F421598

General Info

Members Datasets Scaffolds Average Seq Length
359 199 714 459

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0154840|Ga0436364_0154840_179948_181534
Length 528
Sequence MRKSLAKPRSSRMFYASWVRFVVARCDRRCVSSSNRAESCVDGLRNRREKLVTSKTNADIVDTVPHAVTEWDRIPAKRYYDPDFYELENKNLWPRVWQMACRLEEIPEVGDYTVYRNLDQSIIVIRTGADTIKAYHNHCRHRGVELVNKNGKATGGFICPFHGWRWDREGNNTFVFQEDAYSEANMCKDDLALRDVRCDTWGGCAWINLDKDAPPLYESLGRFAKQMDLYKVDELQVEWWYAARLPTNWKLAMEAFMEGYHVATTHPQLLPPGATSRPGEAAWVKLPPEMIMGSWWTTMPPKMPEEIDSGMFIDNYIDKMNELHEGMGGMLAKEEIAVAERLRNTELPRNTQDALITWRRMLNQAMTDDYRGKGIEIGDLNAIDAAGEASSVNFCFPHYFLLPVHGAASSYRIRPLGPEECLFELWSLKRYPKDEKRPVPTAPTPKAHDDPQWPEIPKQDYSNLPRQQRGLHTGDFEFMRISKDMEGLISNYQRLIDGYLAGYPSDKLVDAVQEVSGPIDRAVEDLGF

