F421433

General Info

Members Datasets Scaffolds Average Seq Length
359 192 359 171

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_101120403|Ga0070668_1011204031
Length 185
Sequence MKLQPREVGLIAAALALIADQGSKLFLLYGAGFMQMPPGESIPVLPFFNLVMVWNPGISYGLFPASGRLGTWLLIGMSVIAIGVLSWLLWRASSRALAIGYGMIIGGALGNNLVDRLVYGKVADFFHFYGFGYDWYVFNIADLAITLGAMAILYDVLKPQPSQEDQTPKDLGPGIWNQGSRANEV

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
137 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
183 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
184 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
185 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
186 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
187 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
190 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
191 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.85
Nodule 0
Rhizoplane 0
Rhizosphere 91.92
Stem 0
Stem Tuber 0
Unclassified 2.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000036 3300003214 Bacteria 286380
2 JGI25153J46596_10005159 3300003215 Bacteria 6880
3 Ga0070658_10172261 3300005327 Bacteria 1818
4 Ga0070676_10223434 3300005328 Unclassified 1245
5 Ga0070676_10247591 3300005328 Bacteria 1188
6 Ga0070683_100076315 3300005329 Bacteria 3132
7 Ga0070690_100071294 3300005330 Bacteria 2258
8 Ga0070670_100576011 3300005331 Bacteria 1006
9 Ga0070670_100646336 3300005331 Unclassified 949
10 Ga0070666_10020247 3300005335 Bacteria 4300
11 Ga0070666_10104131 3300005335 Bacteria 1958
12 Ga0070680_100300307 3300005336 Bacteria 1362
13 Ga0068868_100143950 3300005338 Bacteria 1959
14 Ga0068868_100175448 3300005338 Bacteria 1776
15 Ga0068868_100212393 3300005338 Bacteria 1618
16 Ga0070660_100168591 3300005339 Unclassified 1767
17 Ga0070660_100531976 3300005339 Unclassified 980
18 Ga0070661_100065368 3300005344 Bacteria 2673
19 Ga0070661_100072855 3300005344 Bacteria 2528
20 Ga0070661_100132738 3300005344 Bacteria 1871
21 Ga0070692_10400647 3300005345 Bacteria 866
22 Ga0070668_100460469 3300005347 Bacteria 1095
23 Ga0070668_101120403 3300005347 Bacteria 711
24 Ga0070669_100101071 3300005353 Bacteria 2175
25 Ga0070675_100112756 3300005354 Bacteria 2302
26 Ga0070675_100137751 3300005354 Bacteria 2084
27 Ga0070671_100169851 3300005355 Bacteria 1844
28 Ga0070674_100559551 3300005356 Bacteria 961
29 Ga0070674_100567991 3300005356 Bacteria 954
30 Ga0070673_100067687 3300005364 Bacteria 2857
31 Ga0070673_100510774 3300005364 Bacteria 1088
32 Ga0070688_100152867 3300005365 Bacteria 1579
33 Ga0070667_100019018 3300005367 Bacteria 5695
34 Ga0070713_100450382 3300005436 Bacteria 1209
35 Ga0070713_100650465 3300005436 Bacteria 1004
36 Ga0070678_100029113 3300005456 Bacteria 3778
37 Ga0070678_100058087 3300005456 Bacteria 2838
38 Ga0070678_100076411 3300005456 Bacteria 2523
39 Ga0070678_100668763 3300005456 Bacteria 933
40 Ga0070662_100155245 3300005457 Bacteria 1786
41 Ga0070681_10183165 3300005458 Bacteria 2016
42 Ga0070681_10982575 3300005458 Bacteria 764
43 Ga0068867_100065156 3300005459 Bacteria 2711
44 Ga0068867_100591965 3300005459 Unclassified 966
45 Ga0068867_101070417 3300005459 Bacteria 735
46 Ga0070685_10186546 3300005466 Bacteria 1339
47 Ga0070679_100043875 3300005530 Bacteria 4453
48 Ga0070679_101115630 3300005530 Bacteria 734
49 Ga0070684_100037563 3300005535 Bacteria 4156
50 Ga0070684_100301642 3300005535 Bacteria 1470
51 Ga0070684_100474481 3300005535 Bacteria 1157
52 Ga0068853_100012979 3300005539 Bacteria 6792
53 Ga0068853_100041607 3300005539 Bacteria 3926
54 Ga0068853_100064675 3300005539 Bacteria 3173
55 Ga0068853_100256017 3300005539 Bacteria 1608
56 Ga0068853_100481751 3300005539 Bacteria 1170
57 Ga0070672_100302957 3300005543 Bacteria 1355
58 Ga0070672_100707102 3300005543 Bacteria 882
59 Ga0070686_101495995 3300005544 Bacteria 569
60 Ga0070665_100001289 3300005548 Bacteria 29994
61 Ga0070665_100029107 3300005548 Bacteria 5560
62 Ga0070665_100060723 3300005548 Bacteria 3789
63 Ga0070665_100174330 3300005548 Bacteria 2151
64 Ga0070665_100187545 3300005548 Bacteria 2069
65 Ga0070665_101584960 3300005548 Unclassified 663
66 Ga0068855_100328449 3300005563 Bacteria 1689
67 Ga0068855_101365042 3300005563 Bacteria 731
68 Ga0068857_100173997 3300005577 Bacteria 1958
69 Ga0068857_100213549 3300005577 Bacteria 1761
70 Ga0068857_100614916 3300005577 Unclassified 1028
71 Ga0068857_101103683 3300005577 Unclassified 766
72 Ga0068856_100286454 3300005614 Bacteria 1664
73 Ga0068856_100452561 3300005614 Unclassified 1305
74 Ga0068852_100098147 3300005616 Bacteria 2637
75 Ga0068852_100166192 3300005616 Bacteria 2064
76 Ga0068852_101095435 3300005616 Unclassified 817
77 Ga0068859_100274911 3300005617 Bacteria 1777
78 Ga0068864_100156999 3300005618 Bacteria 2065
79 Ga0068866_10057902 3300005718 Bacteria 1999
80 Ga0068866_10118757 3300005718 Bacteria 1487
81 Ga0068861_100117318 3300005719 Bacteria 2142
82 Ga0068861_100150064 3300005719 Unclassified 1911
83 Ga0068851_10171452 3300005834 Bacteria 1198
84 Ga0068870_10282011 3300005840 Bacteria 1042
85 Ga0068863_100055714 3300005841 Bacteria 3743
86 Ga0068858_100301463 3300005842 Bacteria 1529
