F421433
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 359 | 192 | 359 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300005347|Ga0070668_101120403|Ga0070668_1011204031 |
| Length | 185 |
| Sequence | MKLQPREVGLIAAALALIADQGSKLFLLYGAGFMQMPPGESIPVLPFFNLVMVWNPGISYGLFPASGRLGTWLLIGMSVIAIGVLSWLLWRASSRALAIGYGMIIGGALGNNLVDRLVYGKVADFFHFYGFGYDWYVFNIADLAITLGAMAILYDVLKPQPSQEDQTPKDLGPGIWNQGSRANEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 136 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 137 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 138 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 139 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 140 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 141 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 142 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 143 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 145 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 146 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 147 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 151 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 152 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 153 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 154 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 155 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 168 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 169 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 183 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 184 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 185 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 186 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 187 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 188 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 189 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 190 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 191 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 192 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.85 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 91.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000036 | 3300003214 | Bacteria | 286380 |
| 2 | JGI25153J46596_10005159 | 3300003215 | Bacteria | 6880 |
| 3 | Ga0070658_10172261 | 3300005327 | Bacteria | 1818 |
| 4 | Ga0070676_10223434 | 3300005328 | Unclassified | 1245 |
| 5 | Ga0070676_10247591 | 3300005328 | Bacteria | 1188 |
| 6 | Ga0070683_100076315 | 3300005329 | Bacteria | 3132 |
| 7 | Ga0070690_100071294 | 3300005330 | Bacteria | 2258 |
| 8 | Ga0070670_100576011 | 3300005331 | Bacteria | 1006 |
| 9 | Ga0070670_100646336 | 3300005331 | Unclassified | 949 |
| 10 | Ga0070666_10020247 | 3300005335 | Bacteria | 4300 |
| 11 | Ga0070666_10104131 | 3300005335 | Bacteria | 1958 |
| 12 | Ga0070680_100300307 | 3300005336 | Bacteria | 1362 |
| 13 | Ga0068868_100143950 | 3300005338 | Bacteria | 1959 |
| 14 | Ga0068868_100175448 | 3300005338 | Bacteria | 1776 |
| 15 | Ga0068868_100212393 | 3300005338 | Bacteria | 1618 |
| 16 | Ga0070660_100168591 | 3300005339 | Unclassified | 1767 |
| 17 | Ga0070660_100531976 | 3300005339 | Unclassified | 980 |
| 18 | Ga0070661_100065368 | 3300005344 | Bacteria | 2673 |
| 19 | Ga0070661_100072855 | 3300005344 | Bacteria | 2528 |
| 20 | Ga0070661_100132738 | 3300005344 | Bacteria | 1871 |
| 21 | Ga0070692_10400647 | 3300005345 | Bacteria | 866 |
| 22 | Ga0070668_100460469 | 3300005347 | Bacteria | 1095 |
| 23 | Ga0070668_101120403 | 3300005347 | Bacteria | 711 |
| 24 | Ga0070669_100101071 | 3300005353 | Bacteria | 2175 |
| 25 | Ga0070675_100112756 | 3300005354 | Bacteria | 2302 |
| 26 | Ga0070675_100137751 | 3300005354 | Bacteria | 2084 |
| 27 | Ga0070671_100169851 | 3300005355 | Bacteria | 1844 |
| 28 | Ga0070674_100559551 | 3300005356 | Bacteria | 961 |
| 29 | Ga0070674_100567991 | 3300005356 | Bacteria | 954 |
| 30 | Ga0070673_100067687 | 3300005364 | Bacteria | 2857 |
| 31 | Ga0070673_100510774 | 3300005364 | Bacteria | 1088 |
| 32 | Ga0070688_100152867 | 3300005365 | Bacteria | 1579 |
| 33 | Ga0070667_100019018 | 3300005367 | Bacteria | 5695 |
| 34 | Ga0070713_100450382 | 3300005436 | Bacteria | 1209 |
| 35 | Ga0070713_100650465 | 3300005436 | Bacteria | 1004 |
| 36 | Ga0070678_100029113 | 3300005456 | Bacteria | 3778 |
| 37 | Ga0070678_100058087 | 3300005456 | Bacteria | 2838 |
| 38 | Ga0070678_100076411 | 3300005456 | Bacteria | 2523 |
| 39 | Ga0070678_100668763 | 3300005456 | Bacteria | 933 |
| 40 | Ga0070662_100155245 | 3300005457 | Bacteria | 1786 |
| 41 | Ga0070681_10183165 | 3300005458 | Bacteria | 2016 |
| 42 | Ga0070681_10982575 | 3300005458 | Bacteria | 764 |
| 43 | Ga0068867_100065156 | 3300005459 | Bacteria | 2711 |
| 44 | Ga0068867_100591965 | 3300005459 | Unclassified | 966 |
| 45 | Ga0068867_101070417 | 3300005459 | Bacteria | 735 |
| 46 | Ga0070685_10186546 | 3300005466 | Bacteria | 1339 |
| 47 | Ga0070679_100043875 | 3300005530 | Bacteria | 4453 |
| 48 | Ga0070679_101115630 | 3300005530 | Bacteria | 734 |
| 49 | Ga0070684_100037563 | 3300005535 | Bacteria | 4156 |
| 50 | Ga0070684_100301642 | 3300005535 | Bacteria | 1470 |
| 51 | Ga0070684_100474481 | 3300005535 | Bacteria | 1157 |
| 52 | Ga0068853_100012979 | 3300005539 | Bacteria | 6792 |
| 53 | Ga0068853_100041607 | 3300005539 | Bacteria | 3926 |
| 54 | Ga0068853_100064675 | 3300005539 | Bacteria | 3173 |
| 55 | Ga0068853_100256017 | 3300005539 | Bacteria | 1608 |
| 56 | Ga0068853_100481751 | 3300005539 | Bacteria | 1170 |
| 57 | Ga0070672_100302957 | 3300005543 | Bacteria | 1355 |
| 58 | Ga0070672_100707102 | 3300005543 | Bacteria | 882 |
| 59 | Ga0070686_101495995 | 3300005544 | Bacteria | 569 |
| 60 | Ga0070665_100001289 | 3300005548 | Bacteria | 29994 |
| 61 | Ga0070665_100029107 | 3300005548 | Bacteria | 5560 |
| 62 | Ga0070665_100060723 | 3300005548 | Bacteria | 3789 |
| 63 | Ga0070665_100174330 | 3300005548 | Bacteria | 2151 |
| 64 | Ga0070665_100187545 | 3300005548 | Bacteria | 2069 |
| 65 | Ga0070665_101584960 | 3300005548 | Unclassified | 663 |
| 66 | Ga0068855_100328449 | 3300005563 | Bacteria | 1689 |
| 67 | Ga0068855_101365042 | 3300005563 | Bacteria | 731 |
| 68 | Ga0068857_100173997 | 3300005577 | Bacteria | 1958 |
| 69 | Ga0068857_100213549 | 3300005577 | Bacteria | 1761 |
| 70 | Ga0068857_100614916 | 3300005577 | Unclassified | 1028 |
| 71 | Ga0068857_101103683 | 3300005577 | Unclassified | 766 |