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
141 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
142 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
145 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
196 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
197 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
199 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.86
Nodule 0
Rhizoplane 7.8
Rhizosphere 71.87
Stem 0
Stem Tuber 0
Unclassified 1.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0154840 3300037853 Bacteria 188668
2 JGI24737J22298_10026962 3300001990 Bacteria 1814
3 JGI24743J22301_10010095 3300001991 Bacteria 1681
4 JGI24750J21931_1001793 3300002070 Bacteria 2621
5 JGI24744J21845_10007668 3300002077 Bacteria 2229
6 JGI24034J26672_10003211 3300002239 Bacteria 2277
7 Ga0070658_10000161 3300005327 Bacteria 59009
8 Ga0070676_10036856 3300005328 Bacteria 2818
9 Ga0068869_100001650 3300005334 Bacteria 13320
10 Ga0070666_10002481 3300005335 Bacteria 11157
11 Ga0070666_10069963 3300005335 Bacteria 2387
12 Ga0070680_100083055 3300005336 Bacteria 2645
13 Ga0070682_100039981 3300005337 Bacteria 2884
14 Ga0070682_100094684 3300005337 Bacteria 1960
15 Ga0068868_100076038 3300005338 Bacteria 2684
16 Ga0070689_100046399 3300005340 Bacteria 3348
17 Ga0070691_10018046 3300005341 Bacteria 3249
18 Ga0070668_100014466 3300005347 Bacteria 5898
19 Ga0070668_100055852 3300005347 Bacteria 3048
20 Ga0070669_100000094 3300005353 Bacteria 87053
21 Ga0070669_100000408 3300005353 Bacteria 32921
22 Ga0070669_100007928 3300005353 Bacteria 7589
23 Ga0070671_100000031 3300005355 Bacteria 108269
24 Ga0070671_100000108 3300005355 Bacteria 52691
25 Ga0070671_100000208 3300005355 Bacteria 38891
26 Ga0070671_100122667 3300005355 Bacteria 2187
27 Ga0070674_100041428 3300005356 Bacteria 3121
28 Ga0070688_100039454 3300005365 Bacteria 2889
29 Ga0070667_100000573 3300005367 Bacteria 36406
30 Ga0070667_100022731 3300005367 Bacteria 5200
31 Ga0070667_100064132 3300005367 Bacteria 3116
32 Ga0070703_10008483 3300005406 Bacteria 2891
33 Ga0070710_10000890 3300005437 Bacteria 14275
34 Ga0070710_10001239 3300005437 Bacteria 12104
35 Ga0070701_10017297 3300005438 Bacteria 3368
36 Ga0070711_100009898 3300005439 Bacteria 5877
37 Ga0070705_100055668 3300005440 Bacteria 2325
38 Ga0070663_100127053 3300005455 Bacteria 1932
39 Ga0070678_100046318 3300005456 Bacteria 3117
40 Ga0070662_100064024 3300005457 Bacteria 2691
41 Ga0068867_100002467 3300005459 Bacteria 13007
42 Ga0070685_10077475 3300005466 Bacteria 1985
43 Ga0068853_100067493 3300005539 Bacteria 3107
44 Ga0070686_100008799 3300005544 Bacteria 5658
45 Ga0070686_100022004 3300005544 Bacteria 3795
46 Ga0070695_100019390 3300005545 Bacteria 4142
47 Ga0070696_100006247 3300005546 Bacteria 7974
48 Ga0070696_100051378 3300005546 Bacteria 2867
49 Ga0070693_100048392 3300005547 Bacteria 2421
50 Ga0070665_100002065 3300005548 Bacteria 22532
51 Ga0070665_100014678 3300005548 Bacteria 7861
52 Ga0070665_100036009 3300005548 Bacteria 4979
53 Ga0070665_100140174 3300005548 Bacteria 2421
54 Ga0070665_100215979 3300005548 Bacteria 1919
55 Ga0070704_100002000 3300005549 Bacteria 11293
56 Ga0068855_100000259 3300005563 Bacteria 66061
57 Ga0068855_100005120 3300005563 Bacteria 15985
58 Ga0068855_100018242 3300005563 Bacteria 8429
59 Ga0068855_100021297 3300005563 Bacteria 7773
60 Ga0068855_100050111 3300005563 Bacteria 4922
61 Ga0068855_100094352 3300005563 Bacteria 3450
62 Ga0068854_100000230 3300005578 Bacteria 37984
63 Ga0068854_100053802 3300005578 Bacteria 2892
64 Ga0068856_100001269 3300005614 Bacteria 26574
65 Ga0068856_100163127 3300005614 Bacteria 2240
66 Ga0068852_100000118 3300005616 Bacteria 53741
67 Ga0068852_100088411 3300005616 Unclassified 2767
68 Ga0068852_100212090 3300005616 Bacteria 1838
69 Ga0068859_100000579 3300005617 Bacteria 36523
70 Ga0068859_100008383 3300005617 Bacteria 10476
71 Ga0068859_100016015 3300005617 Bacteria 7534
72 Ga0068859_100077225 3300005617 Bacteria 3371
73 Ga0068866_10003501 3300005718 Bacteria 6434
74 Ga0068861_100002743 3300005719 Bacteria 11538
75 Ga0068863_100001232 3300005841 Bacteria 25519
76 Ga0068863_100028228 3300005841 Bacteria 5358
77 Ga0068858_100000478 3300005842 Bacteria 41670
78 Ga0068858_100016569 3300005842 Bacteria 6922
79 Ga0068858_100037188 3300005842 Bacteria 4514
