0495632_0066915 3300046519 Bacteria 1733
262 Ga0495648_0151795 3300046524 Bacteria 1208
263 Ga0495648_0162937 3300046524 Bacteria 1151
264 Ga0495666_0382987 3300046526 Bacteria 633
265 Ga0495586_0012145 3300046535 Bacteria 4574
266 Ga0495598_0222291 3300046537 Bacteria 690
267 Ga0495621_0002243 3300046539 Bacteria 5170
268 Ga0495597_0009718 3300046542 Bacteria 4739
269 Ga0495622_0332634 3300046557 Bacteria 659
270 Ga0495633_0104627 3300046558 Bacteria 1313
271 Ga0495656_0463137 3300046615 Bacteria 669
272 Ga0495668_0056011 3300046616 Bacteria 2177
273 Ga0495668_0075663 3300046616 Bacteria 1849
274 Ga0495647_0031732 3300046681 Bacteria 1966
275 Ga0495647_0262892 3300046681 Bacteria 770
276 Ga0495658_0207861 3300046683 Bacteria 1222
277 Ga0495658_0470865 3300046683 Bacteria 803
278 Ga0495624_0064738 3300046690 Bacteria 2285
279 Ga0495670_0459711 3300046691 Bacteria 690
280 Ga0495649_0002642 3300046694 Bacteria 12482
281 Ga0495660_0030943 3300046810 Bacteria 3012
282 Ga0495687_001512 3300047443 Bacteria 21202
283 Ga0495687_014345 3300047443 Bacteria 4083
284 Ga0495687_072347 3300047443 Bacteria 1377
285 Ga0495593_0023868 3300047673 Bacteria 3394
286 Ga0495626_0126982 3300048091 Bacteria 1092
287 Ga0495626_0393660 3300048091 Bacteria 536
288 Ga0496104_0742712 3300048907 Bacteria 888
289 Ga0496106_0010879 3300048909 Bacteria 6724
290 Ga0496108_0164648 3300048911 Bacteria 1917
291 Ga0496110_0251101 3300048913 Bacteria 1610
292 Ga0496112_0085499 3300048915 Bacteria 3120
293 Ga0496113_1239163 3300048916 Bacteria 581
294 Ga0496114_1145158 3300048917 Bacteria 663
295 Ga0496122_0492703 3300048925 Bacteria 597
296 Ga0501309_023652 3300049129 Bacteria 875
297 Ga0501310_009500 3300049130 Bacteria 1073
298 Ga0501032_0326403 3300049569 Bacteria 990
299 Ga0501043_0000023 3300049579 Bacteria 154331
300 Ga0501046_0000018 3300049580 Bacteria 220589
301 Ga0501047_0000020 3300049581 Bacteria 259377
302 Ga0501048_0002498 3300049582 Bacteria 14043
303 Ga0501045_0058765 3300049824 Bacteria 2816
304 nmdc:mga03683_334461_c1 3300050489 Bacteria 715
305 nmdc:mga03683_34035_c1 3300050489 Bacteria 2060
306 nmdc:mga03683_49772_c1 3300050489 Bacteria 1746
307 nmdc:mga03683_81687_c1 3300050489 Bacteria 1396
308 nmdc:mga03n38_744632_c1 3300050490 Bacteria 567
309 nmdc:mga03n38_9221_c1 3300050490 Bacteria 3578
310 nmdc:mga00v17_117159_c1 3300050491 Bacteria 1694
311 nmdc:mga00v17_334273_c1 3300050491 Bacteria 984
312 nmdc:mga00v17_845826_c1 3300050491 Bacteria 581
313 nmdc:mga0yw44_1210781_c1 3300050492 Bacteria 509
314 nmdc:mga0k408_108279_c1 3300050493 Bacteria 1642
315 nmdc:mga0k408_3338_c1 3300050493 Bacteria 8494
316 nmdc:mga0k408_5004_c1 3300050493 Bacteria 7019
317 nmdc:mga0k408_5674_c1 3300050493 Bacteria 6634
318 nmdc:mga0k408_67186_c1 3300050493 Bacteria 2089
319 nmdc:mga0k408_96573_c1 3300050493 Bacteria 1740
320 nmdc:mga06z11_114759_c1 3300050494 Bacteria 1496
321 nmdc:mga06z11_614070_c1 3300050494 Bacteria 662
322 nmdc:mga04h51_3957_c1 3300050495 Bacteria 3648
323 nmdc:mga07m45_151763_c1 3300050496 Bacteria 1344
324 nmdc:mga07m45_19439_c1 3300050496 Bacteria 3681
325 nmdc:mga07m45_2170_c1 3300050496 Bacteria 9145
326 nmdc:mga07m45_2622_c1 3300050496 Bacteria 8473
327 nmdc:mga07m45_5555_c1 3300050496 Bacteria 6290
328 nmdc:mga07m45_70975_c1 3300050496 Bacteria 1982
329 nmdc:mga07m45_9036_c1 3300050496 Bacteria 5149
