F421591

General Info

Members Datasets Scaffolds Average Seq Length
359 249 718 357

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0009419|Ga0395900_0009419_7154_8308
Length 384
Sequence VRAFSFSGKMERMTSRPAPEQHPNDIRDFNDGGTRLHGEYKVPGGKLVVVDLDVRDGRLANVSLSGDFFLEPDEALQDINAALAGLPVTTPAADITAAVSAGLPPGSVLFGFSAEAVAVTVRRALSKATGWSDHQWEVIPPSVLPTHINVALDEVLTEAVGAGRRNPTLRFWDWEEPSVVIGSFQSVRNEVDPEGVSRHGITVVRRISGGGAMFMEAGNCITYSLYVPQTLVDGISFADSYAFLDAWVMAALEKLGITAFYVPLNDIATDQGKIGGAAQKRLANGGMLHHVTMSYDIDADKMVDVLRIGKEKLSDKGTRSAKKRVDPLRRQTGLARAAIIEAMQEVFMERYGAVESRLTDDELSEARKRVETKFGTEEWLNRVP

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
48 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
86 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
87 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
88 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
89 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
90 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
91 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
92 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
93 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
94 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
95 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
96 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
97 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
98 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
99 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
100 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
101 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
102 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
143 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
144 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
166 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
167 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
168 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
171 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
172 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
173 2643221711 Terrabacter sp. Root85 Isolate Unclassified
174 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
175 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
176 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
177 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
178 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
179 2739367653 Kocuria sp. OV113 Isolate Unclassified
180 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
181 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
182 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
183 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
184 2773857759 Microbacterium sp. 1294 Isolate Unclassified
185 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
186 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
187 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
188 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
189 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
190 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
191 2808606394 Promicromonospora sp. C35 Isolate Unclassified
192 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
193 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
194 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
195 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
196 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
197 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
198 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
199 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
200 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
201 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
202 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
203 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
204 2854911287 Brucella lupini LUP21 Isolate Unclassified
205 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
206 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
207 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
208 2857727296 Kocuria sp. R-72562 Isolate Unclassified
209 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
210 2867475112 Streptomyces sp. TM32 Isolate Unclassified
211 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
212 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