87 Ga0068858_100325069 3300005842 Bacteria 1470
88 Ga0068858_100364640 3300005842 Bacteria 1385
89 Ga0068860_100107154 3300005843 Bacteria 2670
90 Ga0068860_100979918 3300005843 Bacteria 863
91 Ga0068862_101211150 3300005844 Unclassified 754
92 Ga0070712_100457678 3300006175 Bacteria 1063
93 Ga0097621_100000673 3300006237 Bacteria 23947
94 Ga0097621_100011628 3300006237 Bacteria 6490
95 Ga0097621_100033622 3300006237 Bacteria 4085
96 Ga0097621_100039250 3300006237 Bacteria 3802
97 Ga0097621_100047819 3300006237 Bacteria 3467
98 Ga0068871_100011202 3300006358 Bacteria 6571
99 Ga0068871_100107015 3300006358 Bacteria 2348
100 Ga0068871_100268634 3300006358 Unclassified 1489
101 Ga0068871_100686973 3300006358 Bacteria 937
102 Ga0068871_100777174 3300006358 Unclassified 881
103 Ga0068865_100003490 3300006881 Bacteria 9423
104 Ga0068865_100184971 3300006881 Bacteria 1607
105 Ga0097620_100274919 3300006931 Bacteria 1777
106 Ga0105240_10000320 3300009093 Bacteria 91422
107 Ga0105240_10251172 3300009093 Bacteria 2045
108 Ga0105240_10354973 3300009093 Bacteria 1662
109 Ga0105240_10689785 3300009093 Unclassified 1116
110 Ga0105240_11885502 3300009093 Bacteria 622
111 Ga0105245_10077982 3300009098 Bacteria 3022
112 Ga0105245_10145676 3300009098 Bacteria 2235
113 Ga0105245_10239528 3300009098 Bacteria 1758
114 Ga0105247_10114438 3300009101 Bacteria 1740
115 Ga0105247_10119367 3300009101 Bacteria 1707
116 Ga0105247_10966833 3300009101 Bacteria 662
117 Ga0105243_10019578 3300009148 Bacteria 5130
118 Ga0105243_10226519 3300009148 Unclassified 1656
119 Ga0105243_10505732 3300009148 Bacteria 1146
120 Ga0105241_10096329 3300009174 Bacteria 2344
121 Ga0105241_10209432 3300009174 Bacteria 1633
122 Ga0105241_10267217 3300009174 Unclassified 1456
123 Ga0105241_10397926 3300009174 Unclassified 1207
124 Ga0105242_10394942 3300009176 Bacteria 1289
125 Ga0105248_10089475 3300009177 Bacteria 3465
126 Ga0105248_11648242 3300009177 Unclassified 727
127 Ga0105237_10214049 3300009545 Unclassified 1927
128 Ga0105237_10238834 3300009545 Bacteria 1818
129 Ga0105237_10293571 3300009545 Bacteria 1628
130 Ga0105237_10648317 3300009545 Bacteria 1063
131 Ga0105238_10001160 3300009551 Bacteria 26566
132 Ga0105238_10007037 3300009551 Bacteria 11248
133 Ga0105238_10184195 3300009551 Bacteria 2065
134 Ga0105238_10332175 3300009551 Bacteria 1507
135 Ga0105238_10745137 3300009551 Bacteria 993
136 Ga0105249_10034531 3300009553 Bacteria 4584
137 Ga0105249_10346669 3300009553 Bacteria 1503
138 Ga0105239_10094421 3300010375 Bacteria 3304
139 Ga0105239_10132861 3300010375 Bacteria 2769
140 Ga0105239_10331662 3300010375 Bacteria 1716
141 Ga0105239_10563049 3300010375 Unclassified 1298
142 Ga0105246_10009121 3300011119 Bacteria 6108
143 Ga0105246_10044889 3300011119 Bacteria 3006
144 Ga0105246_10516139 3300011119 Bacteria 1017
145 Ga0157373_10231009 3300013100 Unclassified 1306
146 Ga0157371_10807002 3300013102 Bacteria 707
147 Ga0157370_10865292 3300013104 Bacteria 821
148 Ga0157369_10049793 3300013105 Bacteria 4540
149 Ga0157369_10719719 3300013105 Unclassified 1027
150 Ga0157369_11642678 3300013105 Bacteria 653
151 Ga0157374_10060155 3300013296 Bacteria 3554
152 Ga0157374_10325478 3300013296 Bacteria 1524
153 Ga0157374_10447237 3300013296 Bacteria 1293
154 Ga0157374_10490972 3300013296 Bacteria 1232
155 Ga0157374_10537390 3300013296 Bacteria 1176
156 Ga0157374_12001348 3300013296 Bacteria 606
157 Ga0157378_10018878 3300013297 Bacteria 6061
158 Ga0157378_10038524 3300013297 Bacteria 4237
159 Ga0157378_10322060 3300013297 Bacteria 1502
160 Ga0157378_10360665 3300013297 Unclassified 1422
161 Ga0163162_10026382 3300013306 Bacteria 5741
162 Ga0157372_10030596 3300013307 Bacteria 5890
163 Ga0157372_10090408 3300013307 Bacteria 3480
164 Ga0157375_10042953 3300013308 Bacteria 4380
165 Ga0157375_11952642 3300013308 Bacteria 697
166 Ga0163163_10138765 3300014325 Bacteria 2473
167 Ga0163163_10310234 3300014325 Bacteria 1630
168 Ga0157380_10217561 3300014326 Unclassified 1707
169 Ga0157379_10001454 3300014968 Bacteria 19485
170 Ga0157379_10099229 3300014968 Bacteria 2614
171 Ga0157379_10118385 3300014968 Bacteria 2382
172 Ga0157379_10226196 3300014968 Bacteria 1696
173 Ga0157376_10099206 3300014969 Bacteria 2540
174 Ga0157376_10605033 3300014969 Unclassified 1091
175 Ga0157376_10745880 3300014969 Bacteria 988
176 Ga0157376_10772981 3300014969 Bacteria 971
177 Ga0163161_10009873 3300017792 Bacteria 6611
178 Ga0209563_119395 3300025230 Unclassified 781
179 Ga0207427_104852 3300025231 Bacteria 2084
180 Ga0209233_1000015 3300025261 Bacteria 980563
181 Ga0209455_1009120 3300025272 Bacteria 2632
182 Ga0209758_1000085 3300025297 Bacteria 256191
183 Ga0207656_10186615 3300025321 Bacteria 997
184 Ga0207642_10015558 3300025899 Bacteria 2839
185 Ga0207642_10088761 3300025899 Bacteria 1522
186 Ga0207710_10049904 3300025900 Bacteria 1876
187 Ga0207680_10060584 3300025903 Unclassified 2304
188 Ga0207680_11059080 3300025903 Bacteria 580
189 Ga0207645_10194514 3300025907 Unclassified 1333
190 Ga0207705_10035655 3300025909 Bacteria 3558
191 Ga0207705_10559873 3300025909 Bacteria 889
192 Ga0207654_10219566 3300025911 Bacteria 1260
193 Ga0207654_10284042 3300025911 Bacteria 1120