330 nmdc:mga08y16_434752_c1 3300050511 Bacteria 1340
331 nmdc:mga0sz30_80235_c1 3300050516 Bacteria 1412
332 Ga0500578_0034117 3300053086 Bacteria 3270
333 Ga0500643_217903 3300053087 Bacteria 512
334 Ga0500647_0151113 3300053091 Bacteria 1084
335 Ga0500583_0410665 3300053092 Bacteria 648
336 Ga0500651_0279332 3300053093 Bacteria 963
337 Ga0500651_0600677 3300053093 Bacteria 597
338 Ga0500562_084676 3300053108 Bacteria 859
339 Ga0500594_0003821 3300053118 Bacteria 3315
340 Ga0500623_149030 3300053127 Bacteria 966
341 Ga0500628_002138 3300053129 Bacteria 3302
342 Ga0500642_0003445 3300053130 Bacteria 4787
343 Ga0500652_001710 3300053131 Bacteria 6657
344 Ga0500655_046960 3300053133 Bacteria 855
345 Ga0500658_0060396 3300053134 Bacteria 1574
346 Ga0500559_0000059 3300053136 Bacteria 87846
347 Ga0500564_250507 3300053138 Bacteria 702
348 Ga0500577_0077584 3300053142 Bacteria 1317
349 Ga0500604_0022946 3300053151 Bacteria 1776
350 Ga0500619_025847 3300053154 Bacteria 1743
351 Ga0500622_0000160 3300053156 Bacteria 70774
352 Ga0500570_051675 3300053724 Bacteria 2062
353 Ga0500645_011925 3300053730 Bacteria 2821
354 Ga0500596_014327 3300053735 Bacteria 1194
355 Ga0500587_003685 3300053739 Bacteria 2129
356 Ga0501082_0356421 3300060353 Bacteria 1276
357 Ga0466962_0063065 3300061719 Bacteria 1769

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0180467 Ga0453683_0180467_821_1165 86
2 3300045051 Ga0451576_0000034 Ga0451576_0000034_253782_254126 86
3 3300005331 Ga0070670_100120135 Ga0070670_1001201351 95
4 3300005344 Ga0070661_100436020 Ga0070661_1004360202 95
5 3300005347 Ga0070668_100024055 Ga0070668_1000240554 95
6 3300005353 Ga0070669_100153967 Ga0070669_1001539673 95
7 3300005355 Ga0070671_100045516 Ga0070671_1000455164 95
8 3300005457 Ga0070662_100180942 Ga0070662_1001809423 95
9 3300005459 Ga0068867_100267381 Ga0068867_1002673812 95
10 3300005616 Ga0068852_100948077 Ga0068852_1009480772 95
11 3300005618 Ga0068864_100409122 Ga0068864_1004091222 95
12 3300005718 Ga0068866_10159005 Ga0068866_101590051 95
13 3300005719 Ga0068861_100150764 Ga0068861_1001507644 95
14 3300006237 Ga0097621_100299663 Ga0097621_1002996634 95
15 3300006880 Ga0075429_100017695 Ga0075429_1000176959 95
16 3300006881 Ga0068865_100183128 Ga0068865_1001831282 95
17 3300009148 Ga0105243_11066595 Ga0105243_110665951 95
18 3300009553 Ga0105249_10075040 Ga0105249_100750404 95
19 3300013296 Ga0157374_11701496 Ga0157374_117014961 95
20 3300013306 Ga0163162_10337087 Ga0163162_103370874 95
21 3300014326 Ga0157380_10712709 Ga0157380_107127091 95
22 3300017792 Ga0163161_10382980 Ga0163161_103829801 95
23 3300025899 Ga0207642_10264134 Ga0207642_102641342 95
24 3300025923 Ga0207681_10135362 Ga0207681_101353622 95
25 3300025938 Ga0207704_10490462 Ga0207704_104904622 95
26 3300025940 Ga0207691_10055811 Ga0207691_100558114 95
27 3300025961 Ga0207712_10131369 Ga0207712_101313695 95
28 3300025972 Ga0207668_10192210 Ga0207668_101922103 95
29 3300026089 Ga0207648_10331687 Ga0207648_103316872 95
30 3300026118 Ga0207675_100365014 Ga0207675_1003650141 95
31 3300042876 Ga0451577_0748301 Ga0451577_0748301_336_737 95
32 3300044712 Ga0453684_0138923 Ga0453684_0138923_2317_2712 95
33 3300046558 Ga0495633_0104627 Ga0495633_0104627_680_1102 95
34 3300014497 Ga0182008_10677057 Ga0182008_106770571 96
35 3300025941 Ga0207711_11135436 Ga0207711_111354361 96