| 72 | Ga0068856_100286454 | 3300005614 | Bacteria | 1664 |
| 73 | Ga0068856_100452561 | 3300005614 | Unclassified | 1305 |
| 74 | Ga0068852_100098147 | 3300005616 | Bacteria | 2637 |
| 75 | Ga0068852_100166192 | 3300005616 | Bacteria | 2064 |
| 76 | Ga0068852_101095435 | 3300005616 | Unclassified | 817 |
| 77 | Ga0068859_100274911 | 3300005617 | Bacteria | 1777 |
| 78 | Ga0068864_100156999 | 3300005618 | Bacteria | 2065 |
| 79 | Ga0068866_10057902 | 3300005718 | Bacteria | 1999 |
| 80 | Ga0068866_10118757 | 3300005718 | Bacteria | 1487 |
| 81 | Ga0068861_100117318 | 3300005719 | Bacteria | 2142 |
| 82 | Ga0068861_100150064 | 3300005719 | Unclassified | 1911 |
| 83 | Ga0068851_10171452 | 3300005834 | Bacteria | 1198 |
| 84 | Ga0068870_10282011 | 3300005840 | Bacteria | 1042 |
| 85 | Ga0068863_100055714 | 3300005841 | Bacteria | 3743 |
| 86 | Ga0068858_100301463 | 3300005842 | Bacteria | 1529 |
| 87 | Ga0068858_100325069 | 3300005842 | Bacteria | 1470 |
| 88 | Ga0068858_100364640 | 3300005842 | Bacteria | 1385 |
| 89 | Ga0068860_100107154 | 3300005843 | Bacteria | 2670 |
| 90 | Ga0068860_100979918 | 3300005843 | Bacteria | 863 |
| 91 | Ga0068862_101211150 | 3300005844 | Unclassified | 754 |
| 92 | Ga0070712_100457678 | 3300006175 | Bacteria | 1063 |
| 93 | Ga0097621_100000673 | 3300006237 | Bacteria | 23947 |
| 94 | Ga0097621_100011628 | 3300006237 | Bacteria | 6490 |
| 95 | Ga0097621_100033622 | 3300006237 | Bacteria | 4085 |
| 96 | Ga0097621_100039250 | 3300006237 | Bacteria | 3802 |
| 97 | Ga0097621_100047819 | 3300006237 | Bacteria | 3467 |
| 98 | Ga0068871_100011202 | 3300006358 | Bacteria | 6571 |
| 99 | Ga0068871_100107015 | 3300006358 | Bacteria | 2348 |
| 100 | Ga0068871_100268634 | 3300006358 | Unclassified | 1489 |
| 101 | Ga0068871_100686973 | 3300006358 | Bacteria | 937 |
| 102 | Ga0068871_100777174 | 3300006358 | Unclassified | 881 |
| 103 | Ga0068865_100003490 | 3300006881 | Bacteria | 9423 |
| 104 | Ga0068865_100184971 | 3300006881 | Bacteria | 1607 |
| 105 | Ga0097620_100274919 | 3300006931 | Bacteria | 1777 |
| 106 | Ga0105240_10000320 | 3300009093 | Bacteria | 91422 |
| 107 | Ga0105240_10251172 | 3300009093 | Bacteria | 2045 |
| 108 | Ga0105240_10354973 | 3300009093 | Bacteria | 1662 |
| 109 | Ga0105240_10689785 | 3300009093 | Unclassified | 1116 |
| 110 | Ga0105240_11885502 | 3300009093 | Bacteria | 622 |
| 111 | Ga0105245_10077982 | 3300009098 | Bacteria | 3022 |
| 112 | Ga0105245_10145676 | 3300009098 | Bacteria | 2235 |
| 113 | Ga0105245_10239528 | 3300009098 | Bacteria | 1758 |
| 114 | Ga0105247_10114438 | 3300009101 | Bacteria | 1740 |
| 115 | Ga0105247_10119367 | 3300009101 | Bacteria | 1707 |
| 116 | Ga0105247_10966833 | 3300009101 | Bacteria | 662 |
| 117 | Ga0105243_10019578 | 3300009148 | Bacteria | 5130 |
| 118 | Ga0105243_10226519 | 3300009148 | Unclassified | 1656 |
| 119 | Ga0105243_10505732 | 3300009148 | Bacteria | 1146 |
| 120 | Ga0105241_10096329 | 3300009174 | Bacteria | 2344 |
| 121 | Ga0105241_10209432 | 3300009174 | Bacteria | 1633 |
| 122 | Ga0105241_10267217 | 3300009174 | Unclassified | 1456 |
| 123 | Ga0105241_10397926 | 3300009174 | Unclassified | 1207 |
| 124 | Ga0105242_10394942 | 3300009176 | Bacteria | 1289 |
| 125 | Ga0105248_10089475 | 3300009177 | Bacteria | 3465 |
| 126 | Ga0105248_11648242 | 3300009177 | Unclassified | 727 |
| 127 | Ga0105237_10214049 | 3300009545 | Unclassified | 1927 |
| 128 | Ga0105237_10238834 | 3300009545 | Bacteria | 1818 |
| 129 | Ga0105237_10293571 | 3300009545 | Bacteria | 1628 |
| 130 | Ga0105237_10648317 | 3300009545 | Bacteria | 1063 |
| 131 | Ga0105238_10001160 | 3300009551 | Bacteria | 26566 |
| 132 | Ga0105238_10007037 | 3300009551 | Bacteria | 11248 |
| 133 | Ga0105238_10184195 | 3300009551 | Bacteria | 2065 |
| 134 | Ga0105238_10332175 | 3300009551 | Bacteria | 1507 |
| 135 | Ga0105238_10745137 | 3300009551 | Bacteria | 993 |
| 136 | Ga0105249_10034531 | 3300009553 | Bacteria | 4584 |
| 137 | Ga0105249_10346669 | 3300009553 | Bacteria | 1503 |
| 138 | Ga0105239_10094421 | 3300010375 | Bacteria | 3304 |
| 139 | Ga0105239_10132861 | 3300010375 | Bacteria | 2769 |
| 140 | Ga0105239_10331662 | 3300010375 | Bacteria | 1716 |
| 141 | Ga0105239_10563049 | 3300010375 | Unclassified | 1298 |
| 142 | Ga0105246_10009121 | 3300011119 | Bacteria | 6108 |
| 143 | Ga0105246_10044889 | 3300011119 | Bacteria | 3006 |
| 144 | Ga0105246_10516139 | 3300011119 | Bacteria | 1017 |
| 145 | Ga0157373_10231009 | 3300013100 | Unclassified | 1306 |
| 146 | Ga0157371_10807002 | 3300013102 | Bacteria | 707 |
| 147 | Ga0157370_10865292 | 3300013104 | Bacteria | 821 |
| 148 | Ga0157369_10049793 | 3300013105 | Bacteria | 4540 |
| 149 | Ga0157369_10719719 | 3300013105 | Unclassified | 1027 |
| 150 | Ga0157369_11642678 | 3300013105 | Bacteria | 653 |
| 151 | Ga0157374_10060155 | 3300013296 | Bacteria | 3554 |
| 152 | Ga0157374_10325478 | 3300013296 | Bacteria | 1524 |
| 153 | Ga0157374_10447237 | 3300013296 | Bacteria | 1293 |
| 154 | Ga0157374_10490972 | 3300013296 | Bacteria | 1232 |
| 155 | Ga0157374_10537390 | 3300013296 | Bacteria | 1176 |
| 156 | Ga0157374_12001348 | 3300013296 | Bacteria | 606 |
| 157 | Ga0157378_10018878 | 3300013297 | Bacteria | 6061 |
| 158 | Ga0157378_10038524 | 3300013297 | Bacteria | 4237 |
| 159 | Ga0157378_10322060 | 3300013297 | Bacteria | 1502 |
| 160 | Ga0157378_10360665 | 3300013297 | Unclassified | 1422 |
| 161 | Ga0163162_10026382 | 3300013306 | Bacteria | 5741 |
| 162 | Ga0157372_10030596 | 3300013307 | Bacteria | 5890 |
| 163 | Ga0157372_10090408 | 3300013307 | Bacteria | 3480 |
| 164 | Ga0157375_10042953 | 3300013308 | Bacteria | 4380 |
| 165 | Ga0157375_11952642 | 3300013308 | Bacteria | 697 |
| 166 | Ga0163163_10138765 | 3300014325 | Bacteria | 2473 |
| 167 | Ga0163163_10310234 | 3300014325 | Bacteria | 1630 |
| 168 | Ga0157380_10217561 | 3300014326 | Unclassified | 1707 |
| 169 | Ga0157379_10001454 | 3300014968 | Bacteria | 19485 |
| 170 | Ga0157379_10099229 | 3300014968 | Bacteria | 2614 |
| 171 | Ga0157379_10118385 | 3300014968 | Bacteria | 2382 |
| 172 | Ga0157379_10226196 | 3300014968 | Bacteria | 1696 |
| 173 | Ga0157376_10099206 | 3300014969 | Bacteria | 2540 |
| 174 | Ga0157376_10605033 | 3300014969 | Unclassified | 1091 |
| 175 | Ga0157376_10745880 | 3300014969 | Bacteria | 988 |
| 176 | Ga0157376_10772981 | 3300014969 | Bacteria | 971 |
| 177 | Ga0163161_10009873 | 3300017792 | Bacteria | 6611 |