194 Ga0207654_10293345 3300025911 Bacteria 1104
195 Ga0207654_10800186 3300025911 Unclassified 681
196 Ga0207707_10075503 3300025912 Bacteria 2941
197 Ga0207707_10234682 3300025912 Bacteria 1596
198 Ga0207695_10000227 3300025913 Bacteria 150546
199 Ga0207695_10091199 3300025913 Bacteria 3062
200 Ga0207695_10248330 3300025913 Bacteria 1679
201 Ga0207695_10423823 3300025913 Bacteria 1215
202 Ga0207671_10432570 3300025914 Unclassified 1047
203 Ga0207671_11192502 3300025914 Bacteria 596
204 Ga0207693_10347152 3300025915 Bacteria 1161
205 Ga0207663_10150943 3300025916 Bacteria 1630
206 Ga0207660_10297607 3300025917 Bacteria 1284
207 Ga0207657_10103179 3300025919 Unclassified 2364
208 Ga0207649_10300872 3300025920 Unclassified 1173
209 Ga0207652_10055634 3300025921 Bacteria 3404
210 Ga0207681_10088579 3300025923 Bacteria 2205
211 Ga0207694_10000005 3300025924 Bacteria 823704
212 Ga0207694_10058449 3300025924 Bacteria 2999
213 Ga0207694_10174184 3300025924 Bacteria 1743
214 Ga0207694_10223871 3300025924 Bacteria 1535
215 Ga0207650_10216414 3300025925 Bacteria 1540
216 Ga0207650_10722402 3300025925 Bacteria 842
217 Ga0207650_10883054 3300025925 Bacteria 759
218 Ga0207659_10266106 3300025926 Bacteria 1397
219 Ga0207659_10299854 3300025926 Unclassified 1319
220 Ga0207687_10149049 3300025927 Bacteria 1783
221 Ga0207687_10370175 3300025927 Bacteria 1171
222 Ga0207687_10553201 3300025927 Bacteria 966
223 Ga0207700_11099791 3300025928 Bacteria 711
224 Ga0207644_10130089 3300025931 Bacteria 1926
225 Ga0207690_10412609 3300025932 Bacteria 1079
226 Ga0207706_10121288 3300025933 Bacteria 2299
227 Ga0207686_10039901 3300025934 Bacteria 2851
228 Ga0207686_10071164 3300025934 Bacteria 2237
229 Ga0207686_10107510 3300025934 Bacteria 1875
230 Ga0207709_10071331 3300025935 Bacteria 2205
231 Ga0207669_10267060 3300025937 Bacteria 1283
232 Ga0207704_10144465 3300025938 Unclassified 1669
233 Ga0207704_10405950 3300025938 Unclassified 1076
234 Ga0207691_10358274 3300025940 Bacteria 1247
235 Ga0207691_10770551 3300025940 Bacteria 809
236 Ga0207689_10060873 3300025942 Bacteria 3105
237 Ga0207689_10091891 3300025942 Bacteria 2493
238 Ga0207679_11004836 3300025945 Bacteria 764
239 Ga0207667_10000011 3300025949 Bacteria 447785
240 Ga0207667_10193176 3300025949 Bacteria 2088
241 Ga0207667_10396000 3300025949 Unclassified 1406
242 Ga0207667_11405760 3300025949 Unclassified 671
243 Ga0207651_10076845 3300025960 Bacteria 2388
244 Ga0207712_11043241 3300025961 Unclassified 726
245 Ga0207668_10129016 3300025972 Bacteria 1928
246 Ga0207677_10106428 3300026023 Bacteria 2078
247 Ga0207703_10337892 3300026035 Bacteria 1383
248 Ga0207639_10009974 3300026041 Bacteria 6565
249 Ga0207639_10307918 3300026041 Bacteria 1402
250 Ga0207639_10408666 3300026041 Bacteria 1224
251 Ga0207639_10645540 3300026041 Bacteria 979
252 Ga0207702_10265608 3300026078 Bacteria 1617
253 Ga0207702_10346727 3300026078 Bacteria 1420
254 Ga0207641_10047013 3300026088 Bacteria 3638
255 Ga0207648_10033772 3300026089 Bacteria 4511
256 Ga0207648_10123993 3300026089 Bacteria 2272
257 Ga0207676_10561860 3300026095 Bacteria 1091
258 Ga0207674_10112933 3300026116 Bacteria 2690
259 Ga0207674_10130842 3300026116 Bacteria 2473
260 Ga0207674_11000081 3300026116 Unclassified 805
261 Ga0207675_100108385 3300026118 Bacteria 2619
262 Ga0207683_10031860 3300026121 Bacteria 4578
263 Ga0207683_10246924 3300026121 Bacteria 1628
264 Ga0207698_10001445 3300026142 Bacteria 13809
265 Ga0207698_10203022 3300026142 Bacteria 1777
266 Ga0207698_11336099 3300026142 Bacteria 732
267 Ga0268266_10001375 3300028379 Bacteria 29309
268 Ga0268266_10016478 3300028379 Bacteria 6318
269 Ga0268266_10051387 3300028379 Bacteria 3538
270 Ga0268266_10175941 3300028379 Bacteria 1945
271 Ga0268266_10189041 3300028379 Bacteria 1879
272 Ga0268266_11529594 3300028379 Bacteria 643
273 Ga0268265_10748318 3300028380 Unclassified 948
274 Ga0265338_10104896 3300028800 Bacteria 2292
275 Ga0265330_10077243 3300031235 Bacteria 1437
276 Ga0265325_10002251 3300031241 Bacteria 13077
277 Ga0265329_10049018 3300031242 Unclassified 1347
278 Ga0265340_10000371 3300031247 Bacteria 23812
279 Ga0265339_10090133 3300031249 Bacteria 1608
280 Ga0265331_10031296 3300031250 Bacteria 2644
281 Ga0265316_10001627 3300031344 Bacteria 23924
282 Ga0265316_10029942 3300031344 Bacteria 4469
283 Ga0265316_10283947 3300031344 Bacteria 1209
284 Ga0307513_10228881 3300031456 Bacteria 1673
285 Ga0265313_10017265 3300031595 Bacteria 4109
286 Ga0265313_10018731 3300031595 Bacteria 3878
287 Ga0265314_10038319 3300031711 Bacteria 3464
288 Ga0265314_10043436 3300031711 Bacteria 3196
289 Ga0265314_10090249 3300031711 Bacteria 1997
290 Ga0265342_10027051 3300031712 Bacteria 3590
291 Ga0307516_10017029 3300031730 Bacteria 7589
292 Ga0307510_10381807 3300033180 Bacteria 854
293 Ga0373937_0683884 3300036401 Bacteria 972
294 Ga0395900_0459548 3300037418 Bacteria 1228
295 Ga0395898_0082386 3300037466 Bacteria 3101
296 Ga0395901_0039206 3300038443 Bacteria 4902
297 Ga0436365_0507621 3300039437 Bacteria 122643
298 Ga0436365_0972936 3300039437 Bacteria 2353
299 Ga0436365_1338454 3300039437 Bacteria 115168
300 Ga0436360_0457407 3300039438 Unclassified 1064