36 3300046691 Ga0495670_0459711 Ga0495670_0459711_23_445 96
37 3300053091 Ga0500647_0151113 Ga0500647_0151113_392_808 97
38 3300041452 Ga0451793_1752054 Ga0451793_1752054_463_885 98
39 3300005466 Ga0070685_10195796 Ga0070685_101957962 99
40 3300005578 Ga0068854_101246610 Ga0068854_1012466101 99
41 3300031250 Ga0265331_10055063 Ga0265331_100550633 99
42 3300031250 Ga0265331_10147558 Ga0265331_101475583 99
43 3300031251 Ga0265327_10000083 Ga0265327_1000008368 99
44 3300031649 Ga0307514_10011202 Ga0307514_100112025 99
45 3300049130 Ga0501310_009500 Ga0501310_009500_346_720 99
46 3300005333 Ga0070677_10024304 Ga0070677_100243042 100
47 3300005353 Ga0070669_101019735 Ga0070669_1010197352 100
48 3300005364 Ga0070673_100906451 Ga0070673_1009064512 100
49 3300005458 Ga0070681_11713845 Ga0070681_117138452 100
50 3300005459 Ga0068867_100363786 Ga0068867_1003637863 100
51 3300005543 Ga0070672_100180344 Ga0070672_1001803442 100
52 3300009094 Ga0111539_10478949 Ga0111539_104789492 100
53 3300012512 Ga0157327_1011888 Ga0157327_10118882 100
54 3300025923 Ga0207681_10083935 Ga0207681_100839352 100
55 3300025926 Ga0207659_10089977 Ga0207659_100899772 100
56 3300025960 Ga0207651_11055669 Ga0207651_110556691 100
57 3300026089 Ga0207648_10198346 Ga0207648_101983462 100
58 3300031730 Ga0307516_10054355 Ga0307516_100543553 100
59 3300042000 Ga0439437_044567 Ga0439437_044567_29_463 100
60 3300042439 Ga0439464_0004025 Ga0439464_0004025_1661_2095 100
61 3300042461 Ga0439460_0011251 Ga0439460_0011251_167_601 100
62 3300046537 Ga0495598_0222291 Ga0495598_0222291_46_495 100
63 3300049129 Ga0501309_023652 Ga0501309_023652_467_835 100
64 3300050489 nmdc:mga03683_334461_c1 nmdc:mga03683_334461_c1_94_501 100
65 3300053127 Ga0500623_149030 Ga0500623_149030_299_721 100
66 3300053130 Ga0500642_0003445 Ga0500642_0003445_829_1251 100
67 3300053156 Ga0500622_0000160 Ga0500622_0000160_46858_47280 100
68 3300005333 Ga0070677_10053157 Ga0070677_100531572 101
69 3300005467 Ga0070706_100000822 Ga0070706_10000082230 101
70 3300005468 Ga0070707_100539279 Ga0070707_1005392791 101
71 3300005468 Ga0070707_100947948 Ga0070707_1009479482 101
72 3300005471 Ga0070698_101981114 Ga0070698_1019811141 101
73 3300005518 Ga0070699_100138939 Ga0070699_1001389393 101
74 3300006178 Ga0075367_10102644 Ga0075367_101026444 101
75 3300006195 Ga0075366_10055215 Ga0075366_100552153 101
76 3300006353 Ga0075370_10004785 Ga0075370_100047857 101
77 3300006353 Ga0075370_10039730 Ga0075370_100397302 101
78 3300009147 Ga0114129_11469413 Ga0114129_114694131 101
79 3300009545 Ga0105237_10811092 Ga0105237_108110922 101
80 3300014326 Ga0157380_11316174 Ga0157380_113161742 101
81 3300025893 Ga0207682_10296824 Ga0207682_102968242 101
82 3300025910 Ga0207684_10002827 Ga0207684_1000282719 101
83 3300025922 Ga0207646_10183986 Ga0207646_101839862 101
84 3300025937 Ga0207669_10044345 Ga0207669_100443456 101
85 3300028794 Ga0307515_10385913 Ga0307515_103859131 101
86 3300031235 Ga0265330_10004765 Ga0265330_100047655 101
87 3300031665 Ga0316575_10000032 Ga0316575_1000003213 101
88 3300036647 Ga0316582_0680897 Ga0316582_0680897_77_421 101
89 3300045051 Ga0451576_1063779 Ga0451576_1063779_119_463 101
90 3300046471 Ga0495650_0305252 Ga0495650_0305252_78_506 101
91 3300046506 Ga0495583_0113900 Ga0495583_0113900_396_809 101
92 3300046539 Ga0495621_0002243 Ga0495621_0002243_465_908 101