| 178 | Ga0209563_119395 | 3300025230 | Unclassified | 781 |
| 179 | Ga0207427_104852 | 3300025231 | Bacteria | 2084 |
| 180 | Ga0209233_1000015 | 3300025261 | Bacteria | 980563 |
| 181 | Ga0209455_1009120 | 3300025272 | Bacteria | 2632 |
| 182 | Ga0209758_1000085 | 3300025297 | Bacteria | 256191 |
| 183 | Ga0207656_10186615 | 3300025321 | Bacteria | 997 |
| 184 | Ga0207642_10015558 | 3300025899 | Bacteria | 2839 |
| 185 | Ga0207642_10088761 | 3300025899 | Bacteria | 1522 |
| 186 | Ga0207710_10049904 | 3300025900 | Bacteria | 1876 |
| 187 | Ga0207680_10060584 | 3300025903 | Unclassified | 2304 |
| 188 | Ga0207680_11059080 | 3300025903 | Bacteria | 580 |
| 189 | Ga0207645_10194514 | 3300025907 | Unclassified | 1333 |
| 190 | Ga0207705_10035655 | 3300025909 | Bacteria | 3558 |
| 191 | Ga0207705_10559873 | 3300025909 | Bacteria | 889 |
| 192 | Ga0207654_10219566 | 3300025911 | Bacteria | 1260 |
| 193 | Ga0207654_10284042 | 3300025911 | Bacteria | 1120 |
| 194 | Ga0207654_10293345 | 3300025911 | Bacteria | 1104 |
| 195 | Ga0207654_10800186 | 3300025911 | Unclassified | 681 |
| 196 | Ga0207707_10075503 | 3300025912 | Bacteria | 2941 |
| 197 | Ga0207707_10234682 | 3300025912 | Bacteria | 1596 |
| 198 | Ga0207695_10000227 | 3300025913 | Bacteria | 150546 |
| 199 | Ga0207695_10091199 | 3300025913 | Bacteria | 3062 |
| 200 | Ga0207695_10248330 | 3300025913 | Bacteria | 1679 |
| 201 | Ga0207695_10423823 | 3300025913 | Bacteria | 1215 |
| 202 | Ga0207671_10432570 | 3300025914 | Unclassified | 1047 |
| 203 | Ga0207671_11192502 | 3300025914 | Bacteria | 596 |
| 204 | Ga0207693_10347152 | 3300025915 | Bacteria | 1161 |
| 205 | Ga0207663_10150943 | 3300025916 | Bacteria | 1630 |
| 206 | Ga0207660_10297607 | 3300025917 | Bacteria | 1284 |
| 207 | Ga0207657_10103179 | 3300025919 | Unclassified | 2364 |
| 208 | Ga0207649_10300872 | 3300025920 | Unclassified | 1173 |
| 209 | Ga0207652_10055634 | 3300025921 | Bacteria | 3404 |
| 210 | Ga0207681_10088579 | 3300025923 | Bacteria | 2205 |
| 211 | Ga0207694_10000005 | 3300025924 | Bacteria | 823704 |
| 212 | Ga0207694_10058449 | 3300025924 | Bacteria | 2999 |
| 213 | Ga0207694_10174184 | 3300025924 | Bacteria | 1743 |
| 214 | Ga0207694_10223871 | 3300025924 | Bacteria | 1535 |
| 215 | Ga0207650_10216414 | 3300025925 | Bacteria | 1540 |
| 216 | Ga0207650_10722402 | 3300025925 | Bacteria | 842 |
| 217 | Ga0207650_10883054 | 3300025925 | Bacteria | 759 |
| 218 | Ga0207659_10266106 | 3300025926 | Bacteria | 1397 |
| 219 | Ga0207659_10299854 | 3300025926 | Unclassified | 1319 |
| 220 | Ga0207687_10149049 | 3300025927 | Bacteria | 1783 |
| 221 | Ga0207687_10370175 | 3300025927 | Bacteria | 1171 |
| 222 | Ga0207687_10553201 | 3300025927 | Bacteria | 966 |
| 223 | Ga0207700_11099791 | 3300025928 | Bacteria | 711 |
| 224 | Ga0207644_10130089 | 3300025931 | Bacteria | 1926 |
| 225 | Ga0207690_10412609 | 3300025932 | Bacteria | 1079 |
| 226 | Ga0207706_10121288 | 3300025933 | Bacteria | 2299 |
| 227 | Ga0207686_10039901 | 3300025934 | Bacteria | 2851 |
| 228 | Ga0207686_10071164 | 3300025934 | Bacteria | 2237 |
| 229 | Ga0207686_10107510 | 3300025934 | Bacteria | 1875 |
| 230 | Ga0207709_10071331 | 3300025935 | Bacteria | 2205 |
| 231 | Ga0207669_10267060 | 3300025937 | Bacteria | 1283 |
| 232 | Ga0207704_10144465 | 3300025938 | Unclassified | 1669 |
| 233 | Ga0207704_10405950 | 3300025938 | Unclassified | 1076 |
| 234 | Ga0207691_10358274 | 3300025940 | Bacteria | 1247 |
| 235 | Ga0207691_10770551 | 3300025940 | Bacteria | 809 |
| 236 | Ga0207689_10060873 | 3300025942 | Bacteria | 3105 |
| 237 | Ga0207689_10091891 | 3300025942 | Bacteria | 2493 |
| 238 | Ga0207679_11004836 | 3300025945 | Bacteria | 764 |
| 239 | Ga0207667_10000011 | 3300025949 | Bacteria | 447785 |
| 240 | Ga0207667_10193176 | 3300025949 | Bacteria | 2088 |
| 241 | Ga0207667_10396000 | 3300025949 | Unclassified | 1406 |
| 242 | Ga0207667_11405760 | 3300025949 | Unclassified | 671 |
| 243 | Ga0207651_10076845 | 3300025960 | Bacteria | 2388 |
| 244 | Ga0207712_11043241 | 3300025961 | Unclassified | 726 |
| 245 | Ga0207668_10129016 | 3300025972 | Bacteria | 1928 |
| 246 | Ga0207677_10106428 | 3300026023 | Bacteria | 2078 |
| 247 | Ga0207703_10337892 | 3300026035 | Bacteria | 1383 |
| 248 | Ga0207639_10009974 | 3300026041 | Bacteria | 6565 |
| 249 | Ga0207639_10307918 | 3300026041 | Bacteria | 1402 |
| 250 | Ga0207639_10408666 | 3300026041 | Bacteria | 1224 |
| 251 | Ga0207639_10645540 | 3300026041 | Bacteria | 979 |
| 252 | Ga0207702_10265608 | 3300026078 | Bacteria | 1617 |
| 253 | Ga0207702_10346727 | 3300026078 | Bacteria | 1420 |
| 254 | Ga0207641_10047013 | 3300026088 | Bacteria | 3638 |
| 255 | Ga0207648_10033772 | 3300026089 | Bacteria | 4511 |
| 256 | Ga0207648_10123993 | 3300026089 | Bacteria | 2272 |
| 257 | Ga0207676_10561860 | 3300026095 | Bacteria | 1091 |
| 258 | Ga0207674_10112933 | 3300026116 | Bacteria | 2690 |
| 259 | Ga0207674_10130842 | 3300026116 | Bacteria | 2473 |
| 260 | Ga0207674_11000081 | 3300026116 | Unclassified | 805 |
| 261 | Ga0207675_100108385 | 3300026118 | Bacteria | 2619 |
| 262 | Ga0207683_10031860 | 3300026121 | Bacteria | 4578 |
| 263 | Ga0207683_10246924 | 3300026121 | Bacteria | 1628 |
| 264 | Ga0207698_10001445 | 3300026142 | Bacteria | 13809 |
| 265 | Ga0207698_10203022 | 3300026142 | Bacteria | 1777 |
| 266 | Ga0207698_11336099 | 3300026142 | Bacteria | 732 |
| 267 | Ga0268266_10001375 | 3300028379 | Bacteria | 29309 |
| 268 | Ga0268266_10016478 | 3300028379 | Bacteria | 6318 |
| 269 | Ga0268266_10051387 | 3300028379 | Bacteria | 3538 |
| 270 | Ga0268266_10175941 | 3300028379 | Bacteria | 1945 |
| 271 | Ga0268266_10189041 | 3300028379 | Bacteria | 1879 |
| 272 | Ga0268266_11529594 | 3300028379 | Bacteria | 643 |
| 273 | Ga0268265_10748318 | 3300028380 | Unclassified | 948 |
| 274 | Ga0265338_10104896 | 3300028800 | Bacteria | 2292 |
| 275 | Ga0265330_10077243 | 3300031235 | Bacteria | 1437 |
| 276 | Ga0265325_10002251 | 3300031241 | Bacteria | 13077 |
| 277 | Ga0265329_10049018 | 3300031242 | Unclassified | 1347 |
| 278 | Ga0265340_10000371 | 3300031247 | Bacteria | 23812 |
| 279 | Ga0265339_10090133 | 3300031249 | Bacteria | 1608 |
| 280 | Ga0265331_10031296 | 3300031250 | Bacteria | 2644 |
| 281 | Ga0265316_10001627 | 3300031344 | Bacteria | 23924 |
| 282 | Ga0265316_10029942 | 3300031344 | Bacteria | 4469 |
| 283 | Ga0265316_10283947 | 3300031344 | Bacteria | 1209 |
