F421460

General Info

Members Datasets Scaffolds Average Seq Length
359 198 359 133

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100282119|Ga0070696_1002821191
Length 160
Sequence MQVVSSLKFTLRSRSTFRCLQEDVMATFKRFEEIECWKKARELTRRIYEITNKPAFARDFGLKDQIRRAAVSVMSNIAEGYDRSGTAEFVHFLATAKKSAAEVRCQLYVAADQGYIEEEHLDELNDLASETSRMLSGLMKYLRTSGYRGTKFKSPALDQT

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
138 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
139 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
145 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
146 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
169 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
170 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
171 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
172 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
173 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
174 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
175 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
176 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
177 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
178 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
184 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
185 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 1.11
Rhizosphere 97.77
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10305931 3300005289 Bacteria 877
2 Ga0065715_10099788 3300005293 Bacteria 3371
3 Ga0065707_10106618 3300005295 Bacteria 2578
4 Ga0065707_10660935 3300005295 Bacteria 658
5 Ga0065707_10751541 3300005295 Unclassified 610
6 Ga0070658_10024664 3300005327 Bacteria 4822
7 Ga0070658_11088528 3300005327 Bacteria 695
8 Ga0070676_10080756 3300005328 Unclassified 1972
9 Ga0070690_100040516 3300005330 Bacteria 2946
10 Ga0070670_100015082 3300005331 Bacteria 6632
11 Ga0070670_100160344 3300005331 Bacteria 1949
12 Ga0070670_100421520 3300005331 Unclassified 1180
13 Ga0068869_100003293 3300005334 Bacteria 9862
14 Ga0068869_100010825 3300005334 Bacteria 5963
15 Ga0068869_100405251 3300005334 Bacteria 1122
16 Ga0068869_100747601 3300005334 Bacteria 837
17 Ga0068869_100925536 3300005334 Bacteria 755
18 Ga0070666_10259357 3300005335 Bacteria 1232
19 Ga0070666_11510452 3300005335 Bacteria 503
20 Ga0070680_101087674 3300005336 Bacteria 691
21 Ga0070682_100263947 3300005337 Bacteria 1247
22 Ga0070689_100855441 3300005340 Unclassified 802
23 Ga0070687_101144766 3300005343 Unclassified 571
24 Ga0070661_100676755 3300005344 Bacteria 839
25 Ga0070692_10251649 3300005345 Bacteria 1058
26 Ga0070692_10509863 3300005345 Bacteria 781
27 Ga0070668_100007385 3300005347 Bacteria 8155
28 Ga0070669_100145574 3300005353 Bacteria 1830
29 Ga0070669_100184876 3300005353 Bacteria 1632
30 Ga0070669_100377090 3300005353 Bacteria 1156
31 Ga0070669_100560744 3300005353 Bacteria 953
32 Ga0070675_100244892 3300005354 Bacteria 1567
33 Ga0070675_100498977 3300005354 Unclassified 1097
34 Ga0070671_100349589 3300005355 Unclassified 1262
35 Ga0070674_101031489 3300005356 Bacteria 723
36 Ga0070673_100204251 3300005364 Bacteria 1703
37 Ga0070673_100579019 3300005364 Bacteria 1022
38 Ga0070688_100082821 3300005365 Bacteria 2080
39 Ga0070688_101514848 3300005365 Unclassified 546
40 Ga0070667_100474073 3300005367 Bacteria 1145
41 Ga0070703_10080157 3300005406 Bacteria 1110
42 Ga0070701_10058582 3300005438 Bacteria 2022
43 Ga0070705_100361748 3300005440 Bacteria 1062
44 Ga0070705_101935890 3300005440 Bacteria 502
45 Ga0070694_100374735 3300005444 Bacteria 1108
46 Ga0070694_101946136 3300005444 Bacteria 502
47 Ga0070708_100326516 3300005445 Bacteria 1445
48 Ga0070708_100426066 3300005445 Bacteria 1251
49 Ga0068867_100182749 3300005459 Bacteria 1668
50 Ga0068867_100204041 3300005459 Bacteria 1584
51 Ga0068867_101448887 3300005459 Bacteria 638
52 Ga0070685_10238792 3300005466 Bacteria 1199
53 Ga0070706_100011988 3300005467 Bacteria 8046
54 Ga0070706_100252781 3300005467 Unclassified 1645
55 Ga0070706_100506303 3300005467 Bacteria 1123
56 Ga0070706_100551850 3300005467 Bacteria 1072
57 Ga0070706_100770766 3300005467 Bacteria 891
58 Ga0070706_101540702 3300005467 Unclassified 607
59 Ga0070707_100247632 3300005468 Bacteria 1734
60 Ga0070707_100402600 3300005468 Unclassified 1329
61 Ga0070707_102338703 3300005468 Unclassified 502
62 Ga0070698_100005699 3300005471 Bacteria 13631
63 Ga0070698_100012339 3300005471 Bacteria 9047
64 Ga0070698_100057519 3300005471 Unclassified 3935
65 Ga0070698_100129973 3300005471 Bacteria 2474
66 Ga0070699_100263255 3300005518 Unclassified 1542
67 Ga0070699_100291829 3300005518 Bacteria 1462
68 Ga0070699_100323570 3300005518 Bacteria 1386
69 Ga0070699_100632425 3300005518 Bacteria 977
70 Ga0070697_100242887 3300005536 Bacteria 1538
71 Ga0068853_100004142 3300005539 Bacteria 11177
72 Ga0068853_100167497 3300005539 Bacteria 1986
73 Ga0068853_101079780 3300005539 Unclassified 774
74 Ga0070672_100011675 3300005543 Bacteria 6132
75 Ga0070686_100817519 3300005544 Bacteria 752
76 Ga0070686_101081220 3300005544 Bacteria 661
77 Ga0070695_100030341 3300005545 Bacteria 3367
78 Ga0070695_100076473 3300005545 Bacteria 2205
79 Ga0070695_100160676 3300005545 Bacteria 1577
80 Ga0070695_101004856 3300005545 Bacteria 679