301 Ga0466957_0261367 3300044842 Unclassified 1154
302 Ga0466957_0459186 3300044842 Bacteria 878
303 Ga0466967_0340894 3300045976 Bacteria 1449
304 Ga0495629_0347457 3300046459 Bacteria 1012
305 Ga0495651_0516372 3300046462 Bacteria 763
306 Ga0495653_0398949 3300046463 Bacteria 875
307 Ga0495585_0154897 3300046492 Bacteria 1193
308 Ga0495621_0092677 3300046539 Bacteria 1140
309 Ga0495645_0122854 3300046543 Bacteria 1827
310 Ga0495622_0022499 3300046557 Bacteria 2937
311 Ga0495625_0158830 3300046660 Bacteria 1516
312 Ga0495635_0497351 3300046663 Bacteria 803
313 Ga0495661_0067898 3300046665 Bacteria 2093
314 Ga0495670_0044719 3300046691 Bacteria 2211
315 Ga0495672_0149825 3300047320 Unclassified 1211
316 Ga0496121_0000483 3300048924 Bacteria 77162
317 Ga0496126_0013807 3300048929 Bacteria 8190
318 Ga0495682_0001215 3300049460 Bacteria 14645
319 Ga0501032_0076864 3300049569 Bacteria 2223
320 Ga0501033_0023210 3300049570 Bacteria 4679
321 Ga0501033_0122806 3300049570 Bacteria 1883
322 Ga0501034_0100862 3300049571 Bacteria 2881
323 Ga0501034_0335578 3300049571 Unclassified 1443
324 Ga0501034_0349237 3300049571 Bacteria 1408
325 Ga0501038_0327540 3300049574 Archaea 1197
326 Ga0501038_0537241 3300049574 Bacteria 890
327 Ga0501043_0142512 3300049579 Bacteria 1876
328 Ga0501043_0311517 3300049579 Unclassified 1201
329 Ga0501046_0066719 3300049580 Bacteria 2804
330 Ga0501046_0324169 3300049580 Bacteria 1122
331 Ga0501047_0050781 3300049581 Bacteria 4005
332 Ga0501047_0101496 3300049581 Bacteria 2757
333 Ga0501047_0290640 3300049581 Bacteria 1478
334 Ga0501047_0300460 3300049581 Bacteria 1448
335 Ga0501047_0518016 3300049581 Bacteria 1018
336 Ga0501072_0303181 3300049588 Bacteria 1270
337 Ga0501080_0033382 3300049742 Bacteria 4803
338 Ga0501080_0461530 3300049742 Bacteria 1138
339 Ga0501083_0068416 3300049744 Bacteria 2363
340 Ga0501035_0015943 3300049822 Bacteria 6935
341 Ga0501035_0283247 3300049822 Bacteria 1400
342 Ga0501044_0064427 3300049823 Bacteria 3742
343 Ga0501044_0097014 3300049823 Bacteria 2969
344 Ga0501044_0310535 3300049823 Bacteria 1503
345 Ga0500643_000003 3300053087 Bacteria 876659
346 Ga0500566_0194363 3300053094 Bacteria 1030
347 Ga0500555_010595 3300053103 Bacteria 2646
348 Ga0500595_001583 3300053119 Bacteria 12003
349 Ga0500595_004834 3300053119 Bacteria 5959
350 Ga0500595_042050 3300053119 Bacteria 1465
351 Ga0500655_008301 3300053133 Bacteria 1869
352 Ga0500655_064919 3300053133 Unclassified 739
353 Ga0500559_0043386 3300053136 Bacteria 1964
354 Ga0500559_0249744 3300053136 Bacteria 836
355 Ga0500568_0048956 3300053139 Bacteria 1669
356 Ga0500588_0019521 3300053146 Unclassified 1804
357 Ga0500639_108544 3300053163 Bacteria 1354
358 Ga0500645_045614 3300053730 Unclassified 1288
359 Ga0501082_0042527 3300060353 Bacteria 3917

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10447237 Ga0157374_104472372 153
2 3300053133 Ga0500655_064919 Ga0500655_064919_22_483 153
3 3300046462 Ga0495651_0516372 Ga0495651_0516372_269_745 157
4 3300006175 Ga0070712_100457678 Ga0070712_1004576782 160
5 3300025915 Ga0207693_10347152 Ga0207693_103471522 160
6 3300031241 Ga0265325_10002251 Ga0265325_100022514 162
7 3300031344 Ga0265316_10283947 Ga0265316_102839472 162
8 3300031595 Ga0265313_10018731 Ga0265313_100187313 162
9 3300049579 Ga0501043_0311517 Ga0501043_0311517_553_1047 162
10 3300005347 Ga0070668_100460469 Ga0070668_1004604692 163
11 3300005844 Ga0068862_101211150 Ga0068862_1012111502 163
12 3300009093 Ga0105240_11885502 Ga0105240_118855021 163
13 3300025972 Ga0207668_10129016 Ga0207668_101290163 163
14 3300028380 Ga0268265_10748318 Ga0268265_107483182 163
15 3300047320 Ga0495672_0149825 Ga0495672_0149825_14_505 163
16 3300049571 Ga0501034_0349237 Ga0501034_0349237_689_1186 163
17 3300049588 Ga0501072_0303181 Ga0501072_0303181_131_628 163
18 3300049742 Ga0501080_0461530 Ga0501080_0461530_349_846 163
19 3300049744 Ga0501083_0068416 Ga0501083_0068416_155_652 163
20 3300053087 Ga0500643_000003 Ga0500643_000003_859088_859579 163
21 3300053139 Ga0500568_0048956 Ga0500568_0048956_301_792 163
22 3300053730 Ga0500645_045614 Ga0500645_045614_440_931 163
23 3300060353 Ga0501082_0042527 Ga0501082_0042527_2466_2963 163
24 3300005344 Ga0070661_100065368 Ga0070661_1000653683 164
25 3300005539 Ga0068853_100012979 Ga0068853_1000129793 164
26 3300005563 Ga0068855_100328449 Ga0068855_1003284493 164
27 3300005577 Ga0068857_100614916 Ga0068857_1006149162 164
28 3300005614 Ga0068856_100452561 Ga0068856_1004525612 164
29 3300005616 Ga0068852_100098147 Ga0068852_1000981473 164
30 3300005616 Ga0068852_101095435 Ga0068852_1010954351 164
31 3300006358 Ga0068871_100686973 Ga0068871_1006869732 164
32 3300009093 Ga0105240_10000320 Ga0105240_1000032033 164
33 3300009101 Ga0105247_10114438 Ga0105247_101144382 164
34 3300009545 Ga0105237_10214049 Ga0105237_102140493 164
35 3300009545 Ga0105237_10648317 Ga0105237_106483171 164
36 3300009551 Ga0105238_10001160 Ga0105238_100011604 164
37 3300013105 Ga0157369_10719719 Ga0157369_107197192 164
38 3300025900 Ga0207710_10049904 Ga0207710_100499043 164
39 3300025911 Ga0207654_10219566 Ga0207654_102195662 164
40 3300025912 Ga0207707_10234682 Ga0207707_102346822 164