213 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
214 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
215 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
216 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
217 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
218 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
219 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
220 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
221 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
222 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
223 2920879853 Kocuria salina CV6 Isolate Unclassified
224 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
225 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
226 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
227 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
228 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
229 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
230 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
231 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
232 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
233 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
234 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
235 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
236 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
237 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
238 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
239 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
240 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
241 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
242 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
243 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
244 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
245 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
246 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
247 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
248 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
249 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.44
Metatranscriptomes 0.28
Isolates 22.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.18
Nodule 0
Rhizoplane 8.36
Rhizosphere 71.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0009419 3300037418 Bacteria 10013
2 LJQas_1000733 3300000549 Bacteria 5223
3 LJQas_1002578 3300000549 Bacteria 2504
4 JGI25152J39213_1000140 3300002773 Bacteria 49435
5 Ga0007423J48922_100219 3300003285 Bacteria 12900
6 Ga0065714_10011815 3300005288 Bacteria 2486
7 Ga0070658_10006384 3300005327 Bacteria 9553
8 Ga0070658_10019320 3300005327 Bacteria 5457
9 Ga0070658_10271625 3300005327 Bacteria 1442
10 Ga0070666_10034109 3300005335 Bacteria 3373
11 Ga0070682_100060015 3300005337 Bacteria 2404
12 Ga0068868_100045629 3300005338 Bacteria 3429
13 Ga0070661_100013668 3300005344 Bacteria 5701
14 Ga0070671_100331718 3300005355 Bacteria 1297
15 Ga0070688_100026752 3300005365 Bacteria 3430
16 Ga0070659_100005151 3300005366 Bacteria 9374
17 Ga0070667_100006813 3300005367 Bacteria 9490
18 Ga0068853_100011363 3300005539 Bacteria 7231
19 Ga0070672_100010357 3300005543 Bacteria 6465
20 Ga0070672_100039078 3300005543 Bacteria 3632
21 Ga0068855_100200091 3300005563 Bacteria 2249
22 Ga0068857_100068570 3300005577 Bacteria 3157
23 Ga0068857_100288453 3300005577 Bacteria 1511
24 Ga0068856_100015783 3300005614 Bacteria 7304
25 Ga0068856_100029210 3300005614 Bacteria 5386
26 Ga0068856_100113908 3300005614 Bacteria 2703
27 Ga0068852_100180680 3300005616 Bacteria 1984
28 Ga0068859_100016720 3300005617 Bacteria 7365
29 Ga0068851_10000033 3300005834 Bacteria 108511
30 Ga0068858_100000422 3300005842 Bacteria 44076
31 Ga0081455_10068810 3300005937 Bacteria 2946
32 Ga0075363_100003933 3300006048 Bacteria 6412
33 Ga0097620_100016720 3300006931 Bacteria 7365
34 Ga0105251_10067245 3300009011 Bacteria 1674
35 Ga0105244_10008879 3300009036 Bacteria 6232
36 Ga0105244_10013257 3300009036 Bacteria 4827
37 Ga0105240_10004370 3300009093 Bacteria 21580
38 Ga0105240_10078806 3300009093 Bacteria 4056
39 Ga0105240_10165520 3300009093 Bacteria 2623
40 Ga0105240_10588984 3300009093 Bacteria 1226
41 Ga0105245_10014788 3300009098 Bacteria 6796
42 Ga0105245_10040044 3300009098 Bacteria 4173
43 Ga0105243_10068770 3300009148 Bacteria 2855
44 Ga0105241_10004955 3300009174 Bacteria 9821