81 Ga0070695_101119757 3300005545 Bacteria 645
82 Ga0070695_101291128 3300005545 Bacteria 603
83 Ga0070696_100048297 3300005546 Bacteria 2954
84 Ga0070696_100282119 3300005546 Bacteria 1266
85 Ga0070693_100899500 3300005547 Bacteria 663
86 Ga0070704_100132129 3300005549 Bacteria 1936
87 Ga0070704_100477634 3300005549 Bacteria 1078
88 Ga0070704_100792382 3300005549 Bacteria 846
89 Ga0068855_100004065 3300005563 Bacteria 17856
90 Ga0068855_100044565 3300005563 Bacteria 5249
91 Ga0068855_100581201 3300005563 Unclassified 1210
92 Ga0068857_101037867 3300005577 Bacteria 790
93 Ga0070702_100079347 3300005615 Bacteria 1961
94 Ga0068852_100441860 3300005616 Unclassified 1286
95 Ga0068859_100029093 3300005617 Bacteria 5545
96 Ga0068859_100074040 3300005617 Unclassified 3444
97 Ga0068859_100182033 3300005617 Bacteria 2184
98 Ga0068859_100530472 3300005617 Unclassified 1272
99 Ga0068859_100638396 3300005617 Bacteria 1157
100 Ga0068859_101934106 3300005617 Unclassified 651
101 Ga0068864_100293391 3300005618 Bacteria 1520
102 Ga0068864_100517431 3300005618 Unclassified 1150
103 Ga0068864_100878424 3300005618 Unclassified 884
104 Ga0068864_100999748 3300005618 Unclassified 829
105 Ga0068864_101545459 3300005618 Unclassified 667
106 Ga0068864_101986494 3300005618 Bacteria 588
107 Ga0068864_102379640 3300005618 Bacteria 536
108 Ga0068866_10142134 3300005718 Unclassified 1379
109 Ga0068866_10191639 3300005718 Bacteria 1215
110 Ga0068866_10364904 3300005718 Unclassified 922
111 Ga0068866_10659464 3300005718 Bacteria 713
112 Ga0068861_100138854 3300005719 Bacteria 1981
113 Ga0068870_10755507 3300005840 Bacteria 676
114 Ga0068863_101133504 3300005841 Bacteria 787
115 Ga0068863_101505022 3300005841 Unclassified 681
116 Ga0068858_100219888 3300005842 Unclassified 1799
117 Ga0068858_100923223 3300005842 Bacteria 854
118 Ga0068858_101428854 3300005842 Bacteria 682
119 Ga0068860_101084525 3300005843 Bacteria 820
120 Ga0068862_100736040 3300005844 Bacteria 958
121 Ga0097621_100005604 3300006237 Bacteria 8854
122 Ga0097621_101151386 3300006237 Bacteria 729
123 Ga0068871_100016468 3300006358 Bacteria 5568
124 Ga0068871_101488270 3300006358 Bacteria 639
125 Ga0075428_100024777 3300006844 Bacteria 6637
126 Ga0075430_101754756 3300006846 Unclassified 509
127 Ga0075431_100222320 3300006847 Unclassified 1926
128 Ga0075434_100219375 3300006871 Bacteria 1921
129 Ga0075434_100265485 3300006871 Bacteria 1736
130 Ga0068865_100009979 3300006881 Bacteria 5900
131 Ga0075436_100000016 3300006914 Bacteria 167300
132 Ga0075436_100000018 3300006914 Bacteria 139195
133 Ga0075436_100003192 3300006914 Bacteria 11243
134 Ga0075436_100018545 3300006914 Bacteria 4763
135 Ga0097620_100029093 3300006931 Bacteria 5545
136 Ga0097620_100074041 3300006931 Unclassified 3444
137 Ga0097620_100182046 3300006931 Bacteria 2184
138 Ga0097620_100530445 3300006931 Unclassified 1272
139 Ga0097620_100638469 3300006931 Bacteria 1157
140 Ga0097620_101933643 3300006931 Unclassified 651
141 Ga0075435_100000802 3300007076 Bacteria 19557
142 Ga0075435_100116466 3300007076 Unclassified 2226
143 Ga0075435_100122079 3300007076 Bacteria 2175
144 Ga0105240_12696129 3300009093 Bacteria 513
145 Ga0111539_10839373 3300009094 Unclassified 1069
146 Ga0111539_11206490 3300009094 Bacteria 879
147 Ga0114129_10635309 3300009147 Bacteria 1379
148 Ga0114129_11414096 3300009147 Bacteria 858
149 Ga0105243_10001431 3300009148 Bacteria 21022
150 Ga0105243_10389704 3300009148 Bacteria 1291
151 Ga0105243_10428460 3300009148 Bacteria 1236
152 Ga0105243_10523267 3300009148 Bacteria 1128
153 Ga0105243_10587542 3300009148 Bacteria 1070
154 Ga0105241_11359648 3300009174 Bacteria 678
155 Ga0105242_10008001 3300009176 Bacteria 8144
156 Ga0105242_10012572 3300009176 Bacteria 6517
157 Ga0105242_10249554 3300009176 Bacteria 1598
158 Ga0105242_11315568 3300009176 Bacteria 747
159 Ga0105248_11073451 3300009177 Bacteria 910
160 Ga0105248_11227033 3300009177 Bacteria 848
161 Ga0105248_12042989 3300009177 Unclassified 651
162 Ga0105238_10027249 3300009551 Bacteria 5822
163 Ga0105249_10000190 3300009553 Bacteria 70486
164 Ga0105249_10044197 3300009553 Bacteria 4051
165 Ga0105249_11491805 3300009553 Bacteria 748
166 Ga0105249_11623799 3300009553 Bacteria 719
167 Ga0105239_13135928 3300010375 Unclassified 538
168 Ga0105246_10223642 3300011119 Unclassified 1477
169 Ga0105246_10493551 3300011119 Bacteria 1038
170 Ga0157373_10408383 3300013100 Unclassified 974
171 Ga0157371_10270134 3300013102 Bacteria 1227
172 Ga0157374_10723728 3300013296 Bacteria 1009
173 Ga0157378_10000002 3300013297 Bacteria 222652
174 Ga0157378_10015240 3300013297 Bacteria 6732
175 Ga0157378_10023681 3300013297 Bacteria 5401
176 Ga0157378_10100181 3300013297 Bacteria 2644
177 Ga0157378_11132489 3300013297 Unclassified 820
178 Ga0163162_10000039 3300013306 Bacteria 137338
179 Ga0163162_10248310 3300013306 Bacteria 1911
180 Ga0163162_10280325 3300013306 Bacteria 1799
181 Ga0163162_10705225 3300013306 Bacteria 1131
182 Ga0163162_11636183 3300013306 Bacteria 735
183 Ga0157372_10055156 3300013307 Bacteria 4437
184 Ga0157372_10938449 3300013307 Bacteria 1003
185 Ga0157375_10006764 3300013308 Bacteria 9985
186 Ga0157375_10009312 3300013308 Bacteria 8621
187 Ga0157375_10346273 3300013308 Bacteria 1652