41 3300025913 Ga0207695_10000227 Ga0207695_1000022790 164
42 3300025914 Ga0207671_10432570 Ga0207671_104325702 164
43 3300025920 Ga0207649_10300872 Ga0207649_103008722 164
44 3300025924 Ga0207694_10000005 Ga0207694_10000005528 164
45 3300025949 Ga0207667_10000011 Ga0207667_1000001160 164
46 3300025949 Ga0207667_11405760 Ga0207667_114057602 164
47 3300026041 Ga0207639_10009974 Ga0207639_100099742 164
48 3300026142 Ga0207698_10001445 Ga0207698_1000144512 164
49 3300026142 Ga0207698_10203022 Ga0207698_102030222 164
50 3300031247 Ga0265340_10000371 Ga0265340_100003714 164
51 3300031344 Ga0265316_10001627 Ga0265316_1000162711 164
52 3300031344 Ga0265316_10029942 Ga0265316_100299422 164
53 3300031595 Ga0265313_10017265 Ga0265313_100172652 164
54 3300031711 Ga0265314_10043436 Ga0265314_100434362 164
55 3300031712 Ga0265342_10027051 Ga0265342_100270512 164
56 3300031730 Ga0307516_10017029 Ga0307516_100170297 164
57 3300037418 Ga0395900_0459548 Ga0395900_0459548_291_788 164
58 3300037466 Ga0395898_0082386 Ga0395898_0082386_223_720 164
59 3300038443 Ga0395901_0039206 Ga0395901_0039206_1125_1622 164
60 3300046543 Ga0495645_0122854 Ga0495645_0122854_769_1284 164
61 3300049460 Ga0495682_0001215 Ga0495682_0001215_163_678 164
62 3300049742 Ga0501080_0033382 Ga0501080_0033382_2031_2528 164
63 3300053133 Ga0500655_008301 Ga0500655_008301_1132_1647 164
64 3300003215 JGI25153J46596_10005159 JGI25153J46596_100051591 166
65 3300005548 Ga0070665_100187545 Ga0070665_1001875453 166
66 3300005577 Ga0068857_101103683 Ga0068857_1011036832 166
67 3300009174 Ga0105241_10209432 Ga0105241_102094322 166
68 3300011119 Ga0105246_10516139 Ga0105246_105161392 166
69 3300013297 Ga0157378_10018878 Ga0157378_100188785 166
70 3300014968 Ga0157379_10118385 Ga0157379_101183852 166
71 3300025230 Ga0209563_119395 Ga0209563_1193952 166
72 3300025272 Ga0209455_1009120 Ga0209455_10091203 166
73 3300025297 Ga0209758_1000085 Ga0209758_1000085155 166
74 3300025916 Ga0207663_10150943 Ga0207663_101509432 166
75 3300025927 Ga0207687_10370175 Ga0207687_103701752 166
76 3300025945 Ga0207679_11004836 Ga0207679_110048361 166
77 3300026116 Ga0207674_11000081 Ga0207674_110000812 166
78 3300046660 Ga0495625_0158830 Ga0495625_0158830_60_560 166
79 3300049581 Ga0501047_0300460 Ga0501047_0300460_808_1329 166
80 3300005328 Ga0070676_10223434 Ga0070676_102234342 167
81 3300005331 Ga0070670_100576011 Ga0070670_1005760111 167
82 3300005338 Ga0068868_100143950 Ga0068868_1001439502 167
83 3300005344 Ga0070661_100132738 Ga0070661_1001327382 167
84 3300005345 Ga0070692_10400647 Ga0070692_104006472 167
85 3300005353 Ga0070669_100101071 Ga0070669_1001010712 167
86 3300005354 Ga0070675_100137751 Ga0070675_1001377512 167
87 3300005356 Ga0070674_100559551 Ga0070674_1005595511 167
88 3300005364 Ga0070673_100067687 Ga0070673_1000676872 167
89 3300005436 Ga0070713_100650465 Ga0070713_1006504652 167
90 3300005456 Ga0070678_100058087 Ga0070678_1000580873 167
91 3300005456 Ga0070678_100076411 Ga0070678_1000764112 167
92 3300005457 Ga0070662_100155245 Ga0070662_1001552451 167
93 3300005459 Ga0068867_100591965 Ga0068867_1005919651 167
94 3300005535 Ga0070684_100301642 Ga0070684_1003016422 167
95 3300005539 Ga0068853_100481751 Ga0068853_1004817512 167
96 3300005543 Ga0070672_100302957 Ga0070672_1003029572 167
97 3300005548 Ga0070665_100029107 Ga0070665_1000291074 167
98 3300005548 Ga0070665_100174330 Ga0070665_1001743302 167
99 3300005577 Ga0068857_100213549 Ga0068857_1002135492 167
100 3300005718 Ga0068866_10118757 Ga0068866_101187572 167
101 3300005719 Ga0068861_100117318 Ga0068861_1001173182 167
102 3300005841 Ga0068863_100055714 Ga0068863_1000557142 167
103 3300005842 Ga0068858_100325069 Ga0068858_1003250692 167
104 3300005843 Ga0068860_100979918 Ga0068860_1009799182 167
105 3300006237 Ga0097621_100047819 Ga0097621_1000478192 167
106 3300006358 Ga0068871_100268634 Ga0068871_1002686342 167
107 3300006358 Ga0068871_100777174 Ga0068871_1007771742 167
108 3300006881 Ga0068865_100184971 Ga0068865_1001849712 167
109 3300009093 Ga0105240_10354973 Ga0105240_103549732 167
110 3300009098 Ga0105245_10077982 Ga0105245_100779823 167
111 3300009098 Ga0105245_10239528 Ga0105245_102395282 167
112 3300009101 Ga0105247_10119367 Ga0105247_101193672 167
113 3300009148 Ga0105243_10019578 Ga0105243_100195782 167
114 3300009174 Ga0105241_10397926 Ga0105241_103979262 167
115 3300009545 Ga0105237_10293571 Ga0105237_102935712 167
116 3300009551 Ga0105238_10184195 Ga0105238_101841952 167
117 3300009551 Ga0105238_10332175 Ga0105238_103321752 167
118 3300009553 Ga0105249_10034531 Ga0105249_100345314 167
119 3300010375 Ga0105239_10094421 Ga0105239_100944212 167
120 3300010375 Ga0105239_10331662 Ga0105239_103316622 167
121 3300010375 Ga0105239_10563049 Ga0105239_105630492 167
122 3300011119 Ga0105246_10044889 Ga0105246_100448893 167
123 3300013105 Ga0157369_11642678 Ga0157369_116426781 167
124 3300013296 Ga0157374_10325478 Ga0157374_103254782 167
125 3300013296 Ga0157374_10490972 Ga0157374_104909722 167
126 3300013297 Ga0157378_10322060 Ga0157378_103220602 167
127 3300013297 Ga0157378_10360665 Ga0157378_103606652 167
128 3300013308 Ga0157375_11952642 Ga0157375_119526421 167