45 Ga0105248_10018363 3300009177 Bacteria 7726
46 Ga0105248_10208244 3300009177 Bacteria 2203
47 Ga0105237_10000673 3300009545 Bacteria 47236
48 Ga0105237_10028936 3300009545 Bacteria 5637
49 Ga0105238_10001056 3300009551 Bacteria 27824
50 Ga0105239_10250203 3300010375 Bacteria 1990
51 Ga0105246_10015331 3300011119 Bacteria 4839
52 Ga0105246_10049637 3300011119 Bacteria 2874
53 Ga0157370_10010018 3300013104 Bacteria 10025
54 Ga0157370_10135458 3300013104 Bacteria 2296
55 Ga0157369_10136217 3300013105 Bacteria 2600
56 Ga0157374_10198480 3300013296 Bacteria 1964
57 Ga0163162_10061886 3300013306 Bacteria 3782
58 Ga0157372_10032398 3300013307 Bacteria 5731
59 Ga0157375_10519898 3300013308 Bacteria 1353
60 Ga0163163_10028524 3300014325 Bacteria 5361
61 Ga0207425_1009535 3300025245 Bacteria 2408
62 Ga0209148_1000601 3300025254 Bacteria 32421
63 Ga0209148_1001847 3300025254 Bacteria 8875
64 Ga0209148_1011106 3300025254 Bacteria 1683
65 Ga0209129_1000067 3300025258 Bacteria 219974
66 Ga0209025_1001395 3300025294 Bacteria 32161
67 Ga0209051_1013158 3300025303 Bacteria 3954
68 Ga0207656_10000001 3300025321 Bacteria 1323684
69 Ga0207655_1001875 3300025728 Bacteria 18097
70 Ga0207655_1019441 3300025728 Bacteria 3549
71 Ga0207680_10029690 3300025903 Bacteria 3075
72 Ga0207705_10004145 3300025909 Bacteria 10996
73 Ga0207654_10000001 3300025911 Bacteria 1816198
74 Ga0207695_10002392 3300025913 Bacteria 27815
75 Ga0207695_10005943 3300025913 Bacteria 15976
76 Ga0207695_10115973 3300025913 Bacteria 2652
77 Ga0207671_10000001 3300025914 Bacteria 1318881
78 Ga0207694_10000019 3300025924 Bacteria 312382
79 Ga0207694_10065853 3300025924 Bacteria 2825
80 Ga0207687_10094493 3300025927 Bacteria 2188
81 Ga0207644_10201376 3300025931 Bacteria 1571
82 Ga0207690_10003657 3300025932 Bacteria 9160
83 Ga0207669_10172277 3300025937 Bacteria 1542
84 Ga0207691_10011415 3300025940 Bacteria 8524
85 Ga0207691_10012885 3300025940 Bacteria 8006
86 Ga0207711_10011046 3300025941 Bacteria 7505
87 Ga0207667_10011845 3300025949 Bacteria 10101
88 Ga0207667_10020267 3300025949 Bacteria 7401
89 Ga0207677_10017245 3300026023 Bacteria 4299
90 Ga0207703_10000369 3300026035 Bacteria 48026
91 Ga0207639_10016247 3300026041 Bacteria 5262
92 Ga0207702_10242231 3300026078 Bacteria 1690
93 Ga0207702_10259271 3300026078 Bacteria 1636
94 Ga0207674_10126684 3300026116 Bacteria 2519
95 Ga0207683_10006321 3300026121 Bacteria 10147
96 Ga0207698_10005420 3300026142 Bacteria 7885
97 Ga0316177_1168697 3300030731 Bacteria 2546
98 Ga0307408_100012179 3300031548 Bacteria 5692
99 Ga0307408_100019147 3300031548 Bacteria 4606
100 Ga0307408_100110509 3300031548 Bacteria 2111
101 Ga0307408_100140475 3300031548 Bacteria 1895
102 Ga0307408_100175808 3300031548 Bacteria 1713
103 Ga0307408_100181898 3300031548 Bacteria 1686
104 Ga0307408_100295092 3300031548 Bacteria 1355
105 Ga0307405_10037197 3300031731 Bacteria 2923
106 Ga0307405_10059331 3300031731 Bacteria 2411
107 Ga0307405_10074259 3300031731 Bacteria 2198
108 Ga0307405_10109812 3300031731 Bacteria 1866
109 Ga0307405_10219836 3300031731 Bacteria 1393
110 Ga0307405_10270767 3300031731 Bacteria 1273
111 Ga0307413_10074021 3300031824 Bacteria 2155
112 Ga0307413_10135374 3300031824 Bacteria 1693
113 Ga0307413_10149060 3300031824 Bacteria 1628
114 Ga0307410_10004373 3300031852 Bacteria 7293
115 Ga0307410_10066168 3300031852 Bacteria 2488
116 Ga0307410_10067674 3300031852 Bacteria 2464
117 Ga0307410_10089082 3300031852 Bacteria 2186
118 Ga0307410_10207740 3300031852 Bacteria 1499
119 Ga0307412_10076268 3300031911 Bacteria 2302
120 Ga0307412_10077622 3300031911 Bacteria 2285
121 Ga0307412_10137289 3300031911 Bacteria 1785
122 Ga0307412_10184970 3300031911 Bacteria 1570
123 Ga0307409_100052391 3300031995 Bacteria 3128
124 Ga0307409_100097325 3300031995 Bacteria 2430
125 Ga0307409_100206346 3300031995 Bacteria 1762
126 Ga0307409_100357507 3300031995 Bacteria 1380
127 Ga0307416_100044124 3300032002 Bacteria 3497
128 Ga0307416_100302564 3300032002 Bacteria 1590
129 Ga0307414_10016009 3300032004 Bacteria 4546
130 Ga0307414_10063636 3300032004 Bacteria 2623
131 Ga0307415_100008027 3300032126 Bacteria 5824
132 Ga0395899_0014179 3300037312 Bacteria 6081
133 Ga0395900_0009548 3300037418 Bacteria 9948
134 Ga0395898_0029569 3300037466 Bacteria 5487
135 Ga0395898_0073963 3300037466 Bacteria 3292
136 Ga0395898_0087399 3300037466 Bacteria 3003
137 Ga0395898_0387123 3300037466 Bacteria 1333