| 284 | Ga0307513_10228881 | 3300031456 | Bacteria | 1673 |
| 285 | Ga0265313_10017265 | 3300031595 | Bacteria | 4109 |
| 286 | Ga0265313_10018731 | 3300031595 | Bacteria | 3878 |
| 287 | Ga0265314_10038319 | 3300031711 | Bacteria | 3464 |
| 288 | Ga0265314_10043436 | 3300031711 | Bacteria | 3196 |
| 289 | Ga0265314_10090249 | 3300031711 | Bacteria | 1997 |
| 290 | Ga0265342_10027051 | 3300031712 | Bacteria | 3590 |
| 291 | Ga0307516_10017029 | 3300031730 | Bacteria | 7589 |
| 292 | Ga0307510_10381807 | 3300033180 | Bacteria | 854 |
| 293 | Ga0373937_0683884 | 3300036401 | Bacteria | 972 |
| 294 | Ga0395900_0459548 | 3300037418 | Bacteria | 1228 |
| 295 | Ga0395898_0082386 | 3300037466 | Bacteria | 3101 |
| 296 | Ga0395901_0039206 | 3300038443 | Bacteria | 4902 |
| 297 | Ga0436365_0507621 | 3300039437 | Bacteria | 122643 |
| 298 | Ga0436365_0972936 | 3300039437 | Bacteria | 2353 |
| 299 | Ga0436365_1338454 | 3300039437 | Bacteria | 115168 |
| 300 | Ga0436360_0457407 | 3300039438 | Unclassified | 1064 |
| 301 | Ga0466957_0261367 | 3300044842 | Unclassified | 1154 |
| 302 | Ga0466957_0459186 | 3300044842 | Bacteria | 878 |
| 303 | Ga0466967_0340894 | 3300045976 | Bacteria | 1449 |
| 304 | Ga0495629_0347457 | 3300046459 | Bacteria | 1012 |
| 305 | Ga0495651_0516372 | 3300046462 | Bacteria | 763 |
| 306 | Ga0495653_0398949 | 3300046463 | Bacteria | 875 |
| 307 | Ga0495585_0154897 | 3300046492 | Bacteria | 1193 |
| 308 | Ga0495621_0092677 | 3300046539 | Bacteria | 1140 |
| 309 | Ga0495645_0122854 | 3300046543 | Bacteria | 1827 |
| 310 | Ga0495622_0022499 | 3300046557 | Bacteria | 2937 |
| 311 | Ga0495625_0158830 | 3300046660 | Bacteria | 1516 |
| 312 | Ga0495635_0497351 | 3300046663 | Bacteria | 803 |
| 313 | Ga0495661_0067898 | 3300046665 | Bacteria | 2093 |
| 314 | Ga0495670_0044719 | 3300046691 | Bacteria | 2211 |
| 315 | Ga0495672_0149825 | 3300047320 | Unclassified | 1211 |
| 316 | Ga0496121_0000483 | 3300048924 | Bacteria | 77162 |
| 317 | Ga0496126_0013807 | 3300048929 | Bacteria | 8190 |
| 318 | Ga0495682_0001215 | 3300049460 | Bacteria | 14645 |
| 319 | Ga0501032_0076864 | 3300049569 | Bacteria | 2223 |
| 320 | Ga0501033_0023210 | 3300049570 | Bacteria | 4679 |
| 321 | Ga0501033_0122806 | 3300049570 | Bacteria | 1883 |
| 322 | Ga0501034_0100862 | 3300049571 | Bacteria | 2881 |
| 323 | Ga0501034_0335578 | 3300049571 | Unclassified | 1443 |
| 324 | Ga0501034_0349237 | 3300049571 | Bacteria | 1408 |
| 325 | Ga0501038_0327540 | 3300049574 | Archaea | 1197 |
| 326 | Ga0501038_0537241 | 3300049574 | Bacteria | 890 |
| 327 | Ga0501043_0142512 | 3300049579 | Bacteria | 1876 |
| 328 | Ga0501043_0311517 | 3300049579 | Unclassified | 1201 |
| 329 | Ga0501046_0066719 | 3300049580 | Bacteria | 2804 |
| 330 | Ga0501046_0324169 | 3300049580 | Bacteria | 1122 |
| 331 | Ga0501047_0050781 | 3300049581 | Bacteria | 4005 |
| 332 | Ga0501047_0101496 | 3300049581 | Bacteria | 2757 |
| 333 | Ga0501047_0290640 | 3300049581 | Bacteria | 1478 |
| 334 | Ga0501047_0300460 | 3300049581 | Bacteria | 1448 |
| 335 | Ga0501047_0518016 | 3300049581 | Bacteria | 1018 |
| 336 | Ga0501072_0303181 | 3300049588 | Bacteria | 1270 |
| 337 | Ga0501080_0033382 | 3300049742 | Bacteria | 4803 |
| 338 | Ga0501080_0461530 | 3300049742 | Bacteria | 1138 |
| 339 | Ga0501083_0068416 | 3300049744 | Bacteria | 2363 |
| 340 | Ga0501035_0015943 | 3300049822 | Bacteria | 6935 |
| 341 | Ga0501035_0283247 | 3300049822 | Bacteria | 1400 |
| 342 | Ga0501044_0064427 | 3300049823 | Bacteria | 3742 |
| 343 | Ga0501044_0097014 | 3300049823 | Bacteria | 2969 |
| 344 | Ga0501044_0310535 | 3300049823 | Bacteria | 1503 |
| 345 | Ga0500643_000003 | 3300053087 | Bacteria | 876659 |
| 346 | Ga0500566_0194363 | 3300053094 | Bacteria | 1030 |
| 347 | Ga0500555_010595 | 3300053103 | Bacteria | 2646 |
| 348 | Ga0500595_001583 | 3300053119 | Bacteria | 12003 |
| 349 | Ga0500595_004834 | 3300053119 | Bacteria | 5959 |
| 350 | Ga0500595_042050 | 3300053119 | Bacteria | 1465 |
| 351 | Ga0500655_008301 | 3300053133 | Bacteria | 1869 |
| 352 | Ga0500655_064919 | 3300053133 | Unclassified | 739 |
| 353 | Ga0500559_0043386 | 3300053136 | Bacteria | 1964 |
| 354 | Ga0500559_0249744 | 3300053136 | Bacteria | 836 |
| 355 | Ga0500568_0048956 | 3300053139 | Bacteria | 1669 |
| 356 | Ga0500588_0019521 | 3300053146 | Unclassified | 1804 |
| 357 | Ga0500639_108544 | 3300053163 | Bacteria | 1354 |
| 358 | Ga0500645_045614 | 3300053730 | Unclassified | 1288 |
| 359 | Ga0501082_0042527 | 3300060353 | Bacteria | 3917 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013296 | Ga0157374_10447237 | Ga0157374_104472372 | 153 |
| 2 | 3300053133 | Ga0500655_064919 | Ga0500655_064919_22_483 | 153 |
| 3 | 3300046462 | Ga0495651_0516372 | Ga0495651_0516372_269_745 | 157 |
| 4 | 3300006175 | Ga0070712_100457678 | Ga0070712_1004576782 | 160 |
| 5 | 3300025915 | Ga0207693_10347152 | Ga0207693_103471522 | 160 |
| 6 | 3300031241 | Ga0265325_10002251 | Ga0265325_100022514 | 162 |
| 7 | 3300031344 | Ga0265316_10283947 | Ga0265316_102839472 | 162 |
| 8 | 3300031595 | Ga0265313_10018731 | Ga0265313_100187313 | 162 |
| 9 | 3300049579 | Ga0501043_0311517 | Ga0501043_0311517_553_1047 | 162 |
| 10 | 3300005347 | Ga0070668_100460469 | Ga0070668_1004604692 | 163 |
| 11 | 3300005844 | Ga0068862_101211150 | Ga0068862_1012111502 | 163 |
| 12 | 3300009093 | Ga0105240_11885502 | Ga0105240_118855021 | 163 |
| 13 | 3300025972 | Ga0207668_10129016 | Ga0207668_101290163 | 163 |
| 14 | 3300028380 | Ga0268265_10748318 | Ga0268265_107483182 | 163 |
| 15 | 3300047320 | Ga0495672_0149825 | Ga0495672_0149825_14_505 | 163 |
| 16 | 3300049571 | Ga0501034_0349237 | Ga0501034_0349237_689_1186 | 163 |
| 17 | 3300049588 | Ga0501072_0303181 | Ga0501072_0303181_131_628 | 163 |
| 18 | 3300049742 | Ga0501080_0461530 | Ga0501080_0461530_349_846 | 163 |
| 19 | 3300049744 | Ga0501083_0068416 | Ga0501083_0068416_155_652 | 163 |
| 20 | 3300053087 | Ga0500643_000003 | Ga0500643_000003_859088_859579 | 163 |
| 21 | 3300053139 | Ga0500568_0048956 | Ga0500568_0048956_301_792 | 163 |
| 22 | 3300053730 | Ga0500645_045614 | Ga0500645_045614_440_931 | 163 |
| 23 | 3300060353 | Ga0501082_0042527 | Ga0501082_0042527_2466_2963 | 163 |
| 24 | 3300005344 | Ga0070661_100065368 | Ga0070661_1000653683 | 164 |
| 25 | 3300005539 | Ga0068853_100012979 | Ga0068853_1000129793 | 164 |
| 26 | 3300005563 | Ga0068855_100328449 | Ga0068855_1003284493 | 164 |
| 27 | 3300005577 | Ga0068857_100614916 | Ga0068857_1006149162 | 164 |