129 3300014325 Ga0163163_10138765 Ga0163163_101387653 167
130 3300014968 Ga0157379_10099229 Ga0157379_100992292 167
131 3300014969 Ga0157376_10605033 Ga0157376_106050332 167
132 3300014969 Ga0157376_10745880 Ga0157376_107458802 167
133 3300025899 Ga0207642_10088761 Ga0207642_100887612 167
134 3300025903 Ga0207680_11059080 Ga0207680_110590801 167
135 3300025907 Ga0207645_10194514 Ga0207645_101945142 167
136 3300025913 Ga0207695_10248330 Ga0207695_102483303 167
137 3300025914 Ga0207671_11192502 Ga0207671_111925021 167
138 3300025919 Ga0207657_10103179 Ga0207657_101031792 167
139 3300025923 Ga0207681_10088579 Ga0207681_100885792 167
140 3300025924 Ga0207694_10174184 Ga0207694_101741843 167
141 3300025925 Ga0207650_10216414 Ga0207650_102164142 167
142 3300025925 Ga0207650_10883054 Ga0207650_108830542 167
143 3300025926 Ga0207659_10299854 Ga0207659_102998542 167
144 3300025927 Ga0207687_10149049 Ga0207687_101490491 167
145 3300025928 Ga0207700_11099791 Ga0207700_110997912 167
146 3300025933 Ga0207706_10121288 Ga0207706_101212882 167
147 3300025934 Ga0207686_10071164 Ga0207686_100711643 167
148 3300025937 Ga0207669_10267060 Ga0207669_102670602 167
149 3300025940 Ga0207691_10358274 Ga0207691_103582742 167
150 3300025942 Ga0207689_10060873 Ga0207689_100608733 167
151 3300025960 Ga0207651_10076845 Ga0207651_100768452 167
152 3300025961 Ga0207712_11043241 Ga0207712_110432412 167
153 3300026023 Ga0207677_10106428 Ga0207677_101064282 167
154 3300026041 Ga0207639_10645540 Ga0207639_106455402 167
155 3300026078 Ga0207702_10346727 Ga0207702_103467273 167
156 3300026088 Ga0207641_10047013 Ga0207641_100470132 167
157 3300026089 Ga0207648_10033772 Ga0207648_100337724 167
158 3300026089 Ga0207648_10123993 Ga0207648_101239933 167
159 3300026116 Ga0207674_10130842 Ga0207674_101308422 167
160 3300026118 Ga0207675_100108385 Ga0207675_1001083853 167
161 3300026121 Ga0207683_10031860 Ga0207683_100318603 167
162 3300026121 Ga0207683_10246924 Ga0207683_102469241 167
163 3300028379 Ga0268266_10016478 Ga0268266_100164782 167
164 3300028379 Ga0268266_10051387 Ga0268266_100513872 167
165 3300031711 Ga0265314_10090249 Ga0265314_100902492 167
166 3300033180 Ga0307510_10381807 Ga0307510_103818072 167
167 3300039437 Ga0436365_0507621 Ga0436365_0507621_21687_22217 167
168 3300039437 Ga0436365_0972936 Ga0436365_0972936_949_1461 167
169 3300046463 Ga0495653_0398949 Ga0495653_0398949_201_719 167
170 3300046492 Ga0495585_0154897 Ga0495585_0154897_633_1142 167
171 3300046539 Ga0495621_0092677 Ga0495621_0092677_321_830 167
172 3300046665 Ga0495661_0067898 Ga0495661_0067898_474_983 167
173 3300046691 Ga0495670_0044719 Ga0495670_0044719_881_1390 167
174 3300049570 Ga0501033_0122806 Ga0501033_0122806_708_1238 167
175 3300049571 Ga0501034_0335578 Ga0501034_0335578_418_948 167
176 3300049580 Ga0501046_0066719 Ga0501046_0066719_1857_2387 167
177 3300049581 Ga0501047_0050781 Ga0501047_0050781_1030_1560 167
178 3300049581 Ga0501047_0290640 Ga0501047_0290640_288_797 167
179 3300049822 Ga0501035_0015943 Ga0501035_0015943_4208_4738 167
180 3300049823 Ga0501044_0097014 Ga0501044_0097014_582_1112 167
181 3300053136 Ga0500559_0249744 Ga0500559_0249744_34_552 167
182 3300053163 Ga0500639_108544 Ga0500639_108544_679_1197 167
183 3300005328 Ga0070676_10247591 Ga0070676_102475912 168
184 3300005335 Ga0070666_10020247 Ga0070666_100202473 168
185 3300005336 Ga0070680_100300307 Ga0070680_1003003072 168
186 3300005339 Ga0070660_100168591 Ga0070660_1001685912 168
187 3300005339 Ga0070660_100531976 Ga0070660_1005319761 168
188 3300005356 Ga0070674_100567991 Ga0070674_1005679912 168
189 3300005436 Ga0070713_100450382 Ga0070713_1004503822 168
190 3300005458 Ga0070681_10183165 Ga0070681_101831652 168
191 3300005459 Ga0068867_101070417 Ga0068867_1010704172 168
192 3300005530 Ga0070679_100043875 Ga0070679_1000438753 168
193 3300005535 Ga0070684_100037563 Ga0070684_1000375632 168
194 3300005539 Ga0068853_100041607 Ga0068853_1000416073 168
195 3300005539 Ga0068853_100064675 Ga0068853_1000646754 168
196 3300005544 Ga0070686_101495995 Ga0070686_1014959951 168
197 3300005548 Ga0070665_100001289 Ga0070665_10000128919 168
198 3300005548 Ga0070665_100060723 Ga0070665_1000607233 168
199 3300006237 Ga0097621_100039250 Ga0097621_1000392504 168
200 3300006358 Ga0068871_100011202 Ga0068871_1000112022 168
201 3300009174 Ga0105241_10267217 Ga0105241_102672173 168
202 3300009551 Ga0105238_10745137 Ga0105238_107451372 168
203 3300013100 Ga0157373_10231009 Ga0157373_102310092 168
204 3300013104 Ga0157370_10865292 Ga0157370_108652922 168
205 3300013307 Ga0157372_10030596 Ga0157372_100305963 168
206 3300025903 Ga0207680_10060584 Ga0207680_100605842 168
207 3300025909 Ga0207705_10035655 Ga0207705_100356552 168
208 3300025909 Ga0207705_10559873 Ga0207705_105598732 168
209 3300025911 Ga0207654_10284042 Ga0207654_102840422 168
210 3300025912 Ga0207707_10075503 Ga0207707_100755032 168
211 3300025913 Ga0207695_10091199 Ga0207695_100911994 168
212 3300025917 Ga0207660_10297607 Ga0207660_102976072 168
213 3300025921 Ga0207652_10055634 Ga0207652_100556342 168
214 3300025924 Ga0207694_10223871 Ga0207694_102238712 168
215 3300025932 Ga0207690_10412609 Ga0207690_104126092 168