188 Ga0157375_10758832 3300013308 Bacteria 1121
189 Ga0163163_10071678 3300014325 Unclassified 3453
190 Ga0163163_10180640 3300014325 Bacteria 2157
191 Ga0163163_10352297 3300014325 Bacteria 1528
192 Ga0163163_10423074 3300014325 Bacteria 1391
193 Ga0163163_11054965 3300014325 Bacteria 876
194 Ga0157380_10035536 3300014326 Bacteria 3850
195 Ga0157380_10147653 3300014326 Bacteria 2028
196 Ga0157380_10512902 3300014326 Bacteria 1168
197 Ga0157380_10605134 3300014326 Bacteria 1085
198 Ga0157376_10424307 3300014969 Unclassified 1291
199 Ga0157376_10462983 3300014969 Bacteria 1239
200 Ga0163161_10188542 3300017792 Bacteria 1584
201 Ga0207642_10006003 3300025899 Bacteria 4009
202 Ga0207642_10265723 3300025899 Unclassified 980
203 Ga0207642_10919578 3300025899 Unclassified 561
204 Ga0207680_10092325 3300025903 Bacteria 1928
205 Ga0207680_10901540 3300025903 Bacteria 634
206 Ga0207645_10707903 3300025907 Bacteria 685
207 Ga0207643_10614433 3300025908 Bacteria 700
208 Ga0207705_10106753 3300025909 Bacteria 2065
209 Ga0207684_10006579 3300025910 Bacteria 10573
210 Ga0207684_10019051 3300025910 Bacteria 5871
211 Ga0207684_10025620 3300025910 Bacteria 5027
212 Ga0207684_10034980 3300025910 Bacteria 4267
213 Ga0207684_10475830 3300025910 Bacteria 1071
214 Ga0207646_10008777 3300025922 Bacteria 10088
215 Ga0207646_10869142 3300025922 Unclassified 801
216 Ga0207646_10935351 3300025922 Unclassified 768
217 Ga0207646_11272619 3300025922 Unclassified 643
218 Ga0207681_10095483 3300025923 Bacteria 2132
219 Ga0207681_10361598 3300025923 Bacteria 1164
220 Ga0207694_10010435 3300025924 Bacteria 7004
221 Ga0207694_10071951 3300025924 Bacteria 2703
222 Ga0207650_10045184 3300025925 Bacteria 3240
223 Ga0207650_10074841 3300025925 Bacteria 2554
224 Ga0207644_10659190 3300025931 Unclassified 871
225 Ga0207686_10001470 3300025934 Bacteria 13309
226 Ga0207686_10680410 3300025934 Bacteria 816
227 Ga0207709_10001542 3300025935 Bacteria 15824
228 Ga0207709_10444359 3300025935 Unclassified 1001
229 Ga0207709_10763936 3300025935 Bacteria 778
230 Ga0207670_10642575 3300025936 Bacteria 874
231 Ga0207669_10149700 3300025937 Bacteria 1633
232 Ga0207704_10110449 3300025938 Bacteria 1857
233 Ga0207691_10573097 3300025940 Bacteria 956
234 Ga0207711_10067317 3300025941 Bacteria 3100
235 Ga0207711_10368167 3300025941 Bacteria 1332
236 Ga0207689_10006536 3300025942 Bacteria 10286
237 Ga0207689_10006785 3300025942 Bacteria 10076
238 Ga0207689_10029397 3300025942 Bacteria 4589
239 Ga0207689_10042517 3300025942 Bacteria 3758
240 Ga0207667_10002345 3300025949 Bacteria 23723
241 Ga0207667_10216312 3300025949 Bacteria 1963
242 Ga0207651_10464772 3300025960 Bacteria 1088
243 Ga0207651_10551404 3300025960 Bacteria 1002
244 Ga0207712_10000201 3300025961 Bacteria 60068
245 Ga0207712_10057971 3300025961 Bacteria 2735
246 Ga0207712_10215444 3300025961 Bacteria 1532
247 Ga0207712_11364933 3300025961 Bacteria 634
248 Ga0207712_11540030 3300025961 Bacteria 596
249 Ga0207668_10005684 3300025972 Bacteria 7343
250 Ga0207658_10666014 3300025986 Unclassified 939
251 Ga0207677_10214078 3300026023 Bacteria 1541
252 Ga0207677_11056374 3300026023 Bacteria 738
253 Ga0207703_10774694 3300026035 Bacteria 915
254 Ga0207703_10815943 3300026035 Bacteria 891
255 Ga0207703_10972040 3300026035 Bacteria 814
256 Ga0207639_10028380 3300026041 Bacteria 4085
257 Ga0207639_10506980 3300026041 Bacteria 1103
258 Ga0207702_12018345 3300026078 Unclassified 567
259 Ga0207641_11146741 3300026088 Bacteria 776
260 Ga0207648_10732444 3300026089 Bacteria 918
261 Ga0207676_10170951 3300026095 Bacteria 1893
262 Ga0207676_10373952 3300026095 Bacteria 1324
263 Ga0207676_10998881 3300026095 Unclassified 824
264 Ga0207674_10528351 3300026116 Bacteria 1140
265 Ga0207674_10598275 3300026116 Bacteria 1065
266 Ga0207675_100156608 3300026118 Bacteria 2171
267 Ga0207675_100441669 3300026118 Bacteria 1288
268 Ga0207683_10077097 3300026121 Unclassified 2952
269 Ga0207698_10150239 3300026142 Bacteria 2020
270 Ga0207698_10209948 3300026142 Bacteria 1751
271 Ga0209974_10082371 3300027876 Bacteria 1109
272 Ga0207428_10154458 3300027907 Unclassified 1746
273 Ga0207428_10328029 3300027907 Bacteria 1129
274 Ga0268265_10573977 3300028380 Bacteria 1074
275 Ga0265327_10009211 3300031251 Bacteria 7162
276 Ga0307408_100369682 3300031548 Bacteria 1222
277 Ga0307408_100982738 3300031548 Bacteria 777
278 Ga0307413_10100409 3300031824 Bacteria 1910
279 Ga0307410_10522376 3300031852 Bacteria 980
280 Ga0307407_10078840 3300031903 Bacteria 1985
281 Ga0307412_10137321 3300031911 Bacteria 1785
282 Ga0307416_100726926 3300032002 Bacteria 1084
283 Ga0307411_10027418 3300032005 Bacteria 3446
284 Ga0307415_101940066 3300032126 Unclassified 572
285 Ga0307415_101959953 3300032126 Unclassified 570
286 Ga0316582_0194375 3300036647 Bacteria 1383
287 Ga0395900_1148901 3300037418 Unclassified 693
288 Ga0400483_151847 3300039062 Bacteria 5221
289 Ga0451800_1239538 3300041459 Unclassified 675
290 Ga0451839_0679563 3300041496 Unclassified 545
291 Ga0451577_0060373 3300042876 Bacteria 3380
292 Ga0451577_1191825 3300042876 Bacteria 679
293 Ga0453683_0007781 3300044673 Bacteria 7247
294 Ga0453683_0021535 3300044673 Bacteria 4115
295 Ga0453684_0143776 3300044712 Unclassified 2844