138 Ga0395901_0030809 3300038443 Bacteria 5527
139 Ga0395901_0164673 3300038443 Bacteria 2328
140 Ga0395901_0171533 3300038443 Bacteria 2276
141 Ga0439436_0013961 3300041404 Bacteria 2427
142 Ga0439436_0021553 3300041404 Bacteria 1914
143 Ga0439436_0031517 3300041404 Bacteria 1539
144 Ga0439438_009001 3300041405 Bacteria 3261
145 Ga0439438_010839 3300041405 Bacteria 2864
146 Ga0439439_0016973 3300041406 Bacteria 1786
147 Ga0439466_0002878 3300041411 Bacteria 6733
148 Ga0439466_0024390 3300041411 Bacteria 2120
149 Ga0451791_1833203 3300041451 Bacteria 1561
150 Ga0451837_1489563 3300041494 Bacteria 1093
151 Ga0439433_0000451 3300041999 Bacteria 7557
152 Ga0439433_0004475 3300041999 Bacteria 3009
153 Ga0439433_0010426 3300041999 Bacteria 2029
154 Ga0439433_0024713 3300041999 Bacteria 1354
155 Ga0439442_000013 3300042002 Bacteria 48856
156 Ga0439442_002018 3300042002 Bacteria 3990
157 Ga0439442_006560 3300042002 Bacteria 2338
158 Ga0439432_003986 3300042006 Bacteria 5424
159 Ga0439449_0000523 3300042007 Bacteria 14301
160 Ga0439449_0012352 3300042007 Bacteria 3210
161 Ga0439449_0013736 3300042007 Bacteria 3047
162 Ga0439449_0060583 3300042007 Bacteria 1397
163 Ga0439452_004244 3300042010 Bacteria 4849
164 Ga0439462_0000144 3300042015 Bacteria 11554
165 Ga0450920_000844 3300042122 Bacteria 4966
166 Ga0450907_000198 3300042146 Bacteria 21876
167 Ga0439446_0022100 3300042156 Bacteria 1802
168 Ga0450909_007992 3300042185 Bacteria 1535
169 Ga0439434_0000843 3300042435 Bacteria 8833
170 Ga0439434_0003209 3300042435 Bacteria 4803
171 Ga0439434_0038106 3300042435 Bacteria 1473
172 Ga0450918_001430 3300042531 Bacteria 4743
173 Ga0466965_0177601 3300044683 Bacteria 1122
174 Ga0495627_016682 3300046453 Bacteria 2511
175 Ga0495629_0190420 3300046459 Bacteria 1420
176 Ga0495582_0112139 3300046473 Bacteria 1532
177 Ga0495594_0081936 3300046499 Bacteria 1802
178 Ga0495631_0043429 3300046518 Bacteria 1983
179 Ga0495665_0000709 3300046531 Bacteria 17165
180 Ga0495665_0032923 3300046531 Bacteria 2773
181 Ga0495586_0012152 3300046535 Bacteria 4572
182 Ga0495586_0023644 3300046535 Bacteria 3282
183 Ga0495587_0015910 3300046536 Bacteria 4685
184 Ga0495645_0014511 3300046543 Bacteria 5592
185 Ga0495633_0108400 3300046558 Bacteria 1288
186 Ga0495667_0037462 3300046559 Bacteria 3231
187 Ga0495656_0006273 3300046615 Bacteria 4164
188 Ga0495635_0120613 3300046663 Bacteria 1789
189 Ga0495588_0011912 3300046674 Bacteria 4095
190 Ga0495588_0014119 3300046674 Bacteria 3818
191 Ga0495588_0062486 3300046674 Bacteria 1930
192 Ga0495623_0012733 3300046679 Bacteria 5447
193 Ga0495600_0149392 3300046809 Bacteria 1514
194 Ga0495600_0214129 3300046809 Bacteria 1234
195 Ga0495581_0006935 3300047315 Bacteria 6562
196 Ga0495581_0008284 3300047315 Bacteria 6027
197 Ga0495636_0007372 3300047318 Bacteria 4329
198 Ga0495680_0071331 3300047322 Bacteria 2645
199 Ga0495675_0006002 3300047444 Bacteria 7427
200 Ga0495681_0087125 3300047470 Bacteria 1385
201 Ga0496100_0023307 3300048903 Bacteria 3759
202 Ga0496100_0089657 3300048903 Bacteria 2095
203 Ga0496101_0066719 3300048904 Bacteria 2625
204 Ga0496102_0011567 3300048905 Bacteria 7614
205 Ga0496102_0027685 3300048905 Bacteria 5061
206 Ga0496102_0194204 3300048905 Bacteria 1913
207 Ga0496103_0001896 3300048906 Bacteria 13603
208 Ga0496103_0023406 3300048906 Bacteria 3724
209 Ga0496103_0035454 3300048906 Bacteria 3054
210 Ga0496104_0021287 3300048907 Bacteria 5951
211 Ga0496105_0002638 3300048908 Bacteria 13053
212 Ga0496106_0053689 3300048909 Bacteria 3044
213 Ga0496107_0014731 3300048910 Bacteria 5475
214 Ga0496107_0115767 3300048910 Bacteria 1973
215 Ga0496110_0020958 3300048913 Bacteria 5523
216 Ga0496110_0174050 3300048913 Bacteria 1953
217 Ga0496110_0269402 3300048913 Bacteria 1550
218 Ga0496111_0049325 3300048914 Bacteria 3035
219 Ga0496111_0049803 3300048914 Bacteria 3020
220 Ga0496111_0258929 3300048914 Bacteria 1291
221 Ga0496112_0004018 3300048915 Bacteria 12333
222 Ga0496112_0035727 3300048915 Bacteria 4844
223 Ga0496113_0060935 3300048916 Bacteria 2846
224 Ga0496113_0217647 3300048916 Bacteria 1522
225 Ga0496114_0006293 3300048917 Bacteria 9345
226 Ga0496114_0121360 3300048917 Bacteria 2248
227 Ga0496114_0153464 3300048917 Bacteria 1998
228 Ga0496114_0334217 3300048917 Bacteria 1339
229 Ga0496115_0122363 3300048918 Bacteria 2142
230 Ga0496117_0059829 3300048920 Bacteria 2628
231 Ga0496118_0072721 3300048921 Bacteria 2467