216 3300025938 Ga0207704_10405950 Ga0207704_104059502 168
217 3300025949 Ga0207667_10396000 Ga0207667_103960002 168
218 3300026041 Ga0207639_10307918 Ga0207639_103079182 168
219 3300026041 Ga0207639_10408666 Ga0207639_104086662 168
220 3300028379 Ga0268266_10001375 Ga0268266_100013759 168
221 3300028379 Ga0268266_10175941 Ga0268266_101759411 168
222 3300028800 Ga0265338_10104896 Ga0265338_101048962 168
223 3300031235 Ga0265330_10077243 Ga0265330_100772432 168
224 3300031242 Ga0265329_10049018 Ga0265329_100490182 168
225 3300031249 Ga0265339_10090133 Ga0265339_100901332 168
226 3300031250 Ga0265331_10031296 Ga0265331_100312962 168
227 3300031456 Ga0307513_10228881 Ga0307513_102288812 168
228 3300031711 Ga0265314_10038319 Ga0265314_100383194 168
229 3300044842 Ga0466957_0261367 Ga0466957_0261367_392_904 168
230 3300044842 Ga0466957_0459186 Ga0466957_0459186_174_686 168
231 3300045976 Ga0466967_0340894 Ga0466967_0340894_65_577 168
232 3300046557 Ga0495622_0022499 Ga0495622_0022499_1939_2472 168
233 3300049569 Ga0501032_0076864 Ga0501032_0076864_1293_1826 168
234 3300049570 Ga0501033_0023210 Ga0501033_0023210_3439_3972 168
235 3300049571 Ga0501034_0100862 Ga0501034_0100862_95_664 168
236 3300049574 Ga0501038_0327540 Ga0501038_0327540_189_758 168
237 3300049574 Ga0501038_0537241 Ga0501038_0537241_245_778 168
238 3300049579 Ga0501043_0142512 Ga0501043_0142512_894_1427 168
239 3300049580 Ga0501046_0324169 Ga0501046_0324169_124_657 168
240 3300049581 Ga0501047_0101496 Ga0501047_0101496_272_841 168
241 3300049581 Ga0501047_0518016 Ga0501047_0518016_193_726 168
242 3300049822 Ga0501035_0283247 Ga0501035_0283247_131_664 168
243 3300049823 Ga0501044_0064427 Ga0501044_0064427_1237_1806 168
244 3300049823 Ga0501044_0310535 Ga0501044_0310535_787_1320 168
245 3300053136 Ga0500559_0043386 Ga0500559_0043386_1415_1933 168
246 3300005338 Ga0068868_100175448 Ga0068868_1001754482 169
247 3300005347 Ga0070668_101120403 Ga0070668_1011204031 169
248 3300005543 Ga0070672_100707102 Ga0070672_1007071022 169
249 3300005548 Ga0070665_101584960 Ga0070665_1015849601 169
250 3300005842 Ga0068858_100301463 Ga0068858_1003014632 169
251 3300006237 Ga0097621_100000673 Ga0097621_10000067310 169
252 3300006237 Ga0097621_100033622 Ga0097621_1000336222 169
253 3300009093 Ga0105240_10689785 Ga0105240_106897852 169
254 3300009148 Ga0105243_10226519 Ga0105243_102265192 169
255 3300009148 Ga0105243_10505732 Ga0105243_105057322 169
256 3300009176 Ga0105242_10394942 Ga0105242_103949422 169
257 3300013296 Ga0157374_12001348 Ga0157374_120013481 169
258 3300014968 Ga0157379_10001454 Ga0157379_1000145413 169
259 3300014969 Ga0157376_10772981 Ga0157376_107729812 169
260 3300025911 Ga0207654_10800186 Ga0207654_108001861 169
261 3300025934 Ga0207686_10107510 Ga0207686_101075102 169
262 3300025935 Ga0207709_10071331 Ga0207709_100713313 169
263 3300025940 Ga0207691_10770551 Ga0207691_107705512 169
264 3300026142 Ga0207698_11336099 Ga0207698_113360992 169
265 3300028379 Ga0268266_11529594 Ga0268266_115295941 169
266 3300039437 Ga0436365_1338454 Ga0436365_1338454_59161_59703 169
267 3300048929 Ga0496126_0013807 Ga0496126_0013807_612_1151 169
268 3300053094 Ga0500566_0194363 Ga0500566_0194363_356_886 169
269 3300053103 Ga0500555_010595 Ga0500555_010595_1875_2399 169
270 3300053119 Ga0500595_001583 Ga0500595_001583_8331_8873 169
271 3300053119 Ga0500595_004834 Ga0500595_004834_920_1459 169
272 3300053119 Ga0500595_042050 Ga0500595_042050_199_720 169
273 3300053146 Ga0500588_0019521 Ga0500588_0019521_898_1419 169
274 3300005327 Ga0070658_10172261 Ga0070658_101722611 170
275 3300005329 Ga0070683_100076315 Ga0070683_1000763154 170
276 3300005330 Ga0070690_100071294 Ga0070690_1000712943 170
277 3300005331 Ga0070670_100646336 Ga0070670_1006463362 170
278 3300005335 Ga0070666_10104131 Ga0070666_101041312 170
279 3300005338 Ga0068868_100212393 Ga0068868_1002123932 170
280 3300005344 Ga0070661_100072855 Ga0070661_1000728552 170
281 3300005355 Ga0070671_100169851 Ga0070671_1001698512 170
282 3300005364 Ga0070673_100510774 Ga0070673_1005107741 170
283 3300005365 Ga0070688_100152867 Ga0070688_1001528671 170
284 3300005367 Ga0070667_100019018 Ga0070667_1000190182 170
285 3300005456 Ga0070678_100029113 Ga0070678_1000291132 170
286 3300005458 Ga0070681_10982575 Ga0070681_109825752 170
287 3300005459 Ga0068867_100065156 Ga0068867_1000651562 170
288 3300005466 Ga0070685_10186546 Ga0070685_101865462 170
289 3300005530 Ga0070679_101115630 Ga0070679_1011156302 170
290 3300005535 Ga0070684_100474481 Ga0070684_1004744812 170
291 3300005539 Ga0068853_100256017 Ga0068853_1002560172 170
292 3300005563 Ga0068855_101365042 Ga0068855_1013650422 170
293 3300005577 Ga0068857_100173997 Ga0068857_1001739972 170
294 3300005614 Ga0068856_100286454 Ga0068856_1002864543 170
295 3300005616 Ga0068852_100166192 Ga0068852_1001661923 170
296 3300005617 Ga0068859_100274911 Ga0068859_1002749112 170
297 3300005618 Ga0068864_100156999 Ga0068864_1001569993 170
298 3300005718 Ga0068866_10057902 Ga0068866_100579021 170
299 3300005719 Ga0068861_100150064 Ga0068861_1001500642 170
300 3300005834 Ga0068851_10171452 Ga0068851_101714522 170
301 3300005842 Ga0068858_100364640 Ga0068858_1003646403 170