80 Ga0068858_100087811 3300005842 Bacteria 2892
81 Ga0068858_100162827 3300005842 Bacteria 2101
82 Ga0068860_100000732 3300005843 Bacteria 37365
83 Ga0068860_100037167 3300005843 Bacteria 4661
84 Ga0068860_100052658 3300005843 Bacteria 3871
85 Ga0068860_100060990 3300005843 Bacteria 3583
86 Ga0068860_100109493 3300005843 Bacteria 2640
87 Ga0068862_100000873 3300005844 Bacteria 29384
88 Ga0068862_100033285 3300005844 Bacteria 4356
89 Ga0081455_10009849 3300005937 Bacteria 9787
90 Ga0081455_10189862 3300005937 Bacteria 1548
91 Ga0081538_10091353 3300005981 Bacteria 1572
92 Ga0075365_10000399 3300006038 Bacteria 15940
93 Ga0075363_100000759 3300006048 Bacteria 11043
94 Ga0075363_100001931 3300006048 Bacteria 8219
95 Ga0075363_100006194 3300006048 Bacteria 5408
96 Ga0075363_100008578 3300006048 Bacteria 4768
97 Ga0075363_100038356 3300006048 Bacteria 2520
98 Ga0075364_10002016 3300006051 Bacteria 11320
99 Ga0075364_10013130 3300006051 Bacteria 5083
100 Ga0075364_10017705 3300006051 Bacteria 4455
101 Ga0075364_10033865 3300006051 Bacteria 3292
102 Ga0070715_10010993 3300006163 Bacteria 3245
103 Ga0070716_100001818 3300006173 Bacteria 9662
104 Ga0070716_100017000 3300006173 Bacteria 3764
105 Ga0070712_100002442 3300006175 Bacteria 11454
106 Ga0070712_100004291 3300006175 Bacteria 8782
107 Ga0075369_10001577 3300006186 Bacteria 7830
108 Ga0075369_10020104 3300006186 Bacteria 2732
109 Ga0075370_10001922 3300006353 Bacteria 9359
110 Ga0075370_10006794 3300006353 Bacteria 5783
111 Ga0075370_10007593 3300006353 Bacteria 5530
112 Ga0075370_10030602 3300006353 Bacteria 3004
113 Ga0075370_10038928 3300006353 Bacteria 2677
114 Ga0097620_100000579 3300006931 Bacteria 36523
115 Ga0097620_100008383 3300006931 Bacteria 10476
116 Ga0097620_100016018 3300006931 Bacteria 7534
117 Ga0097620_100077217 3300006931 Bacteria 3371
118 Ga0105240_10004237 3300009093 Bacteria 21932
119 Ga0105240_10017234 3300009093 Bacteria 9743
120 Ga0105240_10027981 3300009093 Bacteria 7372
121 Ga0105240_10075394 3300009093 Bacteria 4161
122 Ga0105245_10065451 3300009098 Bacteria 3287
123 Ga0105245_10349850 3300009098 Bacteria 1464
124 Ga0105247_10000062 3300009101 Bacteria 126437
125 Ga0105247_10000518 3300009101 Bacteria 31609
126 Ga0105247_10007939 3300009101 Bacteria 6486
127 Ga0105243_10003563 3300009148 Bacteria 12569
128 Ga0105241_10043871 3300009174 Bacteria 3387
129 Ga0105241_10136097 3300009174 Bacteria 1995
130 Ga0105241_10146015 3300009174 Bacteria 1930
131 Ga0105242_10152542 3300009176 Bacteria 2016
132 Ga0105248_10000036 3300009177 Bacteria 187421
133 Ga0105248_10033028 3300009177 Bacteria 5780
134 Ga0105248_10064703 3300009177 Bacteria 4105
135 Ga0105248_10110415 3300009177 Bacteria 3101
136 Ga0105248_10125053 3300009177 Bacteria 2901
137 Ga0105248_10180004 3300009177 Bacteria 2382
138 Ga0105238_10035700 3300009551 Bacteria 5053
139 Ga0105238_10038107 3300009551 Bacteria 4883
140 Ga0105238_10095055 3300009551 Bacteria 2968
141 Ga0105249_10000787 3300009553 Bacteria 28462
142 Ga0105249_10013732 3300009553 Bacteria 7152
143 Ga0105249_10026184 3300009553 Bacteria 5253
144 Ga0105239_10018530 3300010375 Bacteria 7689
145 Ga0157374_10102965 3300013296 Bacteria 2739
146 Ga0157374_10129358 3300013296 Bacteria 2442
147 Ga0157378_10004246 3300013297 Bacteria 12635
148 Ga0163162_10106780 3300013306 Bacteria 2895
149 Ga0157372_10115183 3300013307 Bacteria 3082
150 Ga0157375_10123169 3300013308 Bacteria 2705
151 Ga0163163_10037357 3300014325 Bacteria 4724
152 Ga0157380_10049167 3300014326 Bacteria 3324
153 Ga0157380_10066729 3300014326 Bacteria 2895
154 Ga0157377_10002906 3300014745 Bacteria 7662
155 Ga0157379_10183095 3300014968 Unclassified 1892
156 Ga0163161_10004695 3300017792 Bacteria 9504
157 Ga0213876_10000157 3300021384 Bacteria 71037
158 Ga0213876_10009647 3300021384 Bacteria 5195
159 Ga0213876_10076208 3300021384 Bacteria 1771
160 Ga0213875_10000334 3300021388 Bacteria 44554
161 Ga0207692_10004427 3300025898 Bacteria 5559
162 Ga0207642_10000167 3300025899 Bacteria 18730
163 Ga0207710_10000060 3300025900 Bacteria 168230
164 Ga0207710_10000283 3300025900 Bacteria 41129
165 Ga0207710_10002694 3300025900 Bacteria 8148
166 Ga0207688_10041200 3300025901 Bacteria 2568
167 Ga0207680_10004800 3300025903 Bacteria 6435
168 Ga0207680_10090095 3300025903 Bacteria 1949
169 Ga0207647_10055022 3300025904 Bacteria 2446