93 3300046694 Ga0495649_0002642 Ga0495649_0002642_6715_7128 101
94 3300046810 Ga0495660_0030943 Ga0495660_0030943_1061_1474 101
95 3300047443 Ga0495687_072347 Ga0495687_072347_589_1002 101
96 3300053086 Ga0500578_0034117 Ga0500578_0034117_400_834 101
97 3300053730 Ga0500645_011925 Ga0500645_011925_1947_2381 101
98 3300005262 Ga0065165_1004235 Ga0065165_10042355 102
99 3300005335 Ga0070666_10625319 Ga0070666_106253191 102
100 3300005355 Ga0070671_100030597 Ga0070671_1000305974 102
101 3300005355 Ga0070671_100756851 Ga0070671_1007568512 102
102 3300005364 Ga0070673_100568136 Ga0070673_1005681362 102
103 3300005365 Ga0070688_100887005 Ga0070688_1008870052 102
104 3300005367 Ga0070667_100425219 Ga0070667_1004252193 102
105 3300005457 Ga0070662_100787988 Ga0070662_1007879881 102
106 3300005530 Ga0070679_100024034 Ga0070679_1000240343 102
107 3300005577 Ga0068857_101311996 Ga0068857_1013119961 102
108 3300005617 Ga0068859_100768823 Ga0068859_1007688231 102
109 3300005618 Ga0068864_100182063 Ga0068864_1001820635 102
110 3300005841 Ga0068863_100746191 Ga0068863_1007461912 102
111 3300005841 Ga0068863_101428823 Ga0068863_1014288231 102
112 3300005843 Ga0068860_100221021 Ga0068860_1002210212 102
113 3300006038 Ga0075365_10549705 Ga0075365_105497052 102
114 3300006048 Ga0075363_100023901 Ga0075363_1000239013 102
115 3300006048 Ga0075363_100030185 Ga0075363_1000301852 102
116 3300006051 Ga0075364_10011459 Ga0075364_100114596 102
117 3300006177 Ga0075362_10045705 Ga0075362_100457052 102
118 3300006177 Ga0075362_10048259 Ga0075362_100482592 102
119 3300006177 Ga0075362_10302705 Ga0075362_103027052 102
120 3300006178 Ga0075367_10106696 Ga0075367_101066963 102
121 3300006178 Ga0075367_10434534 Ga0075367_104345342 102
122 3300006186 Ga0075369_10074648 Ga0075369_100746482 102
123 3300006195 Ga0075366_10012469 Ga0075366_100124699 102
124 3300006195 Ga0075366_10062260 Ga0075366_100622601 102
125 3300006195 Ga0075366_10703409 Ga0075366_107034091 102
126 3300006353 Ga0075370_10008782 Ga0075370_100087825 102
127 3300006353 Ga0075370_10033308 Ga0075370_100333082 102
128 3300006353 Ga0075370_10569631 Ga0075370_105696311 102
129 3300006931 Ga0097620_100768783 Ga0097620_1007687831 102
130 3300009093 Ga0105240_10169222 Ga0105240_101692226 102
131 3300009177 Ga0105248_10000679 Ga0105248_1000067938 102
132 3300009545 Ga0105237_10018154 Ga0105237_100181547 102
133 3300025273 Ga0209673_1009129 Ga0209673_10091294 102
134 3300025299 Ga0209256_1029129 Ga0209256_10291292 102
135 3300025903 Ga0207680_10394699 Ga0207680_103946992 102
136 3300025913 Ga0207695_10160543 Ga0207695_101605435 102
137 3300025914 Ga0207671_10046010 Ga0207671_100460106 102
138 3300025917 Ga0207660_10017230 Ga0207660_100172304 102
139 3300025931 Ga0207644_10205970 Ga0207644_102059703 102
140 3300025960 Ga0207651_10096792 Ga0207651_100967921 102
141 3300026067 Ga0207678_10032714 Ga0207678_100327144 102
142 3300026088 Ga0207641_10879580 Ga0207641_108795801 102
143 3300026116 Ga0207674_10079146 Ga0207674_100791464 102
144 3300027866 Ga0209813_10001279 Ga0209813_100012798 102
145 3300028786 Ga0307517_10066773 Ga0307517_100667734 102
146 3300028786 Ga0307517_10226562 Ga0307517_102265622 102
147 3300031456 Ga0307513_10137063 Ga0307513_101370633 102
148 3300031730 Ga0307516_10000234 Ga0307516_100002347 102
149 3300034820 Ga0373959_0077835 Ga0373959_0077835_11_400 102