302 3300005843 Ga0068860_100107154 Ga0068860_1001071542 170
303 3300006237 Ga0097621_100011628 Ga0097621_1000116284 170
304 3300006358 Ga0068871_100107015 Ga0068871_1001070151 170
305 3300006881 Ga0068865_100003490 Ga0068865_1000034906 170
306 3300006931 Ga0097620_100274919 Ga0097620_1002749192 170
307 3300009093 Ga0105240_10251172 Ga0105240_102511722 170
308 3300009098 Ga0105245_10145676 Ga0105245_101456763 170
309 3300009101 Ga0105247_10966833 Ga0105247_109668331 170
310 3300009174 Ga0105241_10096329 Ga0105241_100963292 170
311 3300009177 Ga0105248_10089475 Ga0105248_100894752 170
312 3300009177 Ga0105248_11648242 Ga0105248_116482422 170
313 3300009545 Ga0105237_10238834 Ga0105237_102388342 170
314 3300009551 Ga0105238_10007037 Ga0105238_100070373 170
315 3300009553 Ga0105249_10346669 Ga0105249_103466692 170
316 3300010375 Ga0105239_10132861 Ga0105239_101328612 170
317 3300011119 Ga0105246_10009121 Ga0105246_100091212 170
318 3300013102 Ga0157371_10807002 Ga0157371_108070022 170
319 3300013105 Ga0157369_10049793 Ga0157369_100497932 170
320 3300013296 Ga0157374_10060155 Ga0157374_100601552 170
321 3300013296 Ga0157374_10537390 Ga0157374_105373902 170
322 3300013297 Ga0157378_10038524 Ga0157378_100385243 170
323 3300013306 Ga0163162_10026382 Ga0163162_100263825 170
324 3300013307 Ga0157372_10090408 Ga0157372_100904083 170
325 3300013308 Ga0157375_10042953 Ga0157375_100429533 170
326 3300014325 Ga0163163_10310234 Ga0163163_103102342 170
327 3300014968 Ga0157379_10226196 Ga0157379_102261962 170
328 3300014969 Ga0157376_10099206 Ga0157376_100992062 170
329 3300017792 Ga0163161_10009873 Ga0163161_100098732 170
330 3300025321 Ga0207656_10186615 Ga0207656_101866152 170
331 3300025899 Ga0207642_10015558 Ga0207642_100155582 170
332 3300025911 Ga0207654_10293345 Ga0207654_102933452 170
333 3300025913 Ga0207695_10423823 Ga0207695_104238231 170
334 3300025924 Ga0207694_10058449 Ga0207694_100584492 170
335 3300025925 Ga0207650_10722402 Ga0207650_107224022 170
336 3300025927 Ga0207687_10553201 Ga0207687_105532012 170
337 3300025931 Ga0207644_10130089 Ga0207644_101300893 170
338 3300025934 Ga0207686_10039901 Ga0207686_100399013 170
339 3300025938 Ga0207704_10144465 Ga0207704_101444652 170
340 3300025942 Ga0207689_10091891 Ga0207689_100918912 170
341 3300025949 Ga0207667_10193176 Ga0207667_101931761 170
342 3300026035 Ga0207703_10337892 Ga0207703_103378923 170
343 3300026078 Ga0207702_10265608 Ga0207702_102656082 170
344 3300026095 Ga0207676_10561860 Ga0207676_105618602 170
345 3300026116 Ga0207674_10112933 Ga0207674_101129332 170
346 3300028379 Ga0268266_10189041 Ga0268266_101890412 170
347 3300036401 Ga0373937_0683884 Ga0373937_0683884_353_871 170
348 3300048924 Ga0496121_0000483 Ga0496121_0000483_15846_16370 170
349 3300005354 Ga0070675_100112756 Ga0070675_1001127563 171
350 3300005456 Ga0070678_100668763 Ga0070678_1006687632 171
351 3300005840 Ga0068870_10282011 Ga0068870_102820112 171
352 3300014326 Ga0157380_10217561 Ga0157380_102175612 171
353 3300025926 Ga0207659_10266106 Ga0207659_102661062 171
354 3300046663 Ga0495635_0497351 Ga0495635_0497351_125_655 171
355 3300046459 Ga0495629_0347457 Ga0495629_0347457_334_870 173
356 3300039438 Ga0436360_0457407 Ga0436360_0457407_264_791 174
357 3300003214 JGI25165J46597_1000036 JGI25165J46597_1000036245 175
358 3300025231 Ga0207427_104852 Ga0207427_1048522 175
359 3300025261 Ga0209233_1000015 Ga0209233_10000151022 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01252

Peptidase_A8

Signal peptidase (SPase) II

12

158

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dir-assembly4.cif.gz_D membrane protein at 2.8 angstroms 0.8831 15 164
5dir-assembly4.cif.gz_D membrane protein at 2.8 angstroms 0.872 15 164
5dir-assembly2.cif.gz_B membrane protein at 2.8 angstroms 0.8565 12 161
6ryo-assembly1.cif.gz_A bacterial membrane enzyme structure by the in meso method at 1.9 a resolution 0.8548 15 164
6ryp-assembly1.cif.gz_A bacterial membrane enzyme structure by the in meso method at 2.3 a resolution 0.8288 15 172
ID Description Score Start End Superfamily
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8731 19 162 3.90.1420.10
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.854 19 164 3.90.1420.10
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8505 19 162 3.90.1420.10
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8428 19 164 3.90.1420.10
af_P9WK99_39_178_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8253 19 162 3.90.1420.10
ID Description Score Start End GO Terms
AF-A0A523G0G3-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9472 12 163 GO:0004190
GO:0005886
GO:0006508
AF-A0A525I6A1-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9349 9 163 GO:0004190
GO:0005886
GO:0006508
AF-A0A1G6YY51-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9251 18 162 GO:0004190
GO:0005886
GO:0006508
AF-B8IB41-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9216 9 162 GO:0004190
GO:0005886
GO:0006508
AF-A0A7W2B9V6-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9205 11 162 GO:0004190
GO:0005886
GO:0006508

Feature Viewer

pLDDT pTM Quality
80.44 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map