170 Ga0207699_10035752 3300025906 Bacteria 2828
171 Ga0207645_10042468 3300025907 Bacteria 2909
172 Ga0207705_10000009 3300025909 Bacteria 576128
173 Ga0207705_10070056 3300025909 Bacteria 2541
174 Ga0207654_10131737 3300025911 Bacteria 1583
175 Ga0207695_10029591 3300025913 Bacteria 6046
176 Ga0207695_10037267 3300025913 Bacteria 5247
177 Ga0207695_10054930 3300025913 Bacteria 4154
178 Ga0207695_10136505 3300025913 Bacteria 2406
179 Ga0207693_10001382 3300025915 Bacteria 21519
180 Ga0207693_10001847 3300025915 Bacteria 18553
181 Ga0207693_10099350 3300025915 Bacteria 2282
182 Ga0207663_10022431 3300025916 Bacteria 3608
183 Ga0207657_10118806 3300025919 Bacteria 2176
184 Ga0207652_10065936 3300025921 Bacteria 3136
185 Ga0207681_10000582 3300025923 Bacteria 24883
186 Ga0207681_10000847 3300025923 Bacteria 20130
187 Ga0207681_10009280 3300025923 Bacteria 6008
188 Ga0207694_10175997 3300025924 Bacteria 1734
189 Ga0207687_10010049 3300025927 Bacteria 6192
190 Ga0207687_10023533 3300025927 Bacteria 4108
191 Ga0207644_10000018 3300025931 Bacteria 174861
192 Ga0207644_10000048 3300025931 Bacteria 102494
193 Ga0207644_10001709 3300025931 Bacteria 14181
194 Ga0207644_10036393 3300025931 Bacteria 3455
195 Ga0207706_10038146 3300025933 Bacteria 4262
196 Ga0207706_10044341 3300025933 Bacteria 3942
197 Ga0207686_10009509 3300025934 Bacteria 5274
198 Ga0207709_10011511 3300025935 Bacteria 4880
199 Ga0207669_10001483 3300025937 Bacteria 10021
200 Ga0207704_10000782 3300025938 Bacteria 14026
201 Ga0207711_10000202 3300025941 Bacteria 63414
202 Ga0207711_10062227 3300025941 Bacteria 3219
203 Ga0207689_10017827 3300025942 Bacteria 5999
204 Ga0207689_10090028 3300025942 Bacteria 2521
205 Ga0207667_10007904 3300025949 Bacteria 12700
206 Ga0207667_10009309 3300025949 Bacteria 11584
207 Ga0207667_10034318 3300025949 Bacteria 5449
208 Ga0207667_10040357 3300025949 Bacteria 4970
209 Ga0207667_10156695 3300025949 Bacteria 2343
210 Ga0207712_10000607 3300025961 Bacteria 28445
211 Ga0207712_10028012 3300025961 Bacteria 3766
212 Ga0207668_10007970 3300025972 Bacteria 6303
213 Ga0207640_10010697 3300025981 Bacteria 5177
214 Ga0207640_10049478 3300025981 Bacteria 2722
215 Ga0207658_10000409 3300025986 Bacteria 40927
216 Ga0207658_10024807 3300025986 Bacteria 4196
217 Ga0207677_10062423 3300026023 Bacteria 2585
218 Ga0207703_10021014 3300026035 Bacteria 5107
219 Ga0207703_10021617 3300026035 Bacteria 5038
220 Ga0207703_10059011 3300026035 Bacteria 3134
221 Ga0207639_10023395 3300026041 Bacteria 4462
222 Ga0207678_10015861 3300026067 Bacteria 6623
223 Ga0207678_10133970 3300026067 Bacteria 2114
224 Ga0207708_10009966 3300026075 Bacteria 7056
225 Ga0207702_10001630 3300026078 Bacteria 22191
226 Ga0207702_10151991 3300026078 Bacteria 2107
227 Ga0207641_10011611 3300026088 Bacteria 7231
228 Ga0207641_10018107 3300026088 Bacteria 5772
229 Ga0207648_10068065 3300026089 Bacteria 3103
230 Ga0207676_10226234 3300026095 Bacteria 1669
231 Ga0207675_100012797 3300026118 Bacteria 7839
232 Ga0207675_100091227 3300026118 Bacteria 2864
233 Ga0207683_10069816 3300026121 Bacteria 3103
234 Ga0207698_10002327 3300026142 Bacteria 11253
235 Ga0207698_10043715 3300026142 Unclassified 3359
236 Ga0268266_10005943 3300028379 Bacteria 11285
237 Ga0268266_10096251 3300028379 Bacteria 2601
238 Ga0268265_10000822 3300028380 Bacteria 29405
239 Ga0268265_10006611 3300028380 Bacteria 7848
240 Ga0268264_10000108 3300028381 Bacteria 208791
241 Ga0268264_10046702 3300028381 Bacteria 3597
242 Ga0268264_10081853 3300028381 Bacteria 2760
243 Ga0307511_10026980 3300030521 Bacteria 5255
244 Ga0265331_10011802 3300031250 Bacteria 4769
245 Ga0265331_10021207 3300031250 Bacteria 3328
246 Ga0307508_10000103 3300031616 Bacteria 100310
247 Ga0307516_10000121 3300031730 Bacteria 91748
248 Ga0307516_10000539 3300031730 Bacteria 50564
249 Ga0307516_10001545 3300031730 Bacteria 31640
250 Ga0307413_10159392 3300031824 Bacteria 1583
251 Ga0307409_100081580 3300031995 Bacteria 2615
252 Ga0307411_10049054 3300032005 Bacteria 2741
253 Ga0307411_10053369 3300032005 Bacteria 2648
254 Ga0373931_0004305 3300035691 Bacteria 6488
255 Ga0395905_0224161 3300037471 Bacteria 1759
256 Ga0436364_0665239 3300037853 Bacteria 42065
257 Ga0436365_0411865 3300039437 Bacteria 16194
258 Ga0436365_1412119 3300039437 Bacteria 5324
259 Ga0436365_1596622 3300039437 Bacteria 5162