| 28 | 3300005614 | Ga0068856_100452561 | Ga0068856_1004525612 | 164 |
| 29 | 3300005616 | Ga0068852_100098147 | Ga0068852_1000981473 | 164 |
| 30 | 3300005616 | Ga0068852_101095435 | Ga0068852_1010954351 | 164 |
| 31 | 3300006358 | Ga0068871_100686973 | Ga0068871_1006869732 | 164 |
| 32 | 3300009093 | Ga0105240_10000320 | Ga0105240_1000032033 | 164 |
| 33 | 3300009101 | Ga0105247_10114438 | Ga0105247_101144382 | 164 |
| 34 | 3300009545 | Ga0105237_10214049 | Ga0105237_102140493 | 164 |
| 35 | 3300009545 | Ga0105237_10648317 | Ga0105237_106483171 | 164 |
| 36 | 3300009551 | Ga0105238_10001160 | Ga0105238_100011604 | 164 |
| 37 | 3300013105 | Ga0157369_10719719 | Ga0157369_107197192 | 164 |
| 38 | 3300025900 | Ga0207710_10049904 | Ga0207710_100499043 | 164 |
| 39 | 3300025911 | Ga0207654_10219566 | Ga0207654_102195662 | 164 |
| 40 | 3300025912 | Ga0207707_10234682 | Ga0207707_102346822 | 164 |
| 41 | 3300025913 | Ga0207695_10000227 | Ga0207695_1000022790 | 164 |
| 42 | 3300025914 | Ga0207671_10432570 | Ga0207671_104325702 | 164 |
| 43 | 3300025920 | Ga0207649_10300872 | Ga0207649_103008722 | 164 |
| 44 | 3300025924 | Ga0207694_10000005 | Ga0207694_10000005528 | 164 |
| 45 | 3300025949 | Ga0207667_10000011 | Ga0207667_1000001160 | 164 |
| 46 | 3300025949 | Ga0207667_11405760 | Ga0207667_114057602 | 164 |
| 47 | 3300026041 | Ga0207639_10009974 | Ga0207639_100099742 | 164 |
| 48 | 3300026142 | Ga0207698_10001445 | Ga0207698_1000144512 | 164 |
| 49 | 3300026142 | Ga0207698_10203022 | Ga0207698_102030222 | 164 |
| 50 | 3300031247 | Ga0265340_10000371 | Ga0265340_100003714 | 164 |
| 51 | 3300031344 | Ga0265316_10001627 | Ga0265316_1000162711 | 164 |
| 52 | 3300031344 | Ga0265316_10029942 | Ga0265316_100299422 | 164 |
| 53 | 3300031595 | Ga0265313_10017265 | Ga0265313_100172652 | 164 |
| 54 | 3300031711 | Ga0265314_10043436 | Ga0265314_100434362 | 164 |
| 55 | 3300031712 | Ga0265342_10027051 | Ga0265342_100270512 | 164 |
| 56 | 3300031730 | Ga0307516_10017029 | Ga0307516_100170297 | 164 |
| 57 | 3300037418 | Ga0395900_0459548 | Ga0395900_0459548_291_788 | 164 |
| 58 | 3300037466 | Ga0395898_0082386 | Ga0395898_0082386_223_720 | 164 |
| 59 | 3300038443 | Ga0395901_0039206 | Ga0395901_0039206_1125_1622 | 164 |
| 60 | 3300046543 | Ga0495645_0122854 | Ga0495645_0122854_769_1284 | 164 |
| 61 | 3300049460 | Ga0495682_0001215 | Ga0495682_0001215_163_678 | 164 |
| 62 | 3300049742 | Ga0501080_0033382 | Ga0501080_0033382_2031_2528 | 164 |
| 63 | 3300053133 | Ga0500655_008301 | Ga0500655_008301_1132_1647 | 164 |
| 64 | 3300003215 | JGI25153J46596_10005159 | JGI25153J46596_100051591 | 166 |
| 65 | 3300005548 | Ga0070665_100187545 | Ga0070665_1001875453 | 166 |
| 66 | 3300005577 | Ga0068857_101103683 | Ga0068857_1011036832 | 166 |
| 67 | 3300009174 | Ga0105241_10209432 | Ga0105241_102094322 | 166 |
| 68 | 3300011119 | Ga0105246_10516139 | Ga0105246_105161392 | 166 |
| 69 | 3300013297 | Ga0157378_10018878 | Ga0157378_100188785 | 166 |
| 70 | 3300014968 | Ga0157379_10118385 | Ga0157379_101183852 | 166 |
| 71 | 3300025230 | Ga0209563_119395 | Ga0209563_1193952 | 166 |
| 72 | 3300025272 | Ga0209455_1009120 | Ga0209455_10091203 | 166 |
| 73 | 3300025297 | Ga0209758_1000085 | Ga0209758_1000085155 | 166 |
| 74 | 3300025916 | Ga0207663_10150943 | Ga0207663_101509432 | 166 |
| 75 | 3300025927 | Ga0207687_10370175 | Ga0207687_103701752 | 166 |
| 76 | 3300025945 | Ga0207679_11004836 | Ga0207679_110048361 | 166 |
| 77 | 3300026116 | Ga0207674_11000081 | Ga0207674_110000812 | 166 |
| 78 | 3300046660 | Ga0495625_0158830 | Ga0495625_0158830_60_560 | 166 |
| 79 | 3300049581 | Ga0501047_0300460 | Ga0501047_0300460_808_1329 | 166 |
| 80 | 3300005328 | Ga0070676_10223434 | Ga0070676_102234342 | 167 |
| 81 | 3300005331 | Ga0070670_100576011 | Ga0070670_1005760111 | 167 |
| 82 | 3300005338 | Ga0068868_100143950 | Ga0068868_1001439502 | 167 |
| 83 | 3300005344 | Ga0070661_100132738 | Ga0070661_1001327382 | 167 |
| 84 | 3300005345 | Ga0070692_10400647 | Ga0070692_104006472 | 167 |
| 85 | 3300005353 | Ga0070669_100101071 | Ga0070669_1001010712 | 167 |
| 86 | 3300005354 | Ga0070675_100137751 | Ga0070675_1001377512 | 167 |
| 87 | 3300005356 | Ga0070674_100559551 | Ga0070674_1005595511 | 167 |
| 88 | 3300005364 | Ga0070673_100067687 | Ga0070673_1000676872 | 167 |
| 89 | 3300005436 | Ga0070713_100650465 | Ga0070713_1006504652 | 167 |
| 90 | 3300005456 | Ga0070678_100058087 | Ga0070678_1000580873 | 167 |
| 91 | 3300005456 | Ga0070678_100076411 | Ga0070678_1000764112 | 167 |
| 92 | 3300005457 | Ga0070662_100155245 | Ga0070662_1001552451 | 167 |
| 93 | 3300005459 | Ga0068867_100591965 | Ga0068867_1005919651 | 167 |
| 94 | 3300005535 | Ga0070684_100301642 | Ga0070684_1003016422 | 167 |
| 95 | 3300005539 | Ga0068853_100481751 | Ga0068853_1004817512 | 167 |
| 96 | 3300005543 | Ga0070672_100302957 | Ga0070672_1003029572 | 167 |
| 97 | 3300005548 | Ga0070665_100029107 | Ga0070665_1000291074 | 167 |
| 98 | 3300005548 | Ga0070665_100174330 | Ga0070665_1001743302 | 167 |
| 99 | 3300005577 | Ga0068857_100213549 | Ga0068857_1002135492 | 167 |
| 100 | 3300005718 | Ga0068866_10118757 | Ga0068866_101187572 | 167 |
| 101 | 3300005719 | Ga0068861_100117318 | Ga0068861_1001173182 | 167 |
| 102 | 3300005841 | Ga0068863_100055714 | Ga0068863_1000557142 | 167 |
| 103 | 3300005842 | Ga0068858_100325069 | Ga0068858_1003250692 | 167 |
| 104 | 3300005843 | Ga0068860_100979918 | Ga0068860_1009799182 | 167 |
| 105 | 3300006237 | Ga0097621_100047819 | Ga0097621_1000478192 | 167 |
| 106 | 3300006358 | Ga0068871_100268634 | Ga0068871_1002686342 | 167 |
| 107 | 3300006358 | Ga0068871_100777174 | Ga0068871_1007771742 | 167 |
| 108 | 3300006881 | Ga0068865_100184971 | Ga0068865_1001849712 | 167 |
| 109 | 3300009093 | Ga0105240_10354973 | Ga0105240_103549732 | 167 |
| 110 | 3300009098 | Ga0105245_10077982 | Ga0105245_100779823 | 167 |
| 111 | 3300009098 | Ga0105245_10239528 | Ga0105245_102395282 | 167 |
| 112 | 3300009101 | Ga0105247_10119367 | Ga0105247_101193672 | 167 |
| 113 | 3300009148 | Ga0105243_10019578 | Ga0105243_100195782 | 167 |
| 114 | 3300009174 | Ga0105241_10397926 | Ga0105241_103979262 | 167 |
| 115 | 3300009545 | Ga0105237_10293571 | Ga0105237_102935712 | 167 |
| 116 | 3300009551 | Ga0105238_10184195 | Ga0105238_101841952 | 167 |
| 117 | 3300009551 | Ga0105238_10332175 | Ga0105238_103321752 | 167 |
| 118 | 3300009553 | Ga0105249_10034531 | Ga0105249_100345314 | 167 |