150 3300041443 Ga0451789_0487526 Ga0451789_0487526_420_821 102
151 3300041498 Ga0451841_0817953 Ga0451841_0817953_953_1354 102
152 3300041505 Ga0451849_0737829 Ga0451849_0737829_236_637 102
153 3300044658 Ga0466972_0031619 Ga0466972_0031619_400_798 102
154 3300044901 Ga0466960_0060102 Ga0466960_0060102_904_1302 102
155 3300047443 Ga0495687_014345 Ga0495687_014345_376_789 102
156 3300050489 nmdc:mga03683_49772_c1 nmdc:mga03683_49772_c1_484_900 102
157 3300050489 nmdc:mga03683_81687_c1 nmdc:mga03683_81687_c1_693_1106 102
158 3300050490 nmdc:mga03n38_744632_c1 nmdc:mga03n38_744632_c1_75_476 102
159 3300050490 nmdc:mga03n38_9221_c1 nmdc:mga03n38_9221_c1_1584_2000 102
160 3300050491 nmdc:mga00v17_117159_c1 nmdc:mga00v17_117159_c1_50_466 102
161 3300050491 nmdc:mga00v17_334273_c1 nmdc:mga00v17_334273_c1_248_664 102
162 3300050493 nmdc:mga0k408_108279_c1 nmdc:mga0k408_108279_c1_21_437 102
163 3300050493 nmdc:mga0k408_5004_c1 nmdc:mga0k408_5004_c1_4336_4740 102
164 3300050493 nmdc:mga0k408_5674_c1 nmdc:mga0k408_5674_c1_2118_2534 102
165 3300050493 nmdc:mga0k408_67186_c1 nmdc:mga0k408_67186_c1_1473_1886 102
166 3300050494 nmdc:mga06z11_114759_c1 nmdc:mga06z11_114759_c1_236_652 102
167 3300050494 nmdc:mga06z11_614070_c1 nmdc:mga06z11_614070_c1_176_592 102
168 3300050495 nmdc:mga04h51_3957_c1 nmdc:mga04h51_3957_c1_2066_2482 102
169 3300050496 nmdc:mga07m45_19439_c1 nmdc:mga07m45_19439_c1_1901_2317 102
170 3300050496 nmdc:mga07m45_2170_c1 nmdc:mga07m45_2170_c1_4426_4842 102
171 3300050496 nmdc:mga07m45_2622_c1 nmdc:mga07m45_2622_c1_5106_5522 102
172 3300050496 nmdc:mga07m45_5555_c1 nmdc:mga07m45_5555_c1_3634_4050 102
173 3300050496 nmdc:mga07m45_70975_c1 nmdc:mga07m45_70975_c1_76_477 102
174 3300050516 nmdc:mga0sz30_80235_c1 nmdc:mga0sz30_80235_c1_738_1154 102
175 3300053087 Ga0500643_217903 Ga0500643_217903_58_480 102
176 3300053092 Ga0500583_0410665 Ga0500583_0410665_37_459 102
177 3300053093 Ga0500651_0279332 Ga0500651_0279332_259_681 102
178 3300053108 Ga0500562_084676 Ga0500562_084676_256_678 102
179 3300053129 Ga0500628_002138 Ga0500628_002138_246_668 102
180 3300053131 Ga0500652_001710 Ga0500652_001710_4044_4466 102
181 3300053133 Ga0500655_046960 Ga0500655_046960_251_673 102
182 3300053134 Ga0500658_0060396 Ga0500658_0060396_917_1330 102
183 3300053142 Ga0500577_0077584 Ga0500577_0077584_341_763 102
184 3300053151 Ga0500604_0022946 Ga0500604_0022946_431_853 102
185 3300053724 Ga0500570_051675 Ga0500570_051675_923_1345 102
186 iso_pu_bacteria 2643221654 2644304348 102
187 3300005367 Ga0070667_100948051 Ga0070667_1009480511 103
188 3300005616 Ga0068852_100275913 Ga0068852_1002759133 103
189 3300007076 Ga0075435_100627149 Ga0075435_1006271492 103
190 3300009545 Ga0105237_10000548 Ga0105237_1000054835 103
191 3300014325 Ga0163163_11443261 Ga0163163_114432612 103
192 3300025914 Ga0207671_10038843 Ga0207671_100388432 103
193 3300025941 Ga0207711_10027473 Ga0207711_100274732 103
194 3300031456 Ga0307513_10216102 Ga0307513_102161023 103
195 3300031507 Ga0307509_10017129 Ga0307509_100171294 103
196 3300031507 Ga0307509_10122250 Ga0307509_101222501 103
197 3300031507 Ga0307509_10143782 Ga0307509_101437822 103
198 3300031616 Ga0307508_10000078 Ga0307508_1000007852 103
199 3300031616 Ga0307508_10094553 Ga0307508_100945531 103
200 3300031616 Ga0307508_10630602 Ga0307508_106306021 103