260 Ga0436363_0903407 3300039450 Bacteria 1832
261 Ga0439465_0000964 3300041413 Bacteria 9146
262 Ga0451833_1354800 3300041491 Plasmid 4010
263 Ga0451835_0010834 3300041492 Unclassified 1229
264 Ga0451853_0660160 3300041512 Unclassified 1791
265 Ga0451853_0698899 3300041512 Unclassified 4048
266 Ga0439445_0002628 3300042004 Bacteria 4001
267 Ga0466971_0030183 3300044719 Bacteria 2426
268 Ga0466958_0099243 3300045836 Bacteria 1809
269 Ga0466967_0103467 3300045976 Bacteria 2605
270 Ga0495638_0001442 3300046460 Bacteria 21514
271 Ga0495638_0007163 3300046460 Bacteria 8031
272 Ga0495638_0067513 3300046460 Bacteria 2195
273 Ga0495625_0000078 3300046660 Bacteria 161613
274 Ga0495625_0000776 3300046660 Bacteria 44405
275 Ga0495676_0059195 3300047321 Bacteria 3010
276 Ga0495593_0004118 3300047673 Bacteria 8646
277 Ga0495615_0000406 3300048090 Bacteria 6467
278 Ga0496100_0004989 3300048903 Bacteria 7099
279 Ga0496100_0087139 3300048903 Bacteria 2122
280 Ga0496101_0068630 3300048904 Bacteria 2592
281 Ga0496102_0001066 3300048905 Bacteria 25405
282 Ga0496102_0021952 3300048905 Bacteria 5652
283 Ga0496102_0032106 3300048905 Bacteria 4716
284 Ga0496103_0000435 3300048906 Bacteria 36281
285 Ga0496103_0001226 3300048906 Bacteria 17581
286 Ga0496103_0071952 3300048906 Bacteria 2165
287 Ga0496104_0012148 3300048907 Bacteria 7734
288 Ga0496104_0026232 3300048907 Bacteria 5378
289 Ga0496105_0008705 3300048908 Bacteria 7897
290 Ga0496106_0012656 3300048909 Bacteria 6233
291 Ga0496106_0139010 3300048909 Bacteria 1909
292 Ga0496107_0001641 3300048910 Bacteria 13951
293 Ga0496108_0001147 3300048911 Bacteria 20697
294 Ga0496108_0120996 3300048911 Bacteria 2245
295 Ga0496109_0023012 3300048912 Bacteria 5525
296 Ga0496110_0026476 3300048913 Bacteria 4963
297 Ga0496112_0000478 3300048915 Bacteria 26831
298 Ga0496112_0037199 3300048915 Bacteria 4751
299 Ga0496112_0064177 3300048915 Bacteria 3624
300 Ga0496112_0096977 3300048915 Bacteria 2919
301 Ga0496113_0008452 3300048916 Bacteria 6707
302 Ga0496113_0027382 3300048916 Bacteria 4087
303 Ga0496114_0006251 3300048917 Bacteria 9374
304 Ga0496114_0030184 3300048917 Bacteria 4459
305 Ga0496115_0002673 3300048918 Bacteria 12785
306 Ga0496117_0000430 3300048920 Bacteria 70406
307 Ga0496117_0088899 3300048920 Bacteria 1997
308 Ga0496118_0000165 3300048921 Bacteria 119376
309 Ga0496118_0044379 3300048921 Bacteria 3482
310 Ga0496119_0007337 3300048922 Bacteria 9969
311 Ga0496120_0013079 3300048923 Bacteria 5610
312 Ga0496121_0000069 3300048924 Bacteria 253087
313 Ga0496121_0000747 3300048924 Bacteria 59731
314 Ga0496122_0011278 3300048925 Bacteria 9076
315 Ga0496123_0015082 3300048926 Bacteria 6361
316 Ga0496124_0034792 3300048927 Bacteria 4414
317 Ga0496125_0005185 3300048928 Bacteria 14643
318 Ga0496126_0003255 3300048929 Bacteria 20757
319 Ga0496126_0226875 3300048929 Bacteria 1566
320 Ga0501032_0006334 3300049569 Bacteria 8723
321 Ga0501033_0070305 3300049570 Bacteria 2572
322 Ga0501034_0005259 3300049571 Bacteria 14207
323 Ga0501037_0003402 3300049573 Bacteria 11568
324 Ga0501046_0003379 3300049580 Bacteria 14646
325 Ga0501047_0004498 3300049581 Bacteria 13115
326 Ga0501047_0039600 3300049581 Bacteria 4558
327 Ga0501070_0000669 3300049586 Bacteria 31597
328 Ga0501070_0085886 3300049586 Bacteria 2605
329 Ga0501083_0082357 3300049744 Bacteria 2132
330 Ga0501035_0005600 3300049822 Bacteria 11861
331 Ga0501044_0000053 3300049823 Bacteria 141732
332 Ga0501044_0000128 3300049823 Bacteria 92610
333 Ga0501044_0007007 3300049823 Bacteria 12404
334 nmdc:mga03n38_1446_c1 3300050490 Bacteria 6807
335 nmdc:mga03n38_25978_c1 3300050490 Bacteria 2413
336 nmdc:mga03n38_6471_c1 3300050490 Bacteria 4072
337 nmdc:mga00v17_3944_c1 3300050491 Bacteria 7656
338 nmdc:mga00v17_500_c2 3300050491 Bacteria 10165
339 nmdc:mga0yw44_14018_c1 3300050492 Bacteria 4241
340 nmdc:mga0yw44_38644_c1 3300050492 Bacteria 2825
341 nmdc:mga0k408_29131_c1 3300050493 Bacteria 3141
342 nmdc:mga06z11_68296_c1 3300050494 Bacteria 1873
343 nmdc:mga07m45_1217_c1 3300050496 Bacteria 11669
344 nmdc:mga07m45_12918_c1 3300050496 Bacteria 4418
345 nmdc:mga07m45_1434_c1 3300050496 Bacteria 10928
346 nmdc:mga07m45_1455_c1 3300050496 Bacteria 10863
347 nmdc:mga07m45_21977_c1 3300050496 Bacteria 3480
348 nmdc:mga07m45_48525_c1 3300050496 Bacteria 2388
349 nmdc:mga0sz30_14931_c1 3300050516 Bacteria 2745