296 Ga0453684_0219894 3300044712 Bacteria 2201
297 Ga0453684_0232701 3300044712 Bacteria 2126
298 Ga0453684_2390521 3300044712 Unclassified 524
299 Ga0451576_0414788 3300045051 Bacteria 1412
300 Ga0495663_0000217 3300046525 Bacteria 23003
301 Ga0495598_0002956 3300046537 Bacteria 3565
302 Ga0495621_0000008 3300046539 Bacteria 41319
303 Ga0495672_0057958 3300047320 Bacteria 2247
304 Ga0496100_1577520 3300048903 Bacteria 519
305 Ga0496106_0023640 3300048909 Bacteria 4566
306 Ga0496115_0766954 3300048918 Unclassified 753
307 Ga0501294_037413 3300049517 Bacteria 588
308 Ga0501036_0003091 3300049572 Bacteria 13275
309 Ga0501038_0005446 3300049574 Bacteria 11828
310 Ga0501039_0004750 3300049575 Bacteria 10287
311 Ga0501040_0003573 3300049576 Bacteria 10056
312 Ga0501041_0000299 3300049577 Bacteria 23966
313 Ga0501042_0102420 3300049578 Bacteria 2059
314 Ga0501043_0161354 3300049579 Unclassified 1751
315 Ga0501047_0153894 3300049581 Bacteria 2174
316 Ga0501068_0409384 3300049584 Bacteria 875
317 Ga0501070_0290658 3300049586 Bacteria 1332
318 Ga0501072_0002136 3300049588 Bacteria 14738
319 Ga0501073_0502867 3300049589 Unclassified 838
320 Ga0501074_0017359 3300049590 Bacteria 5221
321 Ga0501075_0001910 3300049591 Bacteria 13749
322 Ga0501076_0000519 3300049592 Bacteria 24446
323 Ga0501077_0000481 3300049593 Bacteria 24252
324 Ga0501201_046562 3300049651 Bacteria 532
325 Ga0501216_147816 3300049660 Bacteria 556
326 Ga0501233_057447 3300049668 Bacteria 958
327 Ga0501235_013809 3300049669 Bacteria 1779
328 Ga0501242_005949 3300049674 Bacteria 1385
329 Ga0501249_048209 3300049679 Bacteria 975
330 Ga0501259_029354 3300049688 Bacteria 1029
331 Ga0501221_109959 3300049704 Bacteria 693
332 Ga0501225_0052223 3300049705 Bacteria 1140
333 Ga0501229_046258 3300049706 Bacteria 632
334 Ga0501245_018744 3300049708 Bacteria 1066
335 Ga0501079_0000440 3300049741 Bacteria 27005
336 Ga0501080_0014030 3300049742 Bacteria 7376
337 Ga0501081_0000162 3300049743 Bacteria 30878
338 Ga0501083_0069274 3300049744 Bacteria 2347
339 Ga0501262_043329 3300049759 Bacteria 678
340 Ga0501268_023032 3300049765 Bacteria 1079
341 Ga0501272_014480 3300049769 Bacteria 911
342 Ga0501035_0040497 3300049822 Unclassified 4210
343 Ga0501045_0000561 3300049824 Bacteria 23341
344 nmdc:mga03n38_472988_c1 3300050490 Bacteria 700
345 nmdc:mga05p37_1669607_c1 3300050507 Bacteria 623
346 nmdc:mga06r32_257332_c1 3300050510 Bacteria 1733
347 nmdc:mga0n895_383523_c1 3300050512 Bacteria 1422
348 nmdc:mga0n895_40193_c1 3300050512 Bacteria 4542
349 nmdc:mga0rr50_1176_c1 3300050513 Bacteria 14220
350 nmdc:mga0rr50_194_c1 3300050513 Bacteria 32808
351 nmdc:mga08x19_12_c1 3300050514 Bacteria 395395
352 nmdc:mga08x19_33_c1 3300050514 Bacteria 203200
353 nmdc:mga08x19_8_c1 3300050514 Bacteria 427794
354 nmdc:mga0a205_130354_c1 3300050515 Bacteria 2415
355 Ga0500651_0329446 3300053093 Unclassified 870
356 Ga0501084_0002904 3300054114 Bacteria 13873
357 Ga0501082_0001053 3300060353 Bacteria 24424
358 Ga0530510_0020563 3300061734 Bacteria 4693
359 Ga0530510_1414898 3300061734 Bacteria 534

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025910 Ga0207684_10034980 Ga0207684_100349802 116
2 3300014325 Ga0163163_10180640 Ga0163163_101806403 120
3 3300032002 Ga0307416_100726926 Ga0307416_1007269262 120
4 3300005518 Ga0070699_100291829 Ga0070699_1002918292 128
5 3300005539 Ga0068853_100004142 Ga0068853_1000041422 128
6 3300005334 Ga0068869_100747601 Ga0068869_1007476012 129
7 3300005467 Ga0070706_100551850 Ga0070706_1005518501 129
8 3300005544 Ga0070686_100817519 Ga0070686_1008175192 129
9 3300005545 Ga0070695_100030341 Ga0070695_1000303412 129
10 3300005545 Ga0070695_101291128 Ga0070695_1012911282 129
11 3300005547 Ga0070693_100899500 Ga0070693_1008995001 129
12 3300005549 Ga0070704_100477634 Ga0070704_1004776343 129
13 3300005617 Ga0068859_101934106 Ga0068859_1019341061 129
14 3300006844 Ga0075428_100024777 Ga0075428_1000247774 129
15 3300006846 Ga0075430_101754756 Ga0075430_1017547562 129
16 3300006931 Ga0097620_101933643 Ga0097620_1019336431 129
17 3300009147 Ga0114129_10635309 Ga0114129_106353092 129
18 3300009147 Ga0114129_11414096 Ga0114129_114140962 129
19 3300009148 Ga0105243_10389704 Ga0105243_103897042 129
20 3300013100 Ga0157373_10408383 Ga0157373_104083832 129
21 3300013306 Ga0163162_10280325 Ga0163162_102803251 129
22 3300014326 Ga0157380_10605134 Ga0157380_106051342 129
23 3300025935 Ga0207709_10763936 Ga0207709_107639362 129
24 3300026142 Ga0207698_10150239 Ga0207698_101502391 129
25 3300027876 Ga0209974_10082371 Ga0209974_100823711 129
26 3300027907 Ga0207428_10154458 Ga0207428_101544582 129
27 3300031251 Ga0265327_10009211 Ga0265327_100092117 129
28 3300031548 Ga0307408_100369682 Ga0307408_1003696822 129
29 3300031548 Ga0307408_100982738 Ga0307408_1009827382 129
30 3300031824 Ga0307413_10100409 Ga0307413_101004092 129
31 3300031852 Ga0307410_10522376 Ga0307410_105223762 129
32 3300031903 Ga0307407_10078840 Ga0307407_100788402 129
33 3300031911 Ga0307412_10137321 Ga0307412_101373212 129
34 3300032005 Ga0307411_10027418 Ga0307411_100274182 129
35 3300032126 Ga0307415_101940066 Ga0307415_1019400661 129
36 3300036647 Ga0316582_0194375 Ga0316582_0194375_551_940 129
37 3300037418 Ga0395900_1148901 Ga0395900_1148901_110_514 129