201 3300031730 Ga0307516_10235920 Ga0307516_102359203 103
202 3300033179 Ga0307507_10142993 Ga0307507_101429932 103
203 3300033180 Ga0307510_10560744 Ga0307510_105607441 103
204 3300035092 Ga0373952_0187720 Ga0373952_0187720_88_516 103
205 3300035112 Ga0373932_0049702 Ga0373932_0049702_505_933 103
206 3300035691 Ga0373931_0156494 Ga0373931_0156494_665_1093 103
207 3300037068 Ga0373925_0140294 Ga0373925_0140294_1117_1551 103
208 3300037068 Ga0373925_0202210 Ga0373925_0202210_220_648 103
209 3300041458 Ga0451798_0629940 Ga0451798_0629940_78_482 103
210 3300041460 Ga0451802_1521315 Ga0451802_1521315_694_1098 103
211 3300041486 Ga0451807_2013634 Ga0451807_2013634_99_503 103
212 3300044683 Ga0466965_0031532 Ga0466965_0031532_2165_2557 103
213 3300044901 Ga0466960_0086820 Ga0466960_0086820_491_886 103
214 3300046454 Ga0495592_0019070 Ga0495592_0019070_2779_3204 103
215 3300046512 Ga0495610_0039633 Ga0495610_0039633_965_1384 103
216 3300046517 Ga0495630_0731855 Ga0495630_0731855_31_459 103
217 3300046526 Ga0495666_0382987 Ga0495666_0382987_113_541 103
218 3300046542 Ga0495597_0009718 Ga0495597_0009718_3235_3651 103
219 3300046557 Ga0495622_0332634 Ga0495622_0332634_33_461 103
220 3300046683 Ga0495658_0470865 Ga0495658_0470865_148_576 103
221 3300046690 Ga0495624_0064738 Ga0495624_0064738_533_961 103
222 3300047443 Ga0495687_001512 Ga0495687_001512_18264_18680 103
223 3300047673 Ga0495593_0023868 Ga0495593_0023868_2356_2784 103
224 3300048091 Ga0495626_0126982 Ga0495626_0126982_411_827 103
225 3300048911 Ga0496108_0164648 Ga0496108_0164648_1095_1511 103
226 3300048915 Ga0496112_0085499 Ga0496112_0085499_76_492 103
227 3300048916 Ga0496113_1239163 Ga0496113_1239163_126_542 103
228 3300053118 Ga0500594_0003821 Ga0500594_0003821_2647_3066 103
229 3300053138 Ga0500564_250507 Ga0500564_250507_129_554 103
230 3300053154 Ga0500619_025847 Ga0500619_025847_699_1124 103
231 3300053739 Ga0500587_003685 Ga0500587_003685_251_670 103
232 3300005354 Ga0070675_100382758 Ga0070675_1003827583 104
233 3300006051 Ga0075364_10134392 Ga0075364_101343922 104
234 3300006353 Ga0075370_10002549 Ga0075370_1000254910 104
235 3300006353 Ga0075370_10453501 Ga0075370_104535012 104
236 3300013296 Ga0157374_10037228 Ga0157374_100372284 104
237 3300014326 Ga0157380_12381763 Ga0157380_123817631 104
238 3300025926 Ga0207659_10593760 Ga0207659_105937602 104
239 3300028786 Ga0307517_10000964 Ga0307517_100009647 104
240 3300028786 Ga0307517_10140145 Ga0307517_101401453 104
241 3300028794 Ga0307515_10012893 Ga0307515_100128935 104
242 3300030522 Ga0307512_10258483 Ga0307512_102584831 104
243 3300031507 Ga0307509_10119015 Ga0307509_101190151 104
244 3300031649 Ga0307514_10096740 Ga0307514_100967402 104
245 3300033180 Ga0307510_10239032 Ga0307510_102390322 104
246 3300035114 Ga0373939_0156138 Ga0373939_0156138_165_569 104
247 3300035117 Ga0373953_0032617 Ga0373953_0032617_583_1014 104
248 3300035171 Ga0373946_0065967 Ga0373946_0065967_814_1245 104
249 3300035692 Ga0373935_0151870 Ga0373935_0151870_69_467 104
250 3300035695 Ga0373927_0550157 Ga0373927_0550157_322_720 104
251 3300046460 Ga0495638_0297234 Ga0495638_0297234_88_516 104
252 3300046511 Ga0495608_0247258 Ga0495608_0247258_627_1046 104
253 3300046519 Ga0495632_0066915 Ga0495632_0066915_987_1415 104
254 3300046524 Ga0495648_0162937 Ga0495648_0162937_237_665 104