350 nmdc:mga0sz30_67497_c1 3300050516 Bacteria 1535
351 Ga0500595_028681 3300053119 Bacteria 1896
352 Ga0500622_0000636 3300053156 Bacteria 31534
353 Ga0500622_0000665 3300053156 Bacteria 30316
354 Ga0500622_0003750 3300053156 Bacteria 9929
355 Ga0500645_021267 3300053730 Bacteria 2004
356 Ga0466962_0020535 3300061719 Bacteria 3173
357 8054302670 8054302542 Bacteria 5698134
358 Ga0436364_0154840
359 JGI24737J22298_10026962
360 JGI24743J22301_10010095
361 JGI24750J21931_1001793
362 JGI24744J21845_10007668
363 JGI24034J26672_10003211
364 Ga0070658_10000161
365 Ga0070676_10036856
366 Ga0068869_100001650
367 Ga0070666_10002481
368 Ga0070666_10069963
369 Ga0070680_100083055
370 Ga0070682_100039981
371 Ga0070682_100094684
372 Ga0068868_100076038
373 Ga0070689_100046399
374 Ga0070691_10018046
375 Ga0070668_100014466
376 Ga0070668_100055852
377 Ga0070669_100000094
378 Ga0070669_100000408
379 Ga0070669_100007928
380 Ga0070671_100000031
381 Ga0070671_100000108
382 Ga0070671_100000208
383 Ga0070671_100122667
384 Ga0070674_100041428
385 Ga0070688_100039454
386 Ga0070667_100000573
387 Ga0070667_100022731
388 Ga0070667_100064132
389 Ga0070703_10008483
390 Ga0070710_10000890
391 Ga0070710_10001239
392 Ga0070701_10017297
393 Ga0070711_100009898
394 Ga0070705_100055668
395 Ga0070663_100127053
396 Ga0070678_100046318
397 Ga0070662_100064024
398 Ga0068867_100002467
399 Ga0070685_10077475
400 Ga0068853_100067493
401 Ga0070686_100008799
402 Ga0070686_100022004
403 Ga0070695_100019390
404 Ga0070696_100006247
405 Ga0070696_100051378
406 Ga0070693_100048392
407 Ga0070665_100002065
408 Ga0070665_100014678
409 Ga0070665_100036009
410 Ga0070665_100140174
411 Ga0070665_100215979
412 Ga0070704_100002000
413 Ga0068855_100000259
414 Ga0068855_100005120
415 Ga0068855_100018242
416 Ga0068855_100021297
417 Ga0068855_100050111
418 Ga0068855_100094352
419 Ga0068854_100000230
420 Ga0068854_100053802
421 Ga0068856_100001269
422 Ga0068856_100163127
423 Ga0068852_100000118
424 Ga0068852_100088411
425 Ga0068852_100212090
426 Ga0068859_100000579
427 Ga0068859_100008383
428 Ga0068859_100016015
429 Ga0068859_100077225
430 Ga0068866_10003501
431 Ga0068861_100002743
432 Ga0068863_100001232
433 Ga0068863_100028228
434 Ga0068858_100000478
435 Ga0068858_100016569
436 Ga0068858_100037188
437 Ga0068858_100087811
438 Ga0068858_100162827
439 Ga0068860_100000732
440 Ga0068860_100037167
441 Ga0068860_100052658
442 Ga0068860_100060990
443 Ga0068860_100109493
444 Ga0068862_100000873
445 Ga0068862_100033285
446 Ga0081455_10009849
447 Ga0081455_10189862
448 Ga0081538_10091353
449 Ga0075365_10000399
450 Ga0075363_100000759
451 Ga0075363_100001931
452 Ga0075363_100006194
453 Ga0075363_100008578
454 Ga0075363_100038356
455 Ga0075364_10002016
456 Ga0075364_10013130
457 Ga0075364_10017705
458 Ga0075364_10033865
459 Ga0070715_10010993
460 Ga0070716_100001818
461 Ga0070716_100017000
462 Ga0070712_100002442
463 Ga0070712_100004291
464 Ga0075369_10001577
465 Ga0075369_10020104
466 Ga0075370_10001922
467 Ga0075370_10006794
468 Ga0075370_10007593
469 Ga0075370_10030602
470 Ga0075370_10038928
471 Ga0097620_100000579
472 Ga0097620_100008383
473 Ga0097620_100016018
474 Ga0097620_100077217
475 Ga0105240_10004237
476 Ga0105240_10017234
477 Ga0105240_10027981
478 Ga0105240_10075394
479 Ga0105245_10065451
480 Ga0105245_10349850
481 Ga0105247_10000062
482 Ga0105247_10000518
483 Ga0105247_10007939
484 Ga0105243_10003563
485 Ga0105241_10043871
486 Ga0105241_10136097
487 Ga0105241_10146015
488 Ga0105242_10152542
489 Ga0105248_10000036
490 Ga0105248_10033028
491 Ga0105248_10064703
492 Ga0105248_10110415
493 Ga0105248_10125053
494 Ga0105248_10180004
495 Ga0105238_10035700
496 Ga0105238_10038107
497 Ga0105238_10095055
498 Ga0105249_10000787
499 Ga0105249_10013732
500 Ga0105249_10026184
501 Ga0105239_10018530
502 Ga0157374_10102965
503 Ga0157374_10129358
504 Ga0157378_10004246
505 Ga0163162_10106780
506 Ga0157372_10115183
507 Ga0157375_10123169
508 Ga0163163_10037357
509 Ga0157380_10049167
510 Ga0157380_10066729
511 Ga0157377_10002906
512 Ga0157379_10183095
513 Ga0163161_10004695
514 Ga0213876_10000157
515 Ga0213876_10009647
516 Ga0213876_10076208
517 Ga0213875_10000334
518 Ga0207692_10004427
519 Ga0207642_10000167
520 Ga0207710_10000060
521 Ga0207710_10000283
522 Ga0207710_10002694
523 Ga0207688_10041200
524 Ga0207680_10004800