38 3300039062 Ga0400483_151847 Ga0400483_151847_3277_3666 129
39 3300044673 Ga0453683_0007781 Ga0453683_0007781_2248_2664 129
40 3300044673 Ga0453683_0021535 Ga0453683_0021535_2142_2531 129
41 3300044712 Ga0453684_0219894 Ga0453684_0219894_340_729 129
42 3300045051 Ga0451576_0414788 Ga0451576_0414788_713_1102 129
43 3300049517 Ga0501294_037413 Ga0501294_037413_29_418 129
44 3300049581 Ga0501047_0153894 Ga0501047_0153894_1141_1530 129
45 3300049651 Ga0501201_046562 Ga0501201_046562_110_499 129
46 3300049660 Ga0501216_147816 Ga0501216_147816_108_497 129
47 3300049668 Ga0501233_057447 Ga0501233_057447_373_762 129
48 3300049669 Ga0501235_013809 Ga0501235_013809_835_1224 129
49 3300049674 Ga0501242_005949 Ga0501242_005949_441_830 129
50 3300049679 Ga0501249_048209 Ga0501249_048209_79_468 129
51 3300049688 Ga0501259_029354 Ga0501259_029354_162_551 129
52 3300049704 Ga0501221_109959 Ga0501221_109959_55_444 129
53 3300049705 Ga0501225_0052223 Ga0501225_0052223_297_686 129
54 3300049706 Ga0501229_046258 Ga0501229_046258_29_418 129
55 3300049708 Ga0501245_018744 Ga0501245_018744_569_958 129
56 3300049759 Ga0501262_043329 Ga0501262_043329_220_609 129
57 3300049765 Ga0501268_023032 Ga0501268_023032_316_705 129
58 3300049769 Ga0501272_014480 Ga0501272_014480_150_539 129
59 3300050507 nmdc:mga05p37_1669607_c1 nmdc:mga05p37_1669607_c1_94_498 129
60 3300005331 Ga0070670_100015082 Ga0070670_1000150822 130
61 3300005331 Ga0070670_100160344 Ga0070670_1001603442 130
62 3300005353 Ga0070669_100377090 Ga0070669_1003770902 130
63 3300005354 Ga0070675_100244892 Ga0070675_1002448922 130
64 3300005356 Ga0070674_101031489 Ga0070674_1010314892 130
65 3300005466 Ga0070685_10238792 Ga0070685_102387921 130
66 3300005617 Ga0068859_100074040 Ga0068859_1000740402 130
67 3300005618 Ga0068864_100293391 Ga0068864_1002933912 130
68 3300005718 Ga0068866_10659464 Ga0068866_106594642 130
69 3300005844 Ga0068862_100736040 Ga0068862_1007360402 130
70 3300006847 Ga0075431_100222320 Ga0075431_1002223202 130
71 3300006871 Ga0075434_100219375 Ga0075434_1002193752 130
72 3300006931 Ga0097620_100074041 Ga0097620_1000740412 130
73 3300009094 Ga0111539_10839373 Ga0111539_108393732 130
74 3300009553 Ga0105249_10044197 Ga0105249_100441972 130
75 3300011119 Ga0105246_10493551 Ga0105246_104935511 130
76 3300013308 Ga0157375_10346273 Ga0157375_103462732 130
77 3300014325 Ga0163163_10352297 Ga0163163_103522972 130
78 3300014326 Ga0157380_10512902 Ga0157380_105129022 130
79 3300025899 Ga0207642_10006003 Ga0207642_100060035 130
80 3300025923 Ga0207681_10361598 Ga0207681_103615982 130
81 3300025925 Ga0207650_10045184 Ga0207650_100451842 130
82 3300025937 Ga0207669_10149700 Ga0207669_101497002 130
83 3300025960 Ga0207651_10464772 Ga0207651_104647722 130
84 3300025961 Ga0207712_10057971 Ga0207712_100579712 130
85 3300026095 Ga0207676_10373952 Ga0207676_103739522 130
86 3300028380 Ga0268265_10573977 Ga0268265_105739772 130
87 3300032126 Ga0307415_101959953 Ga0307415_1019599531 130
88 3300050510 nmdc:mga06r32_257332_c1 nmdc:mga06r32_257332_c1_1150_1542 130
89 3300050512 nmdc:mga0n895_40193_c1 nmdc:mga0n895_40193_c1_244_636 130
90 3300005295 Ga0065707_10751541 Ga0065707_107515411 131
91 3300005327 Ga0070658_10024664 Ga0070658_100246646 131
92 3300005327 Ga0070658_11088528 Ga0070658_110885282 131
93 3300005365 Ga0070688_101514848 Ga0070688_1015148481 131
94 3300005440 Ga0070705_100361748 Ga0070705_1003617481 131
95 3300005467 Ga0070706_101540702 Ga0070706_1015407021 131
96 3300005539 Ga0068853_101079780 Ga0068853_1010797802 131
97 3300005549 Ga0070704_100792382 Ga0070704_1007923821 131
98 3300005563 Ga0068855_100004065 Ga0068855_10000406512 131
99 3300005563 Ga0068855_100044565 Ga0068855_1000445653 131
100 3300005563 Ga0068855_100581201 Ga0068855_1005812012 131
101 3300005618 Ga0068864_101986494 Ga0068864_1019864942 131
102 3300009094 Ga0111539_11206490 Ga0111539_112064902 131
103 3300009176 Ga0105242_11315568 Ga0105242_113155682 131
104 3300009177 Ga0105248_11073451 Ga0105248_110734512 131
105 3300009551 Ga0105238_10027249 Ga0105238_100272499 131
106 3300009553 Ga0105249_11491805 Ga0105249_114918052 131
107 3300013102 Ga0157371_10270134 Ga0157371_102701341 131
108 3300013297 Ga0157378_11132489 Ga0157378_111324892 131
109 3300013307 Ga0157372_10938449 Ga0157372_109384492 131
110 3300025903 Ga0207680_10901540 Ga0207680_109015402 131
111 3300025909 Ga0207705_10106753 Ga0207705_101067533 131
112 3300025924 Ga0207694_10010435 Ga0207694_100104359 131
113 3300025949 Ga0207667_10002345 Ga0207667_1000234512 131
114 3300025949 Ga0207667_10216312 Ga0207667_102163122 131
115 3300025961 Ga0207712_11364933 Ga0207712_113649331 131
116 3300026041 Ga0207639_10506980 Ga0207639_105069802 131
117 3300026078 Ga0207702_12018345 Ga0207702_120183451 131
118 3300026116 Ga0207674_10598275 Ga0207674_105982752 131
119 3300042876 Ga0451577_0060373 Ga0451577_0060373_2222_2638 131
120 3300042876 Ga0451577_1191825 Ga0451577_1191825_40_456 131
121 3300044712 Ga0453684_0143776 Ga0453684_0143776_2185_2607 131
122 3300044712 Ga0453684_0232701 Ga0453684_0232701_1187_1603 131
123 3300044712 Ga0453684_2390521 Ga0453684_2390521_65_493 131
124 3300048918 Ga0496115_0766954 Ga0496115_0766954_69_464 131