255 3300046615 Ga0495656_0463137 Ga0495656_0463137_146_571 104
256 3300048913 Ga0496110_0251101 Ga0496110_0251101_296_712 104
257 3300050491 nmdc:mga00v17_845826_c1 nmdc:mga00v17_845826_c1_158_559 104
258 3300050492 nmdc:mga0yw44_1210781_c1 nmdc:mga0yw44_1210781_c1_47_466 104
259 3300050493 nmdc:mga0k408_96573_c1 nmdc:mga0k408_96573_c1_1033_1455 104
260 3300050496 nmdc:mga07m45_151763_c1 nmdc:mga07m45_151763_c1_677_1105 104
261 3300050496 nmdc:mga07m45_9036_c1 nmdc:mga07m45_9036_c1_4285_4707 104
262 3300050511 nmdc:mga08y16_434752_c1 nmdc:mga08y16_434752_c1_284_733 104
263 3300053735 Ga0500596_014327 Ga0500596_014327_734_1153 104
264 3300005367 Ga0070667_100015086 Ga0070667_1000150864 105
265 3300013306 Ga0163162_11088687 Ga0163162_110886872 105
266 3300013308 Ga0157375_10118175 Ga0157375_101181751 105
267 3300025986 Ga0207658_10009896 Ga0207658_100098967 105
268 3300030522 Ga0307512_10115268 Ga0307512_101152684 105
269 3300031456 Ga0307513_10032115 Ga0307513_100321154 105
270 3300031507 Ga0307509_10049537 Ga0307509_100495376 105
271 3300031616 Ga0307508_10005233 Ga0307508_100052335 105
272 3300031649 Ga0307514_10322728 Ga0307514_103227282 105
273 3300031838 Ga0307518_10115006 Ga0307518_101150064 105
274 3300033180 Ga0307510_10053088 Ga0307510_100530883 105
275 3300041451 Ga0451791_1187348 Ga0451791_1187348_74_475 105
276 3300041512 Ga0451853_1349710 Ga0451853_1349710_79_480 105
277 3300044656 Ga0466969_0032441 Ga0466969_0032441_369_764 105
278 3300044683 Ga0466965_0013493 Ga0466965_0013493_2473_2868 105
279 3300044684 Ga0466966_0029784 Ga0466966_0029784_938_1333 105
280 3300044693 Ga0466961_0034201 Ga0466961_0034201_488_883 105
281 3300045049 Ga0466959_0032290 Ga0466959_0032290_1659_2054 105
282 3300046524 Ga0495648_0151795 Ga0495648_0151795_567_989 105
283 3300048091 Ga0495626_0393660 Ga0495626_0393660_49_477 105
284 3300049569 Ga0501032_0326403 Ga0501032_0326403_287_688 105
285 3300049579 Ga0501043_0000023 Ga0501043_0000023_101258_101659 105
286 3300049580 Ga0501046_0000018 Ga0501046_0000018_118903_119304 105
287 3300049581 Ga0501047_0000020 Ga0501047_0000020_157712_158113 105
288 3300049582 Ga0501048_0002498 Ga0501048_0002498_6677_7078 105
289 3300049824 Ga0501045_0058765 Ga0501045_0058765_1765_2166 105
290 3300053136 Ga0500559_0000059 Ga0500559_0000059_15671_16090 105
291 3300060353 Ga0501082_0356421 Ga0501082_0356421_809_1210 105
292 3300061719 Ga0466962_0063065 Ga0466962_0063065_1028_1423 105
293 3300005338 Ga0068868_100150277 Ga0068868_1001502772 106
294 3300005548 Ga0070665_100008133 Ga0070665_1000081339 106
295 3300006946 Ga0079104_1000017 Ga0079104_1000017109 106
296 3300013297 Ga0157378_10143275 Ga0157378_101432753 106
297 3300025938 Ga0207704_10242470 Ga0207704_102424702 106
298 3300027111 Ga0209281_1000042 Ga0209281_1000042238 106
299 3300028379 Ga0268266_10283371 Ga0268266_102833713 106
300 3300046616 Ga0495668_0056011 Ga0495668_0056011_1719_2159 106
301 3300048925 Ga0496122_0492703 Ga0496122_0492703_70_486 106
302 3300005331 Ga0070670_100118758 Ga0070670_1001187583 107
303 3300005338 Ga0068868_100046779 Ga0068868_1000467795 107
304 3300005338 Ga0068868_101235377 Ga0068868_1012353771 107
305 3300005343 Ga0070687_100269432 Ga0070687_1002694322 107
306 3300005615 Ga0070702_100670693 Ga0070702_1006706932 107
307 3300005618 Ga0068864_100300917 Ga0068864_1003009171 107