525 Ga0207680_10090095
526 Ga0207647_10055022
527 Ga0207699_10035752
528 Ga0207645_10042468
529 Ga0207705_10000009
530 Ga0207705_10070056
531 Ga0207654_10131737
532 Ga0207695_10029591
533 Ga0207695_10037267
534 Ga0207695_10054930
535 Ga0207695_10136505
536 Ga0207693_10001382
537 Ga0207693_10001847
538 Ga0207693_10099350
539 Ga0207663_10022431
540 Ga0207657_10118806
541 Ga0207652_10065936
542 Ga0207681_10000582
543 Ga0207681_10000847
544 Ga0207681_10009280
545 Ga0207694_10175997
546 Ga0207687_10010049
547 Ga0207687_10023533
548 Ga0207644_10000018
549 Ga0207644_10000048
550 Ga0207644_10001709
551 Ga0207644_10036393
552 Ga0207706_10038146
553 Ga0207706_10044341
554 Ga0207686_10009509
555 Ga0207709_10011511
556 Ga0207669_10001483
557 Ga0207704_10000782
558 Ga0207711_10000202
559 Ga0207711_10062227
560 Ga0207689_10017827
561 Ga0207689_10090028
562 Ga0207667_10007904
563 Ga0207667_10009309
564 Ga0207667_10034318
565 Ga0207667_10040357
566 Ga0207667_10156695
567 Ga0207712_10000607
568 Ga0207712_10028012
569 Ga0207668_10007970
570 Ga0207640_10010697
571 Ga0207640_10049478
572 Ga0207658_10000409
573 Ga0207658_10024807
574 Ga0207677_10062423
575 Ga0207703_10021014
576 Ga0207703_10021617
577 Ga0207703_10059011
578 Ga0207639_10023395
579 Ga0207678_10015861
580 Ga0207678_10133970
581 Ga0207708_10009966
582 Ga0207702_10001630
583 Ga0207702_10151991
584 Ga0207641_10011611
585 Ga0207641_10018107
586 Ga0207648_10068065
587 Ga0207676_10226234
588 Ga0207675_100012797
589 Ga0207675_100091227
590 Ga0207683_10069816
591 Ga0207698_10002327
592 Ga0207698_10043715
593 Ga0268266_10005943
594 Ga0268266_10096251
595 Ga0268265_10000822
596 Ga0268265_10006611
597 Ga0268264_10000108
598 Ga0268264_10046702
599 Ga0268264_10081853
600 Ga0307511_10026980
601 Ga0265331_10011802
602 Ga0265331_10021207
603 Ga0307508_10000103
604 Ga0307516_10000121
605 Ga0307516_10000539
606 Ga0307516_10001545
607 Ga0307413_10159392
608 Ga0307409_100081580
609 Ga0307411_10049054
610 Ga0307411_10053369
611 Ga0373931_0004305
612 Ga0395905_0224161
613 Ga0436364_0665239
614 Ga0436365_0411865
615 Ga0436365_1412119
616 Ga0436365_1596622
617 Ga0436363_0903407
618 Ga0439465_0000964
619 Ga0451833_1354800
620 Ga0451835_0010834
621 Ga0451853_0660160
622 Ga0451853_0698899
623 Ga0439445_0002628
624 Ga0466971_0030183
625 Ga0466958_0099243
626 Ga0466967_0103467
627 Ga0495638_0001442
628 Ga0495638_0007163
629 Ga0495638_0067513
630 Ga0495625_0000078
631 Ga0495625_0000776
632 Ga0495676_0059195
633 Ga0495593_0004118
634 Ga0495615_0000406
635 Ga0496100_0004989
636 Ga0496100_0087139
637 Ga0496101_0068630
638 Ga0496102_0001066
639 Ga0496102_0021952
640 Ga0496102_0032106
641 Ga0496103_0000435
642 Ga0496103_0001226
643 Ga0496103_0071952
644 Ga0496104_0012148
645 Ga0496104_0026232
646 Ga0496105_0008705
647 Ga0496106_0012656
648 Ga0496106_0139010
649 Ga0496107_0001641
650 Ga0496108_0001147
651 Ga0496108_0120996
652 Ga0496109_0023012
653 Ga0496110_0026476
654 Ga0496112_0000478
655 Ga0496112_0037199
656 Ga0496112_0064177
657 Ga0496112_0096977
658 Ga0496113_0008452
659 Ga0496113_0027382
660 Ga0496114_0006251
661 Ga0496114_0030184
662 Ga0496115_0002673
663 Ga0496117_0000430
664 Ga0496117_0088899
665 Ga0496118_0000165
666 Ga0496118_0044379
667 Ga0496119_0007337
668 Ga0496120_0013079
669 Ga0496121_0000069
670 Ga0496121_0000747
671 Ga0496122_0011278
672 Ga0496123_0015082
673 Ga0496124_0034792
674 Ga0496125_0005185
675 Ga0496126_0003255
676 Ga0496126_0226875
677 Ga0501032_0006334
678 Ga0501033_0070305
679 Ga0501034_0005259
680 Ga0501037_0003402
681 Ga0501046_0003379
682 Ga0501047_0004498
683 Ga0501047_0039600
684 Ga0501070_0000669
685 Ga0501070_0085886
686 Ga0501083_0082357
687 Ga0501035_0005600
688 Ga0501044_0000053
689 Ga0501044_0000128
690 Ga0501044_0007007
691 nmdc:mga03n38_1446_c1
692 nmdc:mga03n38_25978_c1
693 nmdc:mga03n38_6471_c1
694 nmdc:mga00v17_3944_c1
695 nmdc:mga00v17_500_c2
696 nmdc:mga0yw44_14018_c1
697 nmdc:mga0yw44_38644_c1
698 nmdc:mga0k408_29131_c1
699 nmdc:mga06z11_68296_c1
700 nmdc:mga07m45_1217_c1
701 nmdc:mga07m45_12918_c1
702 nmdc:mga07m45_1434_c1
703 nmdc:mga07m45_1455_c1
704 nmdc:mga07m45_21977_c1
705 nmdc:mga07m45_48525_c1
706 nmdc:mga0sz30_14931_c1
707 nmdc:mga0sz30_67497_c1
708 Ga0500595_028681
709 Ga0500622_0000636
710 Ga0500622_0000665
711 Ga0500622_0003750
712 Ga0500645_021267
713 Ga0466962_0020535
714 8054302670