232 Ga0496119_0001055 3300048922 Bacteria 35142
233 Ga0496120_0000600 3300048923 Bacteria 54546
234 Ga0496120_0012672 3300048923 Bacteria 5721
235 Ga0496120_0033030 3300048923 Bacteria 3113
236 Ga0496122_0000646 3300048925 Bacteria 70740
237 Ga0496122_0000891 3300048925 Bacteria 55619
238 Ga0496123_0000405 3300048926 Bacteria 79019
239 Ga0496124_0001934 3300048927 Bacteria 28387
240 Ga0496124_0054776 3300048927 Bacteria 3374
241 Ga0496124_0101066 3300048927 Bacteria 2337
242 Ga0496125_0000075 3300048928 Bacteria 234414
243 Ga0496125_0000977 3300048928 Bacteria 44759
244 Ga0501031_0029379 3300049568 Bacteria 3585
245 Ga0501032_0000496 3300049569 Bacteria 31802
246 Ga0501032_0007013 3300049569 Bacteria 8263
247 Ga0501033_0011300 3300049570 Bacteria 6836
248 Ga0501033_0020778 3300049570 Bacteria 4960
249 Ga0501034_0000016 3300049571 Bacteria 289751
250 Ga0501034_0003774 3300049571 Bacteria 17102
251 Ga0501034_0054155 3300049571 Bacteria 4038
252 Ga0501036_0021835 3300049572 Bacteria 5381
253 Ga0501036_0102975 3300049572 Bacteria 2415
254 Ga0501036_0182364 3300049572 Bacteria 1767
255 Ga0501037_0024395 3300049573 Bacteria 4473
256 Ga0501037_0046321 3300049573 Bacteria 3190
257 Ga0501037_0092770 3300049573 Bacteria 2184
258 Ga0501038_0008669 3300049574 Bacteria 9337
259 Ga0501038_0014390 3300049574 Bacteria 7209
260 Ga0501038_0205550 3300049574 Bacteria 1578
261 Ga0501039_0035557 3300049575 Bacteria 3844
262 Ga0501043_0006609 3300049579 Bacteria 9286
263 Ga0501043_0049667 3300049579 Bacteria 3298
264 Ga0501048_0025992 3300049582 Bacteria 4264
265 Ga0501048_0038342 3300049582 Bacteria 3438
266 Ga0501068_0096893 3300049584 Bacteria 1825
267 Ga0501073_0023470 3300049589 Bacteria 4428
268 Ga0501074_0019095 3300049590 Bacteria 4977
269 Ga0501080_0117835 3300049742 Bacteria 2461
270 Ga0501035_0015180 3300049822 Bacteria 7110
271 Ga0501035_0048501 3300049822 Bacteria 3808
272 Ga0501044_0037506 3300049823 Bacteria 5066
273 nmdc:mga03n38_18286_c1 3300050490 Bacteria 2764
274 nmdc:mga07m45_5934_c1 3300050496 Bacteria 6130
275 Ga0500635_0003755 3300053080 Bacteria 3845
276 Ga0500651_0006616 3300053093 Bacteria 6700
277 Ga0500590_016521 3300053148 Bacteria 3815
278 Ga0500620_000164 3300053155 Bacteria 13303
279 Ga0501082_0008676 3300060353 Bacteria 8765
280 2515856957 2515154155 Bacteria 7985436
281 2644506706 2643221690 Bacteria 4654705
282 2644527699 2643221694 Bacteria 4392972
283 2644611102 2643221711 Bacteria 4865335
284 2644670680 2643221722 Bacteria 4247614
285 2691513867 2690315906 Bacteria 4517044
286 2738696624 2738541272 Bacteria 6848551
287 2738891321 2738541308 Bacteria 7020677
288 2739324354 2738543027 Bacteria 6409078
289 2739602343 2739367653 Bacteria 2780952
290 2739606717 2739367654 Bacteria 6049412
291 2747952577 2747842429 Bacteria 3914386
292 2760306463 2758568522 Bacteria 5953541
293 2760625073 2758568621 Bacteria 5967089
294 2774382051 2773857759 Bacteria 2963774
295 2775656904 2775506735 Bacteria 4556596
296 2808831133 2808606357 Bacteria 4466944
297 2808852397 2808606360 Bacteria 4404006
298 2808879311 2808606366 Bacteria 4415912
299 2808891188 2808606370 Bacteria 4942454
300 2808896443 2808606371 Bacteria 4251511
301 2809029941 2808606394 Bacteria 6248540
302 2810363757 2808606700 Bacteria 3482157
303 2812321169 2811994871 Bacteria 4497550
304 2812362115 2811994880 Bacteria 4147780
305 2812375078 2811994882 Bacteria 4688362
306 2817509155 2816332305 Bacteria 2697803
307 2819427828 2818991318 Bacteria 5266538
308 2819666698 2818991458 Bacteria 4794049
309 2819691833 2818991462 Bacteria 4320267
310 2819729390 2818991469 Bacteria 4644110
311 2835189297 2835188231 Bacteria 3476928
312 2842776702 2842775625 Bacteria 5587290
313 2844852732 2844849076 Bacteria 4091819
314 2854911898 2854911287 Bacteria 5582813
315 2857479352 2857479173 Bacteria 2469263
316 2857634522 2857632687 Bacteria 2448521
317 2857712482 2857710386 Bacteria 3186771
318 2857729722 2857727296 Bacteria 2745552
319 2857742112 2857740372 Bacteria 4782044
320 2867476382 2867475112 Bacteria 6909112
321 2870802486 2870801768 Bacteria 2710986
322 2870804558 2870804320 Bacteria 2552467
323 2884994647 2884994152 Bacteria 4492978
324 2893685018 2893684298 Bacteria 2897960
325 2904498223 2904497146 Bacteria 4731781
326 2904777584 2904776348 Bacteria 4658726
327 2905930883 2905926851 Bacteria 4423176
328 2910812653 2910809715 Bacteria 4982797