308 3300005841 Ga0068863_100084874 Ga0068863_1000848743 107
309 3300006177 Ga0075362_10059483 Ga0075362_100594833 107
310 3300006195 Ga0075366_10006139 Ga0075366_100061399 107
311 3300014326 Ga0157380_11024472 Ga0157380_110244722 107
312 3300014968 Ga0157379_10174006 Ga0157379_101740063 107
313 3300014968 Ga0157379_10238931 Ga0157379_102389312 107
314 3300025927 Ga0207687_10209041 Ga0207687_102090411 107
315 3300025931 Ga0207644_10699494 Ga0207644_106994942 107
316 3300025942 Ga0207689_10286097 Ga0207689_102860971 107
317 3300026023 Ga0207677_10031803 Ga0207677_100318033 107
318 3300026023 Ga0207677_11362355 Ga0207677_113623551 107
319 3300026088 Ga0207641_10490748 Ga0207641_104907482 107
320 3300026095 Ga0207676_10174015 Ga0207676_101740151 107
321 3300028379 Ga0268266_11290795 Ga0268266_112907951 107
322 3300035695 Ga0373927_0443674 Ga0373927_0443674_275_676 107
323 3300037068 Ga0373925_0003838 Ga0373925_0003838_7359_7760 107
324 3300041496 Ga0451839_1552783 Ga0451839_1552783_91_489 107
325 3300046616 Ga0495668_0075663 Ga0495668_0075663_829_1269 107
326 3300046681 Ga0495647_0262892 Ga0495647_0262892_120_521 107
327 3300048909 Ga0496106_0010879 Ga0496106_0010879_2237_2665 107
328 3300050489 nmdc:mga03683_34035_c1 nmdc:mga03683_34035_c1_241_666 107
329 3300050493 nmdc:mga0k408_3338_c1 nmdc:mga0k408_3338_c1_5822_6247 107
330 iso_pu_bacteria 2643221592 2643968967 107
331 3300005347 Ga0070668_100047696 Ga0070668_1000476964 108
332 3300009177 Ga0105248_10793572 Ga0105248_107935722 108
333 3300013297 Ga0157378_12160215 Ga0157378_121602151 108
334 3300013308 Ga0157375_10745102 Ga0157375_107451021 108
335 3300014969 Ga0157376_10077996 Ga0157376_100779964 108
336 3300025941 Ga0207711_10346045 Ga0207711_103460452 108
337 3300025972 Ga0207668_10063434 Ga0207668_100634343 108
338 3300037418 Ga0395900_0000109 Ga0395900_0000109_133998_134432 108
339 3300037466 Ga0395898_0001070 Ga0395898_0001070_40444_40878 108
340 3300046455 Ga0495603_0334042 Ga0495603_0334042_325_747 108
341 3300046477 Ga0495664_0056318 Ga0495664_0056318_1638_2039 108
342 3300046535 Ga0495586_0012145 Ga0495586_0012145_2779_3180 108
343 3300046681 Ga0495647_0031732 Ga0495647_0031732_1367_1789 108
344 3300046683 Ga0495658_0207861 Ga0495658_0207861_453_875 108
345 3300048907 Ga0496104_0742712 Ga0496104_0742712_229_651 108
346 3300048917 Ga0496114_1145158 Ga0496114_1145158_133_555 108
347 3300005455 Ga0070663_100000131 Ga0070663_10000013137 109
348 3300013100 Ga0157373_10234543 Ga0157373_102345432 109
349 3300025933 Ga0207706_10023408 Ga0207706_100234084 109
350 3300026067 Ga0207678_10000500 Ga0207678_1000050036 109
351 3300042876 Ga0451577_0090289 Ga0451577_0090289_823_1236 109
352 3300053093 Ga0500651_0600677 Ga0500651_0600677_75_479 110
353 3300003215 JGI25153J46596_10033516 JGI25153J46596_100335163 111
354 3300003771 Ga0055526_1004412 Ga0055526_10044129 111
355 3300025258 Ga0209129_1000369 Ga0209129_100036916 111
356 3300025273 Ga0209673_1020957 Ga0209673_10209573 111
357 3300025295 Ga0209564_1000046 Ga0209564_1000046113 111
358 3300025297 Ga0209758_1000369 Ga0209758_100036911 111
359 3300025297 Ga0209758_1000709 Ga0209758_100070913 111

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03840

SecG

Preprotein translocase SecG subunit

4

64

0.93

Feature Viewer

pLDDT pTM Quality
62.69 0.35 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map