125 3300049572 Ga0501036_0003091 Ga0501036_0003091_11726_12121 131
126 3300049574 Ga0501038_0005446 Ga0501038_0005446_5483_5878 131
127 3300049575 Ga0501039_0004750 Ga0501039_0004750_1792_2187 131
128 3300049576 Ga0501040_0003573 Ga0501040_0003573_1269_1664 131
129 3300049577 Ga0501041_0000299 Ga0501041_0000299_11820_12215 131
130 3300049578 Ga0501042_0102420 Ga0501042_0102420_1222_1617 131
131 3300049579 Ga0501043_0161354 Ga0501043_0161354_107_502 131
132 3300049584 Ga0501068_0409384 Ga0501068_0409384_156_551 131
133 3300049586 Ga0501070_0290658 Ga0501070_0290658_407_802 131
134 3300049588 Ga0501072_0002136 Ga0501072_0002136_12551_12946 131
135 3300049589 Ga0501073_0502867 Ga0501073_0502867_387_782 131
136 3300049590 Ga0501074_0017359 Ga0501074_0017359_3648_4043 131
137 3300049591 Ga0501075_0001910 Ga0501075_0001910_11659_12054 131
138 3300049592 Ga0501076_0000519 Ga0501076_0000519_11659_12054 131
139 3300049593 Ga0501077_0000481 Ga0501077_0000481_11647_12042 131
140 3300049741 Ga0501079_0000440 Ga0501079_0000440_14966_15361 131
141 3300049742 Ga0501080_0014030 Ga0501080_0014030_5744_6139 131
142 3300049743 Ga0501081_0000162 Ga0501081_0000162_25904_26299 131
143 3300049744 Ga0501083_0069274 Ga0501083_0069274_1657_2052 131
144 3300049822 Ga0501035_0040497 Ga0501035_0040497_3797_4192 131
145 3300049824 Ga0501045_0000561 Ga0501045_0000561_9756_10151 131
146 3300050490 nmdc:mga03n38_472988_c1 nmdc:mga03n38_472988_c1_19_414 131
147 3300054114 Ga0501084_0002904 Ga0501084_0002904_1637_2032 131
148 3300060353 Ga0501082_0001053 Ga0501082_0001053_12308_12703 131
149 3300061734 Ga0530510_0020563 Ga0530510_0020563_2165_2560 131
150 3300005289 Ga0065704_10305931 Ga0065704_103059311 132
151 3300005293 Ga0065715_10099788 Ga0065715_100997884 132
152 3300005295 Ga0065707_10106618 Ga0065707_101066182 132
153 3300005295 Ga0065707_10660935 Ga0065707_106609351 132
154 3300005328 Ga0070676_10080756 Ga0070676_100807562 132
155 3300005330 Ga0070690_100040516 Ga0070690_1000405162 132
156 3300005331 Ga0070670_100421520 Ga0070670_1004215202 132
157 3300005334 Ga0068869_100003293 Ga0068869_1000032938 132
158 3300005334 Ga0068869_100010825 Ga0068869_1000108255 132
159 3300005334 Ga0068869_100405251 Ga0068869_1004052512 132
160 3300005334 Ga0068869_100925536 Ga0068869_1009255361 132
161 3300005335 Ga0070666_10259357 Ga0070666_102593571 132
162 3300005335 Ga0070666_11510452 Ga0070666_115104521 132
163 3300005336 Ga0070680_101087674 Ga0070680_1010876741 132
164 3300005337 Ga0070682_100263947 Ga0070682_1002639472 132
165 3300005340 Ga0070689_100855441 Ga0070689_1008554411 132
166 3300005343 Ga0070687_101144766 Ga0070687_1011447661 132
167 3300005344 Ga0070661_100676755 Ga0070661_1006767551 132
168 3300005345 Ga0070692_10251649 Ga0070692_102516492 132
169 3300005345 Ga0070692_10509863 Ga0070692_105098632 132
170 3300005347 Ga0070668_100007385 Ga0070668_10000738510 132
171 3300005353 Ga0070669_100145574 Ga0070669_1001455742 132
172 3300005353 Ga0070669_100184876 Ga0070669_1001848762 132
173 3300005353 Ga0070669_100560744 Ga0070669_1005607442 132
174 3300005354 Ga0070675_100498977 Ga0070675_1004989772 132
175 3300005355 Ga0070671_100349589 Ga0070671_1003495892 132
176 3300005364 Ga0070673_100204251 Ga0070673_1002042512 132
177 3300005364 Ga0070673_100579019 Ga0070673_1005790192 132
178 3300005365 Ga0070688_100082821 Ga0070688_1000828211 132
179 3300005367 Ga0070667_100474073 Ga0070667_1004740732 132
180 3300005406 Ga0070703_10080157 Ga0070703_100801572 132
181 3300005438 Ga0070701_10058582 Ga0070701_100585822 132
182 3300005440 Ga0070705_101935890 Ga0070705_1019358901 132
183 3300005444 Ga0070694_100374735 Ga0070694_1003747351 132
184 3300005444 Ga0070694_101946136 Ga0070694_1019461361 132
185 3300005445 Ga0070708_100326516 Ga0070708_1003265164 132
186 3300005445 Ga0070708_100426066 Ga0070708_1004260662 132
187 3300005459 Ga0068867_100182749 Ga0068867_1001827492 132
188 3300005459 Ga0068867_100204041 Ga0068867_1002040413 132
189 3300005459 Ga0068867_101448887 Ga0068867_1014488872 132
190 3300005467 Ga0070706_100011988 Ga0070706_1000119883 132
191 3300005467 Ga0070706_100252781 Ga0070706_1002527811 132
192 3300005467 Ga0070706_100506303 Ga0070706_1005063032 132
193 3300005467 Ga0070706_100770766 Ga0070706_1007707662 132
194 3300005468 Ga0070707_100247632 Ga0070707_1002476322 132
195 3300005468 Ga0070707_100402600 Ga0070707_1004026002 132
196 3300005468 Ga0070707_102338703 Ga0070707_1023387031 132
197 3300005471 Ga0070698_100005699 Ga0070698_1000056997 132
198 3300005471 Ga0070698_100012339 Ga0070698_1000123397 132
199 3300005471 Ga0070698_100057519 Ga0070698_1000575192 132
200 3300005471 Ga0070698_100129973 Ga0070698_1001299732 132
201 3300005518 Ga0070699_100263255 Ga0070699_1002632552 132
202 3300005518 Ga0070699_100323570 Ga0070699_1003235701 132
203 3300005518 Ga0070699_100632425 Ga0070699_1006324251 132
204 3300005536 Ga0070697_100242887 Ga0070697_1002428871 132
205 3300005539 Ga0068853_100167497 Ga0068853_1001674972 132
206 3300005543 Ga0070672_100011675 Ga0070672_1000116752 132
207 3300005544 Ga0070686_101081220 Ga0070686_1010812201 132
208 3300005545 Ga0070695_100076473 Ga0070695_1000764732 132
209 3300005545 Ga0070695_100160676 Ga0070695_1001606762 132
210 3300005545 Ga0070695_101004856 Ga0070695_1010048561 132