| 119 | 3300010375 | Ga0105239_10094421 | Ga0105239_100944212 | 167 |
| 120 | 3300010375 | Ga0105239_10331662 | Ga0105239_103316622 | 167 |
| 121 | 3300010375 | Ga0105239_10563049 | Ga0105239_105630492 | 167 |
| 122 | 3300011119 | Ga0105246_10044889 | Ga0105246_100448893 | 167 |
| 123 | 3300013105 | Ga0157369_11642678 | Ga0157369_116426781 | 167 |
| 124 | 3300013296 | Ga0157374_10325478 | Ga0157374_103254782 | 167 |
| 125 | 3300013296 | Ga0157374_10490972 | Ga0157374_104909722 | 167 |
| 126 | 3300013297 | Ga0157378_10322060 | Ga0157378_103220602 | 167 |
| 127 | 3300013297 | Ga0157378_10360665 | Ga0157378_103606652 | 167 |
| 128 | 3300013308 | Ga0157375_11952642 | Ga0157375_119526421 | 167 |
| 129 | 3300014325 | Ga0163163_10138765 | Ga0163163_101387653 | 167 |
| 130 | 3300014968 | Ga0157379_10099229 | Ga0157379_100992292 | 167 |
| 131 | 3300014969 | Ga0157376_10605033 | Ga0157376_106050332 | 167 |
| 132 | 3300014969 | Ga0157376_10745880 | Ga0157376_107458802 | 167 |
| 133 | 3300025899 | Ga0207642_10088761 | Ga0207642_100887612 | 167 |
| 134 | 3300025903 | Ga0207680_11059080 | Ga0207680_110590801 | 167 |
| 135 | 3300025907 | Ga0207645_10194514 | Ga0207645_101945142 | 167 |
| 136 | 3300025913 | Ga0207695_10248330 | Ga0207695_102483303 | 167 |
| 137 | 3300025914 | Ga0207671_11192502 | Ga0207671_111925021 | 167 |
| 138 | 3300025919 | Ga0207657_10103179 | Ga0207657_101031792 | 167 |
| 139 | 3300025923 | Ga0207681_10088579 | Ga0207681_100885792 | 167 |
| 140 | 3300025924 | Ga0207694_10174184 | Ga0207694_101741843 | 167 |
| 141 | 3300025925 | Ga0207650_10216414 | Ga0207650_102164142 | 167 |
| 142 | 3300025925 | Ga0207650_10883054 | Ga0207650_108830542 | 167 |
| 143 | 3300025926 | Ga0207659_10299854 | Ga0207659_102998542 | 167 |
| 144 | 3300025927 | Ga0207687_10149049 | Ga0207687_101490491 | 167 |
| 145 | 3300025928 | Ga0207700_11099791 | Ga0207700_110997912 | 167 |
| 146 | 3300025933 | Ga0207706_10121288 | Ga0207706_101212882 | 167 |
| 147 | 3300025934 | Ga0207686_10071164 | Ga0207686_100711643 | 167 |
| 148 | 3300025937 | Ga0207669_10267060 | Ga0207669_102670602 | 167 |
| 149 | 3300025940 | Ga0207691_10358274 | Ga0207691_103582742 | 167 |
| 150 | 3300025942 | Ga0207689_10060873 | Ga0207689_100608733 | 167 |
| 151 | 3300025960 | Ga0207651_10076845 | Ga0207651_100768452 | 167 |
| 152 | 3300025961 | Ga0207712_11043241 | Ga0207712_110432412 | 167 |
| 153 | 3300026023 | Ga0207677_10106428 | Ga0207677_101064282 | 167 |
| 154 | 3300026041 | Ga0207639_10645540 | Ga0207639_106455402 | 167 |
| 155 | 3300026078 | Ga0207702_10346727 | Ga0207702_103467273 | 167 |
| 156 | 3300026088 | Ga0207641_10047013 | Ga0207641_100470132 | 167 |
| 157 | 3300026089 | Ga0207648_10033772 | Ga0207648_100337724 | 167 |
| 158 | 3300026089 | Ga0207648_10123993 | Ga0207648_101239933 | 167 |
| 159 | 3300026116 | Ga0207674_10130842 | Ga0207674_101308422 | 167 |
| 160 | 3300026118 | Ga0207675_100108385 | Ga0207675_1001083853 | 167 |
| 161 | 3300026121 | Ga0207683_10031860 | Ga0207683_100318603 | 167 |
| 162 | 3300026121 | Ga0207683_10246924 | Ga0207683_102469241 | 167 |
| 163 | 3300028379 | Ga0268266_10016478 | Ga0268266_100164782 | 167 |
| 164 | 3300028379 | Ga0268266_10051387 | Ga0268266_100513872 | 167 |
| 165 | 3300031711 | Ga0265314_10090249 | Ga0265314_100902492 | 167 |
| 166 | 3300033180 | Ga0307510_10381807 | Ga0307510_103818072 | 167 |
| 167 | 3300039437 | Ga0436365_0507621 | Ga0436365_0507621_21687_22217 | 167 |
| 168 | 3300039437 | Ga0436365_0972936 | Ga0436365_0972936_949_1461 | 167 |
| 169 | 3300046463 | Ga0495653_0398949 | Ga0495653_0398949_201_719 | 167 |
| 170 | 3300046492 | Ga0495585_0154897 | Ga0495585_0154897_633_1142 | 167 |
| 171 | 3300046539 | Ga0495621_0092677 | Ga0495621_0092677_321_830 | 167 |
| 172 | 3300046665 | Ga0495661_0067898 | Ga0495661_0067898_474_983 | 167 |
| 173 | 3300046691 | Ga0495670_0044719 | Ga0495670_0044719_881_1390 | 167 |
| 174 | 3300049570 | Ga0501033_0122806 | Ga0501033_0122806_708_1238 | 167 |
| 175 | 3300049571 | Ga0501034_0335578 | Ga0501034_0335578_418_948 | 167 |
| 176 | 3300049580 | Ga0501046_0066719 | Ga0501046_0066719_1857_2387 | 167 |
| 177 | 3300049581 | Ga0501047_0050781 | Ga0501047_0050781_1030_1560 | 167 |
| 178 | 3300049581 | Ga0501047_0290640 | Ga0501047_0290640_288_797 | 167 |
| 179 | 3300049822 | Ga0501035_0015943 | Ga0501035_0015943_4208_4738 | 167 |
| 180 | 3300049823 | Ga0501044_0097014 | Ga0501044_0097014_582_1112 | 167 |
| 181 | 3300053136 | Ga0500559_0249744 | Ga0500559_0249744_34_552 | 167 |
| 182 | 3300053163 | Ga0500639_108544 | Ga0500639_108544_679_1197 | 167 |
| 183 | 3300005328 | Ga0070676_10247591 | Ga0070676_102475912 | 168 |
| 184 | 3300005335 | Ga0070666_10020247 | Ga0070666_100202473 | 168 |
| 185 | 3300005336 | Ga0070680_100300307 | Ga0070680_1003003072 | 168 |
| 186 | 3300005339 | Ga0070660_100168591 | Ga0070660_1001685912 | 168 |
| 187 | 3300005339 | Ga0070660_100531976 | Ga0070660_1005319761 | 168 |
| 188 | 3300005356 | Ga0070674_100567991 | Ga0070674_1005679912 | 168 |
| 189 | 3300005436 | Ga0070713_100450382 | Ga0070713_1004503822 | 168 |
| 190 | 3300005458 | Ga0070681_10183165 | Ga0070681_101831652 | 168 |
| 191 | 3300005459 | Ga0068867_101070417 | Ga0068867_1010704172 | 168 |
| 192 | 3300005530 | Ga0070679_100043875 | Ga0070679_1000438753 | 168 |
| 193 | 3300005535 | Ga0070684_100037563 | Ga0070684_1000375632 | 168 |
| 194 | 3300005539 | Ga0068853_100041607 | Ga0068853_1000416073 | 168 |
| 195 | 3300005539 | Ga0068853_100064675 | Ga0068853_1000646754 | 168 |
| 196 | 3300005544 | Ga0070686_101495995 | Ga0070686_1014959951 | 168 |
| 197 | 3300005548 | Ga0070665_100001289 | Ga0070665_10000128919 | 168 |
| 198 | 3300005548 | Ga0070665_100060723 | Ga0070665_1000607233 | 168 |
| 199 | 3300006237 | Ga0097621_100039250 | Ga0097621_1000392504 | 168 |
| 200 | 3300006358 | Ga0068871_100011202 | Ga0068871_1000112022 | 168 |
| 201 | 3300009174 | Ga0105241_10267217 | Ga0105241_102672173 | 168 |
| 202 | 3300009551 | Ga0105238_10745137 | Ga0105238_107451372 | 168 |
| 203 | 3300013100 | Ga0157373_10231009 | Ga0157373_102310092 | 168 |
| 204 | 3300013104 | Ga0157370_10865292 | Ga0157370_108652922 | 168 |
| 205 | 3300013307 | Ga0157372_10030596 | Ga0157372_100305963 | 168 |
| 206 | 3300025903 | Ga0207680_10060584 | Ga0207680_100605842 | 168 |
| 207 | 3300025909 | Ga0207705_10035655 | Ga0207705_100356552 | 168 |
| 208 | 3300025909 | Ga0207705_10559873 | Ga0207705_105598732 | 168 |