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

96

180

0.92

PF00848

Ring_hydroxyl_A

Ring hydroxylating alpha subunit (catalytic domain)

232

502

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6y8j-assembly1.cif.gz_A-3 crystal structure of the apo form of a quaternary ammonium rieske monooxygenase cnta 0.7769 9 404
6y8j-assembly1.cif.gz_A-3 crystal structure of the apo form of a quaternary ammonium rieske monooxygenase cnta 0.7706 9 404
4emj-assembly1.cif.gz_B complex between the reductase and ferredoxin components of toluene dioxygenase 0.766 46 164
1vm9-assembly1.cif.gz_A the x-ray structure of the cys84ala cys85ala double mutant of the [2fe-2s] ferredoxin subunit of toluene-4-monooxygenase from pseudomonas mendocina kr1 0.7613 46 164
4p1b-assembly1.cif.gz_I crystal structure of the toluene 4-monooxygenase hydroxylase-ferredoxin c7s e16c c84a c85a variant electron-transfer complex 0.7606 46 164
ID Description Score Start End Superfamily
af_P0ABR7_49_169_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9307 50 167 2.102.10.10
af_A0A1D6LNR1_82_208_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9171 45 165 2.102.10.10
3n0qA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.91 45 165 2.102.10.10
2b1xA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9072 46 167 2.102.10.10
2xrxU02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.898 46 166 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A4Q3WTX5-F1-model_v4 deleted 0.9667 24 102
AF-A0A2E6F8Q7-F1-model_v4 Iron-sulfur protein 0.9526 23 170 GO:0016491
GO:0046872
GO:0051537
AF-X8E3Q5-F1-model_v4 Rieske domain protein 0.95 19 136 GO:0016491
GO:0046872
GO:0051537
AF-A0A7X3Q3Q1-F1-model_v4 Aromatic ring-hydroxylating dioxygenase subunit alpha 0.9496 24 218 GO:0005506
GO:0051213
GO:0051537
AF-A0A383AFX7-F1-model_v4 Rieske domain-containing protein 0.949 32 217 GO:0005506
GO:0016491
GO:0051537

Map