211 3300005545 Ga0070695_101119757 Ga0070695_1011197571 132
212 3300005546 Ga0070696_100048297 Ga0070696_1000482972 132
213 3300005546 Ga0070696_100282119 Ga0070696_1002821191 132
214 3300005549 Ga0070704_100132129 Ga0070704_1001321293 132
215 3300005577 Ga0068857_101037867 Ga0068857_1010378672 132
216 3300005615 Ga0070702_100079347 Ga0070702_1000793472 132
217 3300005616 Ga0068852_100441860 Ga0068852_1004418602 132
218 3300005617 Ga0068859_100029093 Ga0068859_1000290935 132
219 3300005617 Ga0068859_100182033 Ga0068859_1001820332 132
220 3300005617 Ga0068859_100530472 Ga0068859_1005304722 132
221 3300005617 Ga0068859_100638396 Ga0068859_1006383962 132
222 3300005618 Ga0068864_100517431 Ga0068864_1005174312 132
223 3300005618 Ga0068864_100878424 Ga0068864_1008784241 132
224 3300005618 Ga0068864_100999748 Ga0068864_1009997482 132
225 3300005618 Ga0068864_101545459 Ga0068864_1015454592 132
226 3300005618 Ga0068864_102379640 Ga0068864_1023796401 132
227 3300005718 Ga0068866_10142134 Ga0068866_101421341 132
228 3300005718 Ga0068866_10191639 Ga0068866_101916391 132
229 3300005718 Ga0068866_10364904 Ga0068866_103649042 132
230 3300005719 Ga0068861_100138854 Ga0068861_1001388542 132
231 3300005840 Ga0068870_10755507 Ga0068870_107555071 132
232 3300005841 Ga0068863_101133504 Ga0068863_1011335042 132
233 3300005841 Ga0068863_101505022 Ga0068863_1015050221 132
234 3300005842 Ga0068858_100219888 Ga0068858_1002198881 132
235 3300005842 Ga0068858_100923223 Ga0068858_1009232231 132
236 3300005842 Ga0068858_101428854 Ga0068858_1014288541 132
237 3300005843 Ga0068860_101084525 Ga0068860_1010845252 132
238 3300006237 Ga0097621_100005604 Ga0097621_1000056047 132
239 3300006237 Ga0097621_101151386 Ga0097621_1011513861 132
240 3300006358 Ga0068871_100016468 Ga0068871_1000164682 132
241 3300006358 Ga0068871_101488270 Ga0068871_1014882701 132
242 3300006871 Ga0075434_100265485 Ga0075434_1002654852 132
243 3300006881 Ga0068865_100009979 Ga0068865_1000099792 132
244 3300006914 Ga0075436_100000016 Ga0075436_100000016134 132
245 3300006914 Ga0075436_100000018 Ga0075436_100000018112 132
246 3300006914 Ga0075436_100003192 Ga0075436_1000031924 132
247 3300006914 Ga0075436_100018545 Ga0075436_1000185454 132
248 3300006931 Ga0097620_100029093 Ga0097620_1000290932 132
249 3300006931 Ga0097620_100182046 Ga0097620_1001820462 132
250 3300006931 Ga0097620_100530445 Ga0097620_1005304452 132
251 3300006931 Ga0097620_100638469 Ga0097620_1006384692 132
252 3300007076 Ga0075435_100000802 Ga0075435_1000008025 132
253 3300007076 Ga0075435_100116466 Ga0075435_1001164662 132
254 3300007076 Ga0075435_100122079 Ga0075435_1001220792 132
255 3300009093 Ga0105240_12696129 Ga0105240_126961291 132
256 3300009148 Ga0105243_10001431 Ga0105243_100014318 132
257 3300009148 Ga0105243_10428460 Ga0105243_104284601 132
258 3300009148 Ga0105243_10523267 Ga0105243_105232672 132
259 3300009148 Ga0105243_10587542 Ga0105243_105875421 132
260 3300009174 Ga0105241_11359648 Ga0105241_113596482 132
261 3300009176 Ga0105242_10008001 Ga0105242_100080014 132
262 3300009176 Ga0105242_10012572 Ga0105242_100125725 132
263 3300009176 Ga0105242_10249554 Ga0105242_102495542 132
264 3300009177 Ga0105248_11227033 Ga0105248_112270332 132
265 3300009177 Ga0105248_12042989 Ga0105248_120429891 132
266 3300009553 Ga0105249_10000190 Ga0105249_1000019024 132
267 3300009553 Ga0105249_11623799 Ga0105249_116237992 132
268 3300010375 Ga0105239_13135928 Ga0105239_131359281 132
269 3300011119 Ga0105246_10223642 Ga0105246_102236421 132
270 3300013296 Ga0157374_10723728 Ga0157374_107237281 132
271 3300013297 Ga0157378_10000002 Ga0157378_1000000288 132
272 3300013297 Ga0157378_10015240 Ga0157378_100152405 132
273 3300013297 Ga0157378_10023681 Ga0157378_100236815 132
274 3300013297 Ga0157378_10100181 Ga0157378_101001813 132
275 3300013306 Ga0163162_10000039 Ga0163162_1000003952 132
276 3300013306 Ga0163162_10248310 Ga0163162_102483102 132
277 3300013306 Ga0163162_10705225 Ga0163162_107052252 132
278 3300013306 Ga0163162_11636183 Ga0163162_116361832 132
279 3300013307 Ga0157372_10055156 Ga0157372_100551563 132
280 3300013308 Ga0157375_10006764 Ga0157375_100067645 132
281 3300013308 Ga0157375_10009312 Ga0157375_100093127 132
282 3300013308 Ga0157375_10758832 Ga0157375_107588322 132
283 3300014325 Ga0163163_10071678 Ga0163163_100716782 132
284 3300014325 Ga0163163_10423074 Ga0163163_104230741 132
285 3300014325 Ga0163163_11054965 Ga0163163_110549652 132
286 3300014326 Ga0157380_10035536 Ga0157380_100355363 132
287 3300014326 Ga0157380_10147653 Ga0157380_101476532 132
288 3300014969 Ga0157376_10424307 Ga0157376_104243072 132
289 3300014969 Ga0157376_10462983 Ga0157376_104629831 132
290 3300017792 Ga0163161_10188542 Ga0163161_101885421 132
291 3300025899 Ga0207642_10265723 Ga0207642_102657231 132
292 3300025899 Ga0207642_10919578 Ga0207642_109195781 132
293 3300025903 Ga0207680_10092325 Ga0207680_100923251 132
294 3300025907 Ga0207645_10707903 Ga0207645_107079031 132
295 3300025908 Ga0207643_10614433 Ga0207643_106144332 132
296 3300025910 Ga0207684_10006579 Ga0207684_100065792 132
297 3300025910 Ga0207684_10019051 Ga0207684_100190513 132
298 3300025910 Ga0207684_10025620 Ga0207684_100256202 132
299 3300025910 Ga0207684_10475830 Ga0207684_104758302 132
300 3300025922 Ga0207646_10008777 Ga0207646_100087774 132
301 3300025922 Ga0207646_10869142 Ga0207646_108691421 132
302 3300025922 Ga0207646_10935351 Ga0207646_109353511 132
303 3300025922 Ga0207646_11272619 Ga0207646_112726191 132
304 3300025923 Ga0207681_10095483 Ga0207681_100954832 132
305 3300025924 Ga0207694_10071951 Ga0207694_100719512 132
306 3300025925 Ga0207650_10074841 Ga0207650_100748412 132
307 3300025931 Ga0207644_10659190 Ga0207644_106591902 132
308 3300025934 Ga0207686_10001470 Ga0207686_1000147011 132
309 3300025934 Ga0207686_10680410 Ga0207686_106804102 132
310 3300025935 Ga0207709_10001542 Ga0207709_1000154212 132
311 3300025935 Ga0207709_10444359 Ga0207709_104443591 132
312 3300025936 Ga0207670_10642575 Ga0207670_106425752 132
313 3300025938 Ga0207704_10110449 Ga0207704_101104492 132
314 3300025940 Ga0207691_10573097 Ga0207691_105730971 132
315 3300025941 Ga0207711_10067317 Ga0207711_100673174 132
316 3300025941 Ga0207711_10368167 Ga0207711_103681671 132
317 3300025942 Ga0207689_10006536 Ga0207689_100065368 132
318 3300025942 Ga0207689_10006785 Ga0207689_100067857 132
319 3300025942 Ga0207689_10029397 Ga0207689_100293974 132
320 3300025942 Ga0207689_10042517 Ga0207689_100425171 132
321 3300025960 Ga0207651_10551404 Ga0207651_105514042 132
322 3300025961 Ga0207712_10000201 Ga0207712_1000020141 132
323 3300025961 Ga0207712_10215444 Ga0207712_102154441 132
324 3300025961 Ga0207712_11540030 Ga0207712_115400301 132
325 3300025972 Ga0207668_10005684 Ga0207668_100056843 132
326 3300025986 Ga0207658_10666014 Ga0207658_106660141 132
327 3300026023 Ga0207677_10214078 Ga0207677_102140782 132
328 3300026023 Ga0207677_11056374 Ga0207677_110563741 132
329 3300026035 Ga0207703_10774694 Ga0207703_107746942 132
330 3300026035 Ga0207703_10815943 Ga0207703_108159431 132
331 3300026035 Ga0207703_10972040 Ga0207703_109720402 132
332 3300026041 Ga0207639_10028380 Ga0207639_100283802 132
333 3300026088 Ga0207641_11146741 Ga0207641_111467411 132
334 3300026089 Ga0207648_10732444 Ga0207648_107324441 132
335 3300026095 Ga0207676_10170951 Ga0207676_101709512 132
336 3300026095 Ga0207676_10998881 Ga0207676_109988811 132
337 3300026116 Ga0207674_10528351 Ga0207674_105283512 132
338 3300026118 Ga0207675_100156608 Ga0207675_1001566082 132
339 3300026118 Ga0207675_100441669 Ga0207675_1004416692 132
340 3300026121 Ga0207683_10077097 Ga0207683_100770972 132
341 3300026142 Ga0207698_10209948 Ga0207698_102099482 132
342 3300027907 Ga0207428_10328029 Ga0207428_103280292 132
343 3300041459 Ga0451800_1239538 Ga0451800_1239538_17_433 132
344 3300041496 Ga0451839_0679563 Ga0451839_0679563_98_502 132
345 3300046525 Ga0495663_0000217 Ga0495663_0000217_19402_19806 132
346 3300046537 Ga0495598_0002956 Ga0495598_0002956_920_1342 132
347 3300046539 Ga0495621_0000008 Ga0495621_0000008_9251_9655 132
348 3300047320 Ga0495672_0057958 Ga0495672_0057958_738_1145 132
349 3300048903 Ga0496100_1577520 Ga0496100_1577520_23_427 132
350 3300048909 Ga0496106_0023640 Ga0496106_0023640_2281_2685 132
351 3300050512 nmdc:mga0n895_383523_c1 nmdc:mga0n895_383523_c1_46_447 132
352 3300050513 nmdc:mga0rr50_1176_c1 nmdc:mga0rr50_1176_c1_1227_1634 132
353 3300050513 nmdc:mga0rr50_194_c1 nmdc:mga0rr50_194_c1_22453_22857 132
354 3300050514 nmdc:mga08x19_12_c1 nmdc:mga08x19_12_c1_106138_106545 132
355 3300050514 nmdc:mga08x19_33_c1 nmdc:mga08x19_33_c1_191181_191597 132
356 3300050514 nmdc:mga08x19_8_c1 nmdc:mga08x19_8_c1_252876_253280 132
357 3300050515 nmdc:mga0a205_130354_c1 nmdc:mga0a205_130354_c1_854_1255 132
358 3300053093 Ga0500651_0329446 Ga0500651_0329446_151_555 132
359 3300061734 Ga0530510_1414898 Ga0530510_1414898_43_450 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05635

23S_rRNA_IVP

23S rRNA-intervening sequence protein

32

137

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gsc-assembly1.cif.gz_D crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.9503 7 119
2f6m-assembly2.cif.gz_C structure of a vps23-c:vps28-n subcomplex 0.9304 62 120
2gsc-assembly1.cif.gz_D crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.9265 7 119
2gsc-assembly1.cif.gz_C crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.9236 7 117
6vme-assembly4.cif.gz_H human escrt-i heterotetramer headpiece 0.9223 62 120
ID Description Score Start End Superfamily
af_K7LHR2_116_185_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9733 63 115 1.10.287.660
af_A0A1D6PIN9_172_240_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9701 63 115 1.10.287.660
af_Q3EBL9_141_209_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9464 63 114 1.10.287.660
2f6mC00 Special;Helix non-globular;Helix Hairpins; 0.9304 62 120 6.10.140.820
2gscA00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9277 5 120 1.20.1440.60
ID Description Score Start End GO Terms
AF-I7A2A3-F1-model_v4 Ribosomal protein S23 0.9988 4 120 GO:0005840
AF-A0A2M8GCJ0-F1-model_v4 Four helix bundle protein 0.9985 4 120
AF-D6STZ5-F1-model_v4 S23 ribosomal protein 0.9981 4 120 GO:0005840
AF-A0A3N5JT07-F1-model_v4 Four helix bundle protein 0.9977 4 119
AF-A0A7C4AM55-F1-model_v4 Four helix bundle protein 0.9975 4 120

Feature Viewer

pLDDT pTM Quality
91.52 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map