| 209 | 3300025911 | Ga0207654_10284042 | Ga0207654_102840422 | 168 |
| 210 | 3300025912 | Ga0207707_10075503 | Ga0207707_100755032 | 168 |
| 211 | 3300025913 | Ga0207695_10091199 | Ga0207695_100911994 | 168 |
| 212 | 3300025917 | Ga0207660_10297607 | Ga0207660_102976072 | 168 |
| 213 | 3300025921 | Ga0207652_10055634 | Ga0207652_100556342 | 168 |
| 214 | 3300025924 | Ga0207694_10223871 | Ga0207694_102238712 | 168 |
| 215 | 3300025932 | Ga0207690_10412609 | Ga0207690_104126092 | 168 |
| 216 | 3300025938 | Ga0207704_10405950 | Ga0207704_104059502 | 168 |
| 217 | 3300025949 | Ga0207667_10396000 | Ga0207667_103960002 | 168 |
| 218 | 3300026041 | Ga0207639_10307918 | Ga0207639_103079182 | 168 |
| 219 | 3300026041 | Ga0207639_10408666 | Ga0207639_104086662 | 168 |
| 220 | 3300028379 | Ga0268266_10001375 | Ga0268266_100013759 | 168 |
| 221 | 3300028379 | Ga0268266_10175941 | Ga0268266_101759411 | 168 |
| 222 | 3300028800 | Ga0265338_10104896 | Ga0265338_101048962 | 168 |
| 223 | 3300031235 | Ga0265330_10077243 | Ga0265330_100772432 | 168 |
| 224 | 3300031242 | Ga0265329_10049018 | Ga0265329_100490182 | 168 |
| 225 | 3300031249 | Ga0265339_10090133 | Ga0265339_100901332 | 168 |
| 226 | 3300031250 | Ga0265331_10031296 | Ga0265331_100312962 | 168 |
| 227 | 3300031456 | Ga0307513_10228881 | Ga0307513_102288812 | 168 |
| 228 | 3300031711 | Ga0265314_10038319 | Ga0265314_100383194 | 168 |
| 229 | 3300044842 | Ga0466957_0261367 | Ga0466957_0261367_392_904 | 168 |
| 230 | 3300044842 | Ga0466957_0459186 | Ga0466957_0459186_174_686 | 168 |
| 231 | 3300045976 | Ga0466967_0340894 | Ga0466967_0340894_65_577 | 168 |
| 232 | 3300046557 | Ga0495622_0022499 | Ga0495622_0022499_1939_2472 | 168 |
| 233 | 3300049569 | Ga0501032_0076864 | Ga0501032_0076864_1293_1826 | 168 |
| 234 | 3300049570 | Ga0501033_0023210 | Ga0501033_0023210_3439_3972 | 168 |
| 235 | 3300049571 | Ga0501034_0100862 | Ga0501034_0100862_95_664 | 168 |
| 236 | 3300049574 | Ga0501038_0327540 | Ga0501038_0327540_189_758 | 168 |
| 237 | 3300049574 | Ga0501038_0537241 | Ga0501038_0537241_245_778 | 168 |
| 238 | 3300049579 | Ga0501043_0142512 | Ga0501043_0142512_894_1427 | 168 |
| 239 | 3300049580 | Ga0501046_0324169 | Ga0501046_0324169_124_657 | 168 |
| 240 | 3300049581 | Ga0501047_0101496 | Ga0501047_0101496_272_841 | 168 |
| 241 | 3300049581 | Ga0501047_0518016 | Ga0501047_0518016_193_726 | 168 |
| 242 | 3300049822 | Ga0501035_0283247 | Ga0501035_0283247_131_664 | 168 |
| 243 | 3300049823 | Ga0501044_0064427 | Ga0501044_0064427_1237_1806 | 168 |
| 244 | 3300049823 | Ga0501044_0310535 | Ga0501044_0310535_787_1320 | 168 |
| 245 | 3300053136 | Ga0500559_0043386 | Ga0500559_0043386_1415_1933 | 168 |
| 246 | 3300005338 | Ga0068868_100175448 | Ga0068868_1001754482 | 169 |
| 247 | 3300005347 | Ga0070668_101120403 | Ga0070668_1011204031 | 169 |
| 248 | 3300005543 | Ga0070672_100707102 | Ga0070672_1007071022 | 169 |
| 249 | 3300005548 | Ga0070665_101584960 | Ga0070665_1015849601 | 169 |
| 250 | 3300005842 | Ga0068858_100301463 | Ga0068858_1003014632 | 169 |
| 251 | 3300006237 | Ga0097621_100000673 | Ga0097621_10000067310 | 169 |
| 252 | 3300006237 | Ga0097621_100033622 | Ga0097621_1000336222 | 169 |
| 253 | 3300009093 | Ga0105240_10689785 | Ga0105240_106897852 | 169 |
| 254 | 3300009148 | Ga0105243_10226519 | Ga0105243_102265192 | 169 |
| 255 | 3300009148 | Ga0105243_10505732 | Ga0105243_105057322 | 169 |
| 256 | 3300009176 | Ga0105242_10394942 | Ga0105242_103949422 | 169 |
| 257 | 3300013296 | Ga0157374_12001348 | Ga0157374_120013481 | 169 |
| 258 | 3300014968 | Ga0157379_10001454 | Ga0157379_1000145413 | 169 |
| 259 | 3300014969 | Ga0157376_10772981 | Ga0157376_107729812 | 169 |
| 260 | 3300025911 | Ga0207654_10800186 | Ga0207654_108001861 | 169 |
| 261 | 3300025934 | Ga0207686_10107510 | Ga0207686_101075102 | 169 |
| 262 | 3300025935 | Ga0207709_10071331 | Ga0207709_100713313 | 169 |
| 263 | 3300025940 | Ga0207691_10770551 | Ga0207691_107705512 | 169 |
| 264 | 3300026142 | Ga0207698_11336099 | Ga0207698_113360992 | 169 |
| 265 | 3300028379 | Ga0268266_11529594 | Ga0268266_115295941 | 169 |
| 266 | 3300039437 | Ga0436365_1338454 | Ga0436365_1338454_59161_59703 | 169 |
| 267 | 3300048929 | Ga0496126_0013807 | Ga0496126_0013807_612_1151 | 169 |
| 268 | 3300053094 | Ga0500566_0194363 | Ga0500566_0194363_356_886 | 169 |
| 269 | 3300053103 | Ga0500555_010595 | Ga0500555_010595_1875_2399 | 169 |
| 270 | 3300053119 | Ga0500595_001583 | Ga0500595_001583_8331_8873 | 169 |
| 271 | 3300053119 | Ga0500595_004834 | Ga0500595_004834_920_1459 | 169 |
| 272 | 3300053119 | Ga0500595_042050 | Ga0500595_042050_199_720 | 169 |
| 273 | 3300053146 | Ga0500588_0019521 | Ga0500588_0019521_898_1419 | 169 |
| 274 | 3300005327 | Ga0070658_10172261 | Ga0070658_101722611 | 170 |
| 275 | 3300005329 | Ga0070683_100076315 | Ga0070683_1000763154 | 170 |
| 276 | 3300005330 | Ga0070690_100071294 | Ga0070690_1000712943 | 170 |
| 277 | 3300005331 | Ga0070670_100646336 | Ga0070670_1006463362 | 170 |
| 278 | 3300005335 | Ga0070666_10104131 | Ga0070666_101041312 | 170 |
| 279 | 3300005338 | Ga0068868_100212393 | Ga0068868_1002123932 | 170 |
| 280 | 3300005344 | Ga0070661_100072855 | Ga0070661_1000728552 | 170 |
| 281 | 3300005355 | Ga0070671_100169851 | Ga0070671_1001698512 | 170 |
| 282 | 3300005364 | Ga0070673_100510774 | Ga0070673_1005107741 | 170 |
| 283 | 3300005365 | Ga0070688_100152867 | Ga0070688_1001528671 | 170 |
| 284 | 3300005367 | Ga0070667_100019018 | Ga0070667_1000190182 | 170 |
| 285 | 3300005456 | Ga0070678_100029113 | Ga0070678_1000291132 | 170 |
| 286 | 3300005458 | Ga0070681_10982575 | Ga0070681_109825752 | 170 |
| 287 | 3300005459 | Ga0068867_100065156 | Ga0068867_1000651562 | 170 |
| 288 | 3300005466 | Ga0070685_10186546 | Ga0070685_101865462 | 170 |
| 289 | 3300005530 | Ga0070679_101115630 | Ga0070679_1011156302 | 170 |
| 290 | 3300005535 | Ga0070684_100474481 | Ga0070684_1004744812 | 170 |
| 291 | 3300005539 | Ga0068853_100256017 | Ga0068853_1002560172 | 170 |
| 292 | 3300005563 | Ga0068855_101365042 | Ga0068855_1013650422 | 170 |
| 293 | 3300005577 | Ga0068857_100173997 | Ga0068857_1001739972 | 170 |
| 294 | 3300005614 | Ga0068856_100286454 | Ga0068856_1002864543 | 170 |
| 295 | 3300005616 | Ga0068852_100166192 | Ga0068852_1001661923 | 170 |
| 296 | 3300005617 | Ga0068859_100274911 | Ga0068859_1002749112 | 170 |
| 297 | 3300005618 | Ga0068864_100156999 | Ga0068864_1001569993 | 170 |