329 2919034955 2919034639 Bacteria 4763403
330 2919059778 2919059106 Bacteria 4991624
331 2919394757 2919391150 Bacteria 4884741
332 2919540415 2919538618 Bacteria 4677069
333 2920882631 2920879853 Bacteria 4216831
334 2932428269 2932426870 Bacteria 4547726
335 2933421108 2933418574 Bacteria 4476724
336 2939601307 2939598168 Bacteria 4687164
337 2939648674 2939647034 Bacteria 4681660
338 2939675274 2939674588 Bacteria 4844420
339 2945918924 2945916053 Bacteria 4555517
340 2945920708 2945920336 Bacteria 4501603
341 2945943106 2945941187 Bacteria 4682474
342 2945959155 2945956166 Bacteria 5110334
343 2946004428 2946003308 Bacteria 3857229
344 2946025895 2946024296 Bacteria 3508095
345 2946038999 2946037020 Bacteria 4900426
346 2946062781 2946059875 Bacteria 4386623
347 2954000405 2953998280 Bacteria 4812144
348 2974306910 2974302888 Bacteria 4369871
349 2997457453 2997451912 Bacteria 8492419
350 8002813380 8002811521 Bacteria 2942897
351 8004022739 8004021418 Bacteria 4313954
352 8004029415 8004025490 Bacteria 4327753
353 8025479405 8025478263 Bacteria 8209203
354 8048135788 8048127548 Bacteria 11053136
355 8054107866 8054107350 Bacteria 5022511
356 8054161872 8054160619 Bacteria 7783213
357 8056066264 8056060235 Bacteria 7259403
358 8056448901 8056447290 Bacteria 7680491
359 8056667250 8056667051 Bacteria 6953971
360 Ga0395900_0009419
361 LJQas_1000733
362 LJQas_1002578
363 JGI25152J39213_1000140
364 Ga0007423J48922_100219
365 Ga0065714_10011815
366 Ga0070658_10006384
367 Ga0070658_10019320
368 Ga0070658_10271625
369 Ga0070666_10034109
370 Ga0070682_100060015
371 Ga0068868_100045629
372 Ga0070661_100013668
373 Ga0070671_100331718
374 Ga0070688_100026752
375 Ga0070659_100005151
376 Ga0070667_100006813
377 Ga0068853_100011363
378 Ga0070672_100010357
379 Ga0070672_100039078
380 Ga0068855_100200091
381 Ga0068857_100068570
382 Ga0068857_100288453
383 Ga0068856_100015783
384 Ga0068856_100029210
385 Ga0068856_100113908
386 Ga0068852_100180680
387 Ga0068859_100016720
388 Ga0068851_10000033
389 Ga0068858_100000422
390 Ga0081455_10068810
391 Ga0075363_100003933
392 Ga0097620_100016720
393 Ga0105251_10067245
394 Ga0105244_10008879
395 Ga0105244_10013257
396 Ga0105240_10004370
397 Ga0105240_10078806
398 Ga0105240_10165520
399 Ga0105240_10588984
400 Ga0105245_10014788
401 Ga0105245_10040044
402 Ga0105243_10068770
403 Ga0105241_10004955
404 Ga0105248_10018363
405 Ga0105248_10208244
406 Ga0105237_10000673
407 Ga0105237_10028936
408 Ga0105238_10001056
409 Ga0105239_10250203
410 Ga0105246_10015331
411 Ga0105246_10049637
412 Ga0157370_10010018
413 Ga0157370_10135458
414 Ga0157369_10136217
415 Ga0157374_10198480
416 Ga0163162_10061886
417 Ga0157372_10032398
418 Ga0157375_10519898
419 Ga0163163_10028524
420 Ga0207425_1009535
421 Ga0209148_1000601
422 Ga0209148_1001847
423 Ga0209148_1011106
424 Ga0209129_1000067
425 Ga0209025_1001395
426 Ga0209051_1013158
427 Ga0207656_10000001
428 Ga0207655_1001875
429 Ga0207655_1019441
430 Ga0207680_10029690
431 Ga0207705_10004145
432 Ga0207654_10000001
433 Ga0207695_10002392
434 Ga0207695_10005943
435 Ga0207695_10115973
436 Ga0207671_10000001
437 Ga0207694_10000019
438 Ga0207694_10065853
439 Ga0207687_10094493
440 Ga0207644_10201376
441 Ga0207690_10003657
442 Ga0207669_10172277
443 Ga0207691_10011415
444 Ga0207691_10012885
445 Ga0207711_10011046
446 Ga0207667_10011845
447 Ga0207667_10020267
448 Ga0207677_10017245
449 Ga0207703_10000369
450 Ga0207639_10016247
451 Ga0207702_10242231
452 Ga0207702_10259271
453 Ga0207674_10126684
454 Ga0207683_10006321
455 Ga0207698_10005420
456 Ga0316177_1168697
457 Ga0307408_100012179
458 Ga0307408_100019147
459 Ga0307408_100110509
460 Ga0307408_100140475
461 Ga0307408_100175808
462 Ga0307408_100181898
463 Ga0307408_100295092
464 Ga0307405_10037197
465 Ga0307405_10059331
466 Ga0307405_10074259
467 Ga0307405_10109812
468 Ga0307405_10219836
469 Ga0307405_10270767
470 Ga0307413_10074021
471 Ga0307413_10135374
472 Ga0307413_10149060
473 Ga0307410_10004373
474 Ga0307410_10066168
475 Ga0307410_10067674
476 Ga0307410_10089082
477 Ga0307410_10207740
478 Ga0307412_10076268
479 Ga0307412_10077622
480 Ga0307412_10137289
481 Ga0307412_10184970
482 Ga0307409_100052391
483 Ga0307409_100097325
484 Ga0307409_100206346
485 Ga0307409_100357507
486 Ga0307416_100044124
487 Ga0307416_100302564
488 Ga0307414_10016009
489 Ga0307414_10063636
490 Ga0307415_100008027
491 Ga0395899_0014179
492 Ga0395900_0009548
493 Ga0395898_0029569
494 Ga0395898_0073963
495 Ga0395898_0087399
496 Ga0395898_0387123
497 Ga0395901_0030809
498 Ga0395901_0164673
499 Ga0395901_0171533
500 Ga0439436_0013961
501 Ga0439436_0021553
502 Ga0439436_0031517
503 Ga0439438_009001
504 Ga0439438_010839
505 Ga0439439_0016973
506 Ga0439466_0002878
507 Ga0439466_0024390
508 Ga0451791_1833203
509 Ga0451837_1489563
510 Ga0439433_0000451
511 Ga0439433_0004475
512 Ga0439433_0010426
513 Ga0439433_0024713
514 Ga0439442_000013
515 Ga0439442_002018
516 Ga0439442_006560
517 Ga0439432_003986
518 Ga0439449_0000523
519 Ga0439449_0012352
520 Ga0439449_0013736
521 Ga0439449_0060583
522 Ga0439452_004244
523 Ga0439462_0000144
524 Ga0450920_000844
525 Ga0450907_000198
526 Ga0439446_0022100
527 Ga0450909_007992
528 Ga0439434_0000843
529 Ga0439434_0003209
530 Ga0439434_0038106
531 Ga0450918_001430
532 Ga0466965_0177601
533 Ga0495627_016682
534 Ga0495629_0190420
535 Ga0495582_0112139
536 Ga0495594_0081936
537 Ga0495631_0043429
538 Ga0495665_0000709
539 Ga0495665_0032923
540 Ga0495586_0012152
541 Ga0495586_0023644
542 Ga0495587_0015910
543 Ga0495645_0014511
544 Ga0495633_0108400
545 Ga0495667_0037462
546 Ga0495656_0006273
547 Ga0495635_0120613
548 Ga0495588_0011912
549 Ga0495588_0014119
550 Ga0495588_0062486
551 Ga0495623_0012733
552 Ga0495600_0149392
553 Ga0495600_0214129
554 Ga0495581_0006935
555 Ga0495581_0008284
556 Ga0495636_0007372
557 Ga0495680_0071331
558 Ga0495675_0006002
559 Ga0495681_0087125
560 Ga0496100_0023307
561 Ga0496100_0089657
562 Ga0496101_0066719
563 Ga0496102_0011567
564 Ga0496102_0027685
565 Ga0496102_0194204
566 Ga0496103_0001896
567 Ga0496103_0023406
568 Ga0496103_0035454
569 Ga0496104_0021287
570 Ga0496105_0002638
571 Ga0496106_0053689
572 Ga0496107_0014731
573 Ga0496107_0115767
574 Ga0496110_0020958
575 Ga0496110_0174050
576 Ga0496110_0269402
577 Ga0496111_0049325
578 Ga0496111_0049803
579 Ga0496111_0258929
580 Ga0496112_0004018
581 Ga0496112_0035727
582 Ga0496113_0060935
583 Ga0496113_0217647
584 Ga0496114_0006293
585 Ga0496114_0121360
586 Ga0496114_0153464
587 Ga0496114_0334217
588 Ga0496115_0122363
589 Ga0496117_0059829
590 Ga0496118_0072721
591 Ga0496119_0001055
592 Ga0496120_0000600
593 Ga0496120_0012672
594 Ga0496120_0033030
595 Ga0496122_0000646
596 Ga0496122_0000891
597 Ga0496123_0000405
598 Ga0496124_0001934
599 Ga0496124_0054776
600 Ga0496124_0101066
601 Ga0496125_0000075
602 Ga0496125_0000977
603 Ga0501031_0029379
604 Ga0501032_0000496
605 Ga0501032_0007013
606 Ga0501033_0011300
607 Ga0501033_0020778
608 Ga0501034_0000016
609 Ga0501034_0003774
610 Ga0501034_0054155
611 Ga0501036_0021835
612 Ga0501036_0102975
613 Ga0501036_0182364
614 Ga0501037_0024395
615 Ga0501037_0046321
616 Ga0501037_0092770
617 Ga0501038_0008669
618 Ga0501038_0014390
619 Ga0501038_0205550
620 Ga0501039_0035557
621 Ga0501043_0006609
622 Ga0501043_0049667
623 Ga0501048_0025992
624 Ga0501048_0038342
625 Ga0501068_0096893
626 Ga0501073_0023470
627 Ga0501074_0019095
628 Ga0501080_0117835
629 Ga0501035_0015180
630 Ga0501035_0048501
631 Ga0501044_0037506
632 nmdc:mga03n38_18286_c1
633 nmdc:mga07m45_5934_c1
634 Ga0500635_0003755
635 Ga0500651_0006616
636 Ga0500590_016521
637 Ga0500620_000164
638 Ga0501082_0008676
639 2515856957
640 2644506706
641 2644527699
642 2644611102
643 2644670680
644 2691513867
645 2738696624
646 2738891321
647 2739324354
648 2739602343
649 2739606717
650 2747952577
651 2760306463
652 2760625073
653 2774382051
654 2775656904
655 2808831133
656 2808852397
657 2808879311
658 2808891188
659 2808896443
660 2809029941
661 2810363757
662 2812321169
663 2812362115
664 2812375078
665 2817509155
666 2819427828
667 2819666698
668 2819691833
669 2819729390
670 2835189297
671 2842776702
672 2844852732
673 2854911898
674 2857479352
675 2857634522
676 2857712482
677 2857729722
678 2857742112
679 2867476382
680 2870802486
681 2870804558
682 2884994647
683 2893685018
684 2904498223
685 2904777584
686 2905930883
687 2910812653
688 2919034955
689 2919059778
690 2919394757
691 2919540415
692 2920882631
693 2932428269
694 2933421108
695 2939601307
696 2939648674
697 2939675274
698 2945918924
699 2945920708
700 2945943106
701 2945959155
702 2946004428
703 2946025895
704 2946038999
705 2946062781
706 2954000405
707 2974306910
708 2997457453
709 8002813380
710 8004022739
711 8004029415
712 8025479405
713 8048135788
714 8054107866
715 8054161872
716 8056066264
717 8056448901
718 8056667250

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

145

351

0.93

PF03099

BPL_LplA_LipB

Biotin/lipoate A/B protein ligase family

178

298

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r07-assembly1.cif.gz_A structural analysis of an archaeal lipoylation system. a bi-partite lipoate protein ligase and its e2 lipoyl domain from thermoplasma acidophilum 0.856 116 366
2c7i-assembly2.cif.gz_B structure of protein ta0514, putative lipoate protein ligase from t. acidophilum. 0.8557 117 363
2c8m-assembly1.cif.gz_A structure of protein ta0514, putative lipoate protein ligase from t. acidophilum with bound lipoic acid 0.8551 117 363
2c8m-assembly4.cif.gz_D structure of protein ta0514, putative lipoate protein ligase from t. acidophilum with bound lipoic acid 0.852 117 364
2c8m-assembly3.cif.gz_C structure of protein ta0514, putative lipoate protein ligase from t. acidophilum with bound lipoic acid 0.8516 116 363
ID Description Score Start End Superfamily
af_Q2FZN7_2_241_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8614 121 364 3.30.930.10
3r07A00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.856 116 366 3.30.930.10
af_Q2FZN7_2_241_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8543 121 364 3.30.930.10
3r07C00 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.8416 14 104 3.30.390.50
af_Q2FY37_5_276_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8395 118 364 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A4S1ECE8-F1-model_v4 Biotin--protein ligase 1.002 18 107 GO:0016874
AF-M1L2C3-F1-model_v4 Lipoate--protein ligase 0.9966 19 107
AF-A0A8B5XI26-F1-model_v4 Biotin--protein ligase 0.9927 18 108 GO:0016874
AF-A0A536DZI5-F1-model_v4 BPL/LPL catalytic domain-containing protein 0.9703 116 276 GO:0036211
AF-A0A4S1ECE8-F1-model_v4 Biotin--protein ligase 0.9701 18 107 GO:0016874

Map