| 298 | 3300005718 | Ga0068866_10057902 | Ga0068866_100579021 | 170 |
| 299 | 3300005719 | Ga0068861_100150064 | Ga0068861_1001500642 | 170 |
| 300 | 3300005834 | Ga0068851_10171452 | Ga0068851_101714522 | 170 |
| 301 | 3300005842 | Ga0068858_100364640 | Ga0068858_1003646403 | 170 |
| 302 | 3300005843 | Ga0068860_100107154 | Ga0068860_1001071542 | 170 |
| 303 | 3300006237 | Ga0097621_100011628 | Ga0097621_1000116284 | 170 |
| 304 | 3300006358 | Ga0068871_100107015 | Ga0068871_1001070151 | 170 |
| 305 | 3300006881 | Ga0068865_100003490 | Ga0068865_1000034906 | 170 |
| 306 | 3300006931 | Ga0097620_100274919 | Ga0097620_1002749192 | 170 |
| 307 | 3300009093 | Ga0105240_10251172 | Ga0105240_102511722 | 170 |
| 308 | 3300009098 | Ga0105245_10145676 | Ga0105245_101456763 | 170 |
| 309 | 3300009101 | Ga0105247_10966833 | Ga0105247_109668331 | 170 |
| 310 | 3300009174 | Ga0105241_10096329 | Ga0105241_100963292 | 170 |
| 311 | 3300009177 | Ga0105248_10089475 | Ga0105248_100894752 | 170 |
| 312 | 3300009177 | Ga0105248_11648242 | Ga0105248_116482422 | 170 |
| 313 | 3300009545 | Ga0105237_10238834 | Ga0105237_102388342 | 170 |
| 314 | 3300009551 | Ga0105238_10007037 | Ga0105238_100070373 | 170 |
| 315 | 3300009553 | Ga0105249_10346669 | Ga0105249_103466692 | 170 |
| 316 | 3300010375 | Ga0105239_10132861 | Ga0105239_101328612 | 170 |
| 317 | 3300011119 | Ga0105246_10009121 | Ga0105246_100091212 | 170 |
| 318 | 3300013102 | Ga0157371_10807002 | Ga0157371_108070022 | 170 |
| 319 | 3300013105 | Ga0157369_10049793 | Ga0157369_100497932 | 170 |
| 320 | 3300013296 | Ga0157374_10060155 | Ga0157374_100601552 | 170 |
| 321 | 3300013296 | Ga0157374_10537390 | Ga0157374_105373902 | 170 |
| 322 | 3300013297 | Ga0157378_10038524 | Ga0157378_100385243 | 170 |
| 323 | 3300013306 | Ga0163162_10026382 | Ga0163162_100263825 | 170 |
| 324 | 3300013307 | Ga0157372_10090408 | Ga0157372_100904083 | 170 |
| 325 | 3300013308 | Ga0157375_10042953 | Ga0157375_100429533 | 170 |
| 326 | 3300014325 | Ga0163163_10310234 | Ga0163163_103102342 | 170 |
| 327 | 3300014968 | Ga0157379_10226196 | Ga0157379_102261962 | 170 |
| 328 | 3300014969 | Ga0157376_10099206 | Ga0157376_100992062 | 170 |
| 329 | 3300017792 | Ga0163161_10009873 | Ga0163161_100098732 | 170 |
| 330 | 3300025321 | Ga0207656_10186615 | Ga0207656_101866152 | 170 |
| 331 | 3300025899 | Ga0207642_10015558 | Ga0207642_100155582 | 170 |
| 332 | 3300025911 | Ga0207654_10293345 | Ga0207654_102933452 | 170 |
| 333 | 3300025913 | Ga0207695_10423823 | Ga0207695_104238231 | 170 |
| 334 | 3300025924 | Ga0207694_10058449 | Ga0207694_100584492 | 170 |
| 335 | 3300025925 | Ga0207650_10722402 | Ga0207650_107224022 | 170 |
| 336 | 3300025927 | Ga0207687_10553201 | Ga0207687_105532012 | 170 |
| 337 | 3300025931 | Ga0207644_10130089 | Ga0207644_101300893 | 170 |
| 338 | 3300025934 | Ga0207686_10039901 | Ga0207686_100399013 | 170 |
| 339 | 3300025938 | Ga0207704_10144465 | Ga0207704_101444652 | 170 |
| 340 | 3300025942 | Ga0207689_10091891 | Ga0207689_100918912 | 170 |
| 341 | 3300025949 | Ga0207667_10193176 | Ga0207667_101931761 | 170 |
| 342 | 3300026035 | Ga0207703_10337892 | Ga0207703_103378923 | 170 |
| 343 | 3300026078 | Ga0207702_10265608 | Ga0207702_102656082 | 170 |
| 344 | 3300026095 | Ga0207676_10561860 | Ga0207676_105618602 | 170 |
| 345 | 3300026116 | Ga0207674_10112933 | Ga0207674_101129332 | 170 |
| 346 | 3300028379 | Ga0268266_10189041 | Ga0268266_101890412 | 170 |
| 347 | 3300036401 | Ga0373937_0683884 | Ga0373937_0683884_353_871 | 170 |
| 348 | 3300048924 | Ga0496121_0000483 | Ga0496121_0000483_15846_16370 | 170 |
| 349 | 3300005354 | Ga0070675_100112756 | Ga0070675_1001127563 | 171 |
| 350 | 3300005456 | Ga0070678_100668763 | Ga0070678_1006687632 | 171 |
| 351 | 3300005840 | Ga0068870_10282011 | Ga0068870_102820112 | 171 |
| 352 | 3300014326 | Ga0157380_10217561 | Ga0157380_102175612 | 171 |
| 353 | 3300025926 | Ga0207659_10266106 | Ga0207659_102661062 | 171 |
| 354 | 3300046663 | Ga0495635_0497351 | Ga0495635_0497351_125_655 | 171 |
| 355 | 3300046459 | Ga0495629_0347457 | Ga0495629_0347457_334_870 | 173 |
| 356 | 3300039438 | Ga0436360_0457407 | Ga0436360_0457407_264_791 | 174 |
| 357 | 3300003214 | JGI25165J46597_1000036 | JGI25165J46597_1000036245 | 175 |
| 358 | 3300025231 | Ga0207427_104852 | Ga0207427_1048522 | 175 |
| 359 | 3300025261 | Ga0209233_1000015 | Ga0209233_10000151022 | 175 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5dir-assembly4.cif.gz_D | membrane protein at 2.8 angstroms | 0.8831 | 15 | 164 |
| 5dir-assembly4.cif.gz_D | membrane protein at 2.8 angstroms | 0.872 | 15 | 164 |
| 5dir-assembly2.cif.gz_B | membrane protein at 2.8 angstroms | 0.8565 | 12 | 161 |
| 6ryo-assembly1.cif.gz_A | bacterial membrane enzyme structure by the in meso method at 1.9 a resolution | 0.8548 | 15 | 164 |
| 6ryp-assembly1.cif.gz_A | bacterial membrane enzyme structure by the in meso method at 2.3 a resolution | 0.8288 | 15 | 172 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P00804_15_157_3.90.1420.10 | Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain | 0.8731 | 19 | 162 | 3.90.1420.10 |
| af_Q2FZ79_13_152_3.90.1420.10 | Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain | 0.854 | 19 | 164 | 3.90.1420.10 |
| af_P00804_15_157_3.90.1420.10 | Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain | 0.8505 | 19 | 162 | 3.90.1420.10 |
| af_Q2FZ79_13_152_3.90.1420.10 | Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain | 0.8428 | 19 | 164 | 3.90.1420.10 |
| af_P9WK99_39_178_3.90.1420.10 | Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain | 0.8253 | 19 | 162 | 3.90.1420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523G0G3-F1-model_v4 | Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) | 0.9472 | 12 | 163 |
GO:0004190
GO:0005886 GO:0006508 |
| AF-A0A525I6A1-F1-model_v4 | Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) | 0.9349 | 9 | 163 |
GO:0004190
GO:0005886 GO:0006508 |
| AF-A0A1G6YY51-F1-model_v4 | Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) | 0.9251 | 18 | 162 |
GO:0004190
GO:0005886 GO:0006508 |
| AF-B8IB41-F1-model_v4 | Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) | 0.9216 | 9 | 162 |
GO:0004190
GO:0005886 GO:0006508 |
| AF-A0A7W2B9V6-F1-model_v4 | Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) | 0.9205 | 11 | 162 |
GO:0004190
GO:0005886 GO:0006508 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar