F421428

General Info

Members Datasets Scaffolds Average Seq Length
359 236 359 128

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100225201|Ga0070660_1002252012
Length 153
Sequence VPGWPPSLGKIVAGDVTRLVEKAEHDLMTSPDIRAALERHWAASDASDFETEHEIYRDDAILDYPQSGERIRGRRQIQLSRTAQQNKKRFSIKRILGKDDLWITEYVLTYDGQPSYVVSIMEFLGGQVAHETQYFGDAFEPGPSRAQWVEPIR

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
86 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
87 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
230 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
231 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
232 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
233 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
234 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
235 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
236 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.69
Nodule 0
Rhizoplane 11.98
Rhizosphere 75.77
Stem 0
Stem Tuber 0
Unclassified 5.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10092510 3300003322 Bacteria 1457
2 Ga0070670_100010555 3300005331 Bacteria 7887
3 Ga0070680_100612568 3300005336 Bacteria 935
4 Ga0068868_100053015 3300005338 Bacteria 3194
5 Ga0068868_100547763 3300005338 Bacteria 1019
6 Ga0070660_100225201 3300005339 Bacteria 1525
7 Ga0070689_100088870 3300005340 Bacteria 2433
8 Ga0070687_100333909 3300005343 Bacteria 973
9 Ga0070668_100286483 3300005347 Bacteria 1377
10 Ga0070671_100011118 3300005355 Bacteria 7229
11 Ga0070674_100296013 3300005356 Bacteria 1288
12 Ga0070673_100005568 3300005364 Bacteria 8073
13 Ga0070688_100066050 3300005365 Bacteria 2301
14 Ga0070667_100000378 3300005367 Bacteria 48704
15 Ga0070667_100107020 3300005367 Bacteria 2421
16 Ga0070709_10062288 3300005434 Bacteria 2378
17 Ga0070709_10072552 3300005434 Bacteria 2226
18 Ga0070714_100026568 3300005435 Bacteria 4785
19 Ga0070713_100030830 3300005436 Bacteria 4264
20 Ga0070713_100389992 3300005436 Bacteria 1299
21 Ga0070713_100530141 3300005436 Bacteria 1114
22 Ga0070710_10041563 3300005437 Bacteria 2539
23 Ga0070710_10082995 3300005437 Bacteria 1875
24 Ga0070710_11228756 3300005437 Bacteria 555
25 Ga0070711_100251052 3300005439 Unclassified 1387
26 Ga0070711_100453746 3300005439 Bacteria 1050
27 Ga0070705_100769057 3300005440 Bacteria 763
28 Ga0070708_100360821 3300005445 Bacteria 1369
29 Ga0070678_100693400 3300005456 Bacteria 917
30 Ga0070662_100151876 3300005457 Bacteria 1804
31 Ga0068867_101110630 3300005459 Bacteria 722
32 Ga0070685_10973898 3300005466 Bacteria 635
33 Ga0070706_100434575 3300005467 Bacteria 1222
34 Ga0070707_100515759 3300005468 Bacteria 1157
35 Ga0070707_101034420 3300005468 Bacteria 787
36 Ga0070698_100334501 3300005471 Bacteria 1446
37 Ga0070698_102133342 3300005471 Bacteria 514
38 Ga0070699_100384326 3300005518 Bacteria 1268
39 Ga0070699_100421861 3300005518 Bacteria 1207
40 Ga0070679_100087452 3300005530 Bacteria 3103
41 Ga0070697_100046854 3300005536 Bacteria 3504
42 Ga0070697_100786409 3300005536 Bacteria 842
43 Ga0070672_100219706 3300005543 Bacteria 1594
44 Ga0070695_100869483 3300005545 Bacteria 726
45 Ga0070665_100158641 3300005548 Bacteria 2264
46 Ga0070665_100280908 3300005548 Bacteria 1667
47 Ga0070665_101658129 3300005548 Bacteria 647
48 Ga0070704_100148792 3300005549 Bacteria 1838
49 Ga0068857_100086635 3300005577 Bacteria 2801
50 Ga0068856_100525886 3300005614 Bacteria 1204
51 Ga0068852_100758177 3300005616 Bacteria 983
52 Ga0068852_101856977 3300005616 Unclassified 625
53 Ga0068866_11253616 3300005718 Bacteria 537
54 Ga0068861_100101215 3300005719 Bacteria 2292
55 Ga0068858_100418608 3300005842 Unclassified 1288
56 Ga0068860_100277203 3300005843 Bacteria 1638
57 Ga0068862_100202936 3300005844 Bacteria 1788
58 Ga0068862_100638404 3300005844 Bacteria 1026
59 Ga0081455_10015831 3300005937 Bacteria 7303
60 Ga0081455_10216127 3300005937 Unclassified 1425
61 Ga0081455_10217651 3300005937 Bacteria 1418
62 Ga0081539_10132533 3300005985 Bacteria 1222
63 Ga0070717_10019143 3300006028 Bacteria 5363
64 Ga0070717_10308206 3300006028 Bacteria 1408
65 Ga0075365_10130107 3300006038 Bacteria 1742
66 Ga0075365_10399038 3300006038 Bacteria 970
67 Ga0075368_10101021 3300006042 Bacteria 1184
68 Ga0075364_10211032 3300006051 Bacteria 1317
69 Ga0070712_100796655 3300006175 Bacteria 810
70 Ga0070712_100899268 3300006175 Bacteria 763
71 Ga0070712_101116149 3300006175 Bacteria 685
72 Ga0070712_101697601 3300006175 Bacteria 553
73 Ga0075362_10008888 3300006177 Bacteria 3862
74 Ga0075362_10158807 3300006177 Bacteria 1088
75 Ga0075367_10017801 3300006178 Bacteria 3907
76 Ga0075367_10836131 3300006178 Bacteria 587
77 Ga0075369_10000465 3300006186 Bacteria 12424
78 Ga0097621_101258781 3300006237 Bacteria 698
79 Ga0075370_10114344 3300006353 Bacteria 1568
80 Ga0075370_10304600 3300006353 Bacteria 948
81 Ga0075428_101917269 3300006844 Bacteria 615
82 Ga0075433_10279194 3300006852 Bacteria 1480
83 Ga0075434_100018455 3300006871 Bacteria 6740
84 Ga0075434_100079291 3300006871 Bacteria 3280
85 Ga0075434_101029231 3300006871 Bacteria 837
86 Ga0075436_101233445 3300006914 Bacteria 565
87 Ga0099794_10183915 3300007265 Bacteria 1067
88 Ga0105240_11190071 3300009093 Bacteria 807
89 Ga0105240_11216769 3300009093 Bacteria 797
90 Ga0111539_10300307 3300009094 Bacteria 1869
91 Ga0105245_10141475 3300009098 Bacteria 2266
92 Ga0105245_10413522 3300009098 Bacteria 1350
93 Ga0105247_10149405 3300009101 Bacteria 1538
94 Ga0114129_10183079 3300009147 Bacteria 2849
95 Ga0105243_11435898 3300009148 Bacteria 712
96 Ga0105241_12283460 3300009174 Unclassified 538
97 Ga0105242_10202828 3300009176 Bacteria 1762
98 Ga0105242_11124832 3300009176 Unclassified 801
99 Ga0105242_11789140 3300009176 Bacteria 653
100 Ga0105248_10039421 3300009177 Bacteria 5290
101 Ga0105237_10356093 3300009545 Bacteria 1468
102 Ga0105237_11456878 3300009545 Bacteria 691
103 Ga0105237_11691672 3300009545 Bacteria 640
104 Ga0105238_10005950 3300009551 Bacteria 12091
105 Ga0105249_10051142 3300009553 Bacteria 3768
106 Ga0105249_10617006 3300009553 Bacteria 1140
107 Ga0105249_11259422 3300009553 Bacteria 811
108 Ga0099796_10411278 3300010159 Bacteria 595
109 Ga0105239_10677573 3300010375 Bacteria 1178
110 Ga0105246_10034209 3300011119 Bacteria 3384
111 Ga0105246_10495901 3300011119 Bacteria 1036
112 Ga0105246_11115777 3300011119 Bacteria 721
113 Ga0157369_10282052 3300013105 Bacteria 1730
114 Ga0157374_10314615 3300013296 Bacteria 1551
115 Ga0157378_11388037 3300013297 Bacteria 745
116 Ga0157378_11613466 3300013297 Bacteria 695
117 Ga0163162_10100520 3300013306 Bacteria 2983
118 Ga0163162_10240484 3300013306 Bacteria 1941
119 Ga0163162_10863321 3300013306 Bacteria 1020
120 Ga0163162_12854426 3300013306 Bacteria 556
121 Ga0157375_11529497 3300013308 Bacteria 788
122 Ga0163163_10093208 3300014325 Bacteria 3028
123 Ga0163163_10766205 3300014325 Bacteria 1028
124 Ga0163163_11318984 3300014325 Bacteria 784
125 Ga0163163_12478501 3300014325 Bacteria 577
126 Ga0163163_13273520 3300014325 Bacteria 505
127 Ga0157380_12579238 3300014326 Bacteria 574
128 Ga0157379_10265202 3300014968 Bacteria 1561
129 Ga0157376_10463740 3300014969 Bacteria 1238
130 Ga0157376_11162982 3300014969 Unclassified 799
131 Ga0157376_11595076 3300014969 Bacteria 687
132 Ga0213872_10240848 3300021361 Bacteria 765
133 Ga0213872_10278444 3300021361 Unclassified 699
134 Ga0213871_10009804 3300021441 Bacteria 2156
135 Ga0224572_1002937 3300024225 Bacteria 2820
136 Ga0228598_1001219 3300024227 Bacteria 5682
137 Ga0228598_1095049 3300024227 Bacteria 601
138 Ga0207426_1015432 3300025302 Bacteria 2769
139 Ga0207692_10031867 3300025898 Bacteria 2528
140 Ga0207710_10512101 3300025900 Bacteria 623
141 Ga0207685_10596191 3300025905 Bacteria 592
142 Ga0207645_10614879 3300025907 Bacteria 738
143 Ga0207684_10307346 3300025910 Bacteria 1367
144 Ga0207693_10978771 3300025915 Bacteria 647
145 Ga0207693_10985293 3300025915 Bacteria 644
146 Ga0207693_11099741 3300025915 Bacteria 604
147 Ga0207663_10389927 3300025916 Bacteria 1063
148 Ga0207663_11072644 3300025916 Unclassified 647
149 Ga0207660_10100823 3300025917 Bacteria 2156
150 Ga0207662_10367081 3300025918 Bacteria 970
151 Ga0207652_10125681 3300025921 Bacteria 2284
152 Ga0207652_11735476 3300025921 Bacteria 529
153 Ga0207646_10462173 3300025922 Bacteria 1145
154 Ga0207646_10799931 3300025922 Bacteria 840
155 Ga0207694_10009235 3300025924 Bacteria 7441
156 Ga0207650_10003824 3300025925 Bacteria 10295
157 Ga0207700_10044404 3300025928 Bacteria 3271
158 Ga0207700_11312791 3300025928 Bacteria 644
159 Ga0207664_10128234 3300025929 Bacteria 2132
160 Ga0207644_10005697 3300025931 Bacteria 8108
161 Ga0207644_10503665 3300025931 Bacteria 999
162 Ga0207706_10165229 3300025933 Bacteria 1945
163 Ga0207686_11282752 3300025934 Bacteria 601
164 Ga0207669_10788581 3300025937 Unclassified 787
165 Ga0207704_11576599 3300025938 Bacteria 564
166 Ga0207665_10108353 3300025939 Bacteria 1949
167 Ga0207665_10473338 3300025939 Unclassified 964
168 Ga0207691_10256151 3300025940 Bacteria 1509
169 Ga0207691_11598255 3300025940 Bacteria 530
170 Ga0207668_10152017 3300025972 Bacteria 1793
171 Ga0207640_10408058 3300025981 Bacteria 1108
172 Ga0207658_10092126 3300025986 Bacteria 2353
173 Ga0207658_10309611 3300025986 Bacteria 1364
174 Ga0207677_10028907 3300026023 Bacteria 3515
175 Ga0207677_10771545 3300026023 Bacteria 858
176 Ga0207703_10886700 3300026035 Bacteria 854
177 Ga0207702_10860120 3300026078 Bacteria 898
178 Ga0207674_10102499 3300026116 Bacteria 2842
179 Ga0207683_10338174 3300026121 Bacteria 1380
180 Ga0268266_10102283 3300028379 Bacteria 2527
181 Ga0268266_10113033 3300028379 Bacteria 2408
182 Ga0268265_11235681 3300028380 Bacteria 746
183 Ga0268264_10250587 3300028381 Bacteria 1645
184 Ga0265760_10121180 3300031090 Bacteria 840
185 Ga0265332_10060556 3300031238 Bacteria 1620
186 Ga0265340_10247508 3300031247 Bacteria 795
187 Ga0265327_10001650 3300031251 Bacteria 26944
188 Ga0307508_10450891 3300031616 Bacteria 879
189 Ga0265342_10397521 3300031712 Bacteria 712
190 Ga0373926_0192807 3300035083 Bacteria 783
191 Ga0373929_0015705 3300035085 Bacteria 1476
192 Ga0373934_0030430 3300035086 Bacteria 2111
193 Ga0373923_0022625 3300035111 Bacteria 2467
194 Ga0373923_0629898 3300035111 Bacteria 529
195 Ga0373932_0069590 3300035112 Bacteria 1088
196 Ga0373936_0089887 3300035113 Bacteria 1287
197 Ga0373936_0432445 3300035113 Bacteria 607
198 Ga0373945_0079836 3300035116 Bacteria 1252
199 Ga0373953_0249908 3300035117 Bacteria 771
200 Ga0373956_0114881 3300035119 Bacteria 1255
201 Ga0373957_0351506 3300035120 Bacteria 630
202 Ga0373943_0021021 3300035170 Bacteria 3014
203 Ga0373931_0059221 3300035691 Bacteria 2059
204 Ga0373935_0169936 3300035692 Bacteria 1491
205 Ga0373927_0085151 3300035695 Bacteria 2051
206 Ga0373927_0268542 3300035695 Unclassified 1122
207 Ga0373927_0745471 3300035695 Bacteria 647
208 Ga0373933_0118208 3300035724 Bacteria 1658
209 Ga0373933_0656452 3300035724 Unclassified 689
210 Ga0373947_1011642 3300035725 Bacteria 567
211 Ga0373937_0169884 3300036401 Bacteria 2046
212 Ga0373937_0271255 3300036401 Unclassified 1601
213 Ga0373937_0486652 3300036401 Bacteria 1172
214 Ga0373937_1082829 3300036401 Bacteria 750
215 Ga0373925_0053850 3300037068 Bacteria 3009
216 Ga0373925_0147157 3300037068 Bacteria 1847
217 Ga0373925_0380895 3300037068 Unclassified 1149
218 Ga0373925_0460370 3300037068 Bacteria 1042
219 Ga0395900_0582240 3300037418 Bacteria 1061
220 Ga0395905_0517251 3300037471 Bacteria 1094
221 Ga0395905_0651923 3300037471 Bacteria 955
222 Ga0436364_0288519 3300037853 Bacteria 886
223 Ga0436364_1115421 3300037853 Bacteria 758
224 Ga0436360_0493755 3300039438 Bacteria 1722
225 Ga0436360_0512015 3300039438 Bacteria 782
226 Ga0436360_0641134 3300039438 Bacteria 541
227 Ga0436360_0956297 3300039438 Bacteria 582
228 Ga0436360_1186751 3300039438 Unclassified 761
229 Ga0436360_1228710 3300039438 Bacteria 4269
230 Ga0436361_0113657 3300039447 Bacteria 858
231 Ga0436361_0446965 3300039447 Bacteria 3246
232 Ga0436361_0528238 3300039447 Bacteria 575
233 Ga0436361_0845388 3300039447 Bacteria 1890
234 Ga0436362_1232017 3300039453 Bacteria 718
235 Ga0451793_0829803 3300041452 Bacteria 625
236 Ga0451841_0644793 3300041498 Unclassified 525
237 Ga0495592_0186851 3300046454 Bacteria 1407
238 Ga0495638_0302870 3300046460 Bacteria 860
239 Ga0495651_0036717 3300046462 Bacteria 3814
240 Ga0495653_0046048 3300046463 Bacteria 3378
241 Ga0495582_0264505 3300046473 Bacteria 987
242 Ga0495639_0155717 3300046475 Bacteria 1104
243 Ga0495662_0449104 3300046476 Unclassified 633
244 Ga0495664_0156059 3300046477 Archaea 1384
245 Ga0495608_0077268 3300046511 Bacteria 2167
246 Ga0495608_0174323 3300046511 Bacteria 1363
247 Ga0495628_0293569 3300046516 Archaea 1204
248 Ga0495637_0140612 3300046520 Unclassified 916
249 Ga0495666_0363945 3300046526 Unclassified 651
250 Ga0495652_0174425 3300046529 Bacteria 1656
251 Ga0495640_0291821 3300046533 Bacteria 1014
252 Ga0495587_0184752 3300046536 Bacteria 1181
253 Ga0495609_0311442 3300046538 Unclassified 640
254 Ga0495645_0483283 3300046543 Bacteria 777
255 Ga0495667_0100214 3300046559 Bacteria 1875
256 Ga0495656_0566306 3300046615 Bacteria 606
257 Ga0495634_0270665 3300046642 Bacteria 1034
258 Ga0495635_0145145 3300046663 Bacteria 1616
259 Ga0495657_0603662 3300046675 Unclassified 635
260 Ga0495599_0385775 3300046678 Bacteria 836
261 Ga0495646_0130198 3300046680 Bacteria 1417
262 Ga0495658_0314555 3300046683 Bacteria 992
263 Ga0495613_0551025 3300046689 Bacteria 772
264 Ga0495613_0905609 3300046689 Bacteria 571
265 Ga0495600_0205844 3300046809 Bacteria 1262
266 Ga0495604_0205042 3300047317 Archaea 1365
267 Ga0495674_0195914 3300047319 Bacteria 1678
268 Ga0495675_0413381 3300047444 Unclassified 785
269 Ga0495679_036337 3300047446 Bacteria 1556
270 Ga0495684_0192138 3300047471 Bacteria 1509
271 Ga0495684_0356170 3300047471 Bacteria 1038
272 Ga0495684_0842313 3300047471 Bacteria 596
273 Ga0495686_0114953 3300047472 Bacteria 1610
274 Ga0495602_0921615 3300048088 Unclassified 580
275 Ga0495614_0082985 3300048089 Bacteria 1390
276 Ga0496100_0002788 3300048903 Bacteria 8938
277 Ga0496100_0035144 3300048903 Bacteria 3151
278 Ga0496100_0065168 3300048903 Bacteria 2413
279 Ga0496100_0466192 3300048903 Bacteria 970
280 Ga0496101_0000104 3300048904 Bacteria 87820
281 Ga0496101_0020184 3300048904 Bacteria 4557
282 Ga0496101_0774002 3300048904 Bacteria 757
283 Ga0496102_0006503 3300048905 Bacteria 9969
284 Ga0496102_0111055 3300048905 Bacteria 2555
285 Ga0496102_0174794 3300048905 Bacteria 2022
286 Ga0496102_0329000 3300048905 Bacteria 1439
287 Ga0496102_0899713 3300048905 Bacteria 807
288 Ga0496103_0037298 3300048906 Bacteria 2978
289 Ga0496103_0050884 3300048906 Bacteria 2563
290 Ga0496103_0694918 3300048906 Bacteria 645
291 Ga0496104_0005957 3300048907 Bacteria 10677
292 Ga0496105_0240591 3300048908 Bacteria 1469
293 Ga0496106_0013739 3300048909 Bacteria 5980
294 Ga0496106_0023382 3300048909 Bacteria 4591
295 Ga0496107_0026526 3300048910 Bacteria 4108
296 Ga0496107_0304343 3300048910 Bacteria 1186
297 Ga0496107_1133691 3300048910 Bacteria 564
298 Ga0496108_0049710 3300048911 Bacteria 3507
299 Ga0496108_0074220 3300048911 Bacteria 2872
300 Ga0496108_0206086 3300048911 Bacteria 1706
301 Ga0496109_0000427 3300048912 Bacteria 36973
302 Ga0496109_0012135 3300048912 Bacteria 7430
303 Ga0496109_0119324 3300048912 Bacteria 2456
304 Ga0496110_0002636 3300048913 Bacteria 13511
305 Ga0496110_0031712 3300048913 Bacteria 4561
306 Ga0496110_1058672 3300048913 Bacteria 719
307 Ga0496110_1408812 3300048913 Bacteria 606
308 Ga0496111_0020917 3300048914 Bacteria 4562
309 Ga0496111_0046428 3300048914 Bacteria 3127
310 Ga0496112_0016141 3300048915 Bacteria 6984
311 Ga0496112_0017286 3300048915 Bacteria 6773
312 Ga0496112_1422383 3300048915 Bacteria 608
313 Ga0496113_0009750 3300048916 Bacteria 6312
314 Ga0496114_0002749 3300048917 Bacteria 13456
315 Ga0496114_0720271 3300048917 Bacteria 874
316 Ga0496114_1444217 3300048917 Bacteria 575
317 Ga0496115_0018002 3300048918 Bacteria 5413
318 Ga0496116_0018912 3300048919 Bacteria 5290
319 Ga0496117_0111740 3300048920 Bacteria 1700
320 Ga0496117_0121018 3300048920 Bacteria 1607
321 Ga0496118_0024480 3300048921 Bacteria 5206
322 Ga0496119_0084524 3300048922 Bacteria 1819
323 Ga0496121_0000002 3300048924 Bacteria 1494588
324 Ga0496121_0101217 3300048924 Bacteria 2223
325 Ga0496122_0000141 3300048925 Bacteria 168707
326 Ga0496123_0009301 3300048926 Bacteria 8868
327 Ga0496124_0000002 3300048927 Bacteria 1494588
328 Ga0496125_0000002 3300048928 Bacteria 1480920
329 Ga0496125_0674473 3300048928 Bacteria 553
330 Ga0496126_0000011 3300048929 Bacteria 744275
331 Ga0496126_0153352 3300048929 Bacteria 1973
332 Ga0496126_1275597 3300048929 Bacteria 536
333 Ga0501070_0995659 3300049586 Bacteria 650
334 Ga0501080_0353371 3300049742 Bacteria 1327
335 nmdc:mga00v17_174971_c1 3300050491 Bacteria 1384
336 nmdc:mga0k408_136336_c1 3300050493 Bacteria 1458
337 nmdc:mga04h51_486937_c1 3300050495 Bacteria 525
338 nmdc:mga05p37_216446_c1 3300050507 Bacteria 2313
339 nmdc:mga08y16_534344_c1 3300050511 Bacteria 1188
340 nmdc:mga0n895_154169_c1 3300050512 Bacteria 2328
341 nmdc:mga0n895_941878_c1 3300050512 Bacteria 847
342 nmdc:mga0n895_96764_c1 3300050512 Bacteria 2957
343 nmdc:mga0rr50_1358677_c1 3300050513 Bacteria 602
344 nmdc:mga0a205_205619_c1 3300050515 Bacteria 1858
345 nmdc:mga0sz30_396526_c1 3300050516 Bacteria 618
346 Ga0495601_0075244 3300053077 Bacteria 2161
347 Ga0495601_0452511 3300053077 Bacteria 830
348 Ga0495601_1089716 3300053077 Bacteria 500
349 Ga0495612_0390183 3300053078 Bacteria 632
350 Ga0495619_0204700 3300053085 Bacteria 1366
351 Ga0495619_0622611 3300053085 Unclassified 737
352 Ga0500583_0402847 3300053092 Bacteria 656
353 Ga0500651_0048689 3300053093 Bacteria 2663
354 Ga0500641_0002069 3300053096 Bacteria 7123
355 Ga0500562_037851 3300053108 Bacteria 1281
356 Ga0500595_198340 3300053119 Bacteria 554
357 Ga0500642_0004845 3300053130 Bacteria 4264
358 Ga0500588_0340955 3300053146 Bacteria 569
359 Ga0500611_116788 3300053727 Bacteria 707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053108 Ga0500562_037851 Ga0500562_037851_329_703 124
2 3300005367 Ga0070667_100000378 Ga0070667_10000037829 125
3 3300005843 Ga0068860_100277203 Ga0068860_1002772033 125
4 3300009176 Ga0105242_11124832 Ga0105242_111248321 125
5 3300009545 Ga0105237_11456878 Ga0105237_114568781 125
6 3300009553 Ga0105249_10617006 Ga0105249_106170062 125
7 3300010375 Ga0105239_10677573 Ga0105239_106775731 125
8 3300013306 Ga0163162_10240484 Ga0163162_102404842 125
9 3300014325 Ga0163163_13273520 Ga0163163_132735201 125
10 3300021361 Ga0213872_10240848 Ga0213872_102408481 125
11 3300025986 Ga0207658_10092126 Ga0207658_100921264 125
12 3300028381 Ga0268264_10250587 Ga0268264_102505873 125
13 3300031251 Ga0265327_10001650 Ga0265327_100016509 125
14 3300035170 Ga0373943_0021021 Ga0373943_0021021_2286_2666 125
15 3300039438 Ga0436360_0641134 Ga0436360_0641134_74_454 125
16 3300048903 Ga0496100_0002788 Ga0496100_0002788_6382_6762 125
17 3300048904 Ga0496101_0000104 Ga0496101_0000104_46779_47159 125
18 3300048905 Ga0496102_0111055 Ga0496102_0111055_1454_1834 125
19 3300048906 Ga0496103_0050884 Ga0496103_0050884_1745_2125 125
20 3300048909 Ga0496106_0013739 Ga0496106_0013739_2805_3185 125
21 3300048910 Ga0496107_0304343 Ga0496107_0304343_738_1118 125
22 3300048911 Ga0496108_0206086 Ga0496108_0206086_318_698 125
23 3300048912 Ga0496109_0000427 Ga0496109_0000427_35313_35693 125
24 3300048913 Ga0496110_0002636 Ga0496110_0002636_12383_12763 125
25 3300048914 Ga0496111_0020917 Ga0496111_0020917_3207_3587 125
26 3300048915 Ga0496112_1422383 Ga0496112_1422383_10_390 125
27 3300048917 Ga0496114_0002749 Ga0496114_0002749_8863_9243 125
28 3300048918 Ga0496115_0018002 Ga0496115_0018002_4257_4637 125
29 3300048919 Ga0496116_0018912 Ga0496116_0018912_2996_3376 125
30 3300048920 Ga0496117_0111740 Ga0496117_0111740_599_979 125
31 3300048920 Ga0496117_0121018 Ga0496117_0121018_722_1102 125
32 3300048921 Ga0496118_0024480 Ga0496118_0024480_4766_5146 125
33 3300048922 Ga0496119_0084524 Ga0496119_0084524_958_1338 125
34 3300048924 Ga0496121_0000002 Ga0496121_0000002_972163_972543 125
35 3300048925 Ga0496122_0000141 Ga0496122_0000141_121532_121912 125
36 3300048926 Ga0496123_0009301 Ga0496123_0009301_6559_6939 125
37 3300048927 Ga0496124_0000002 Ga0496124_0000002_522046_522426 125
38 3300048928 Ga0496125_0000002 Ga0496125_0000002_972163_972543 125
39 3300048929 Ga0496126_0000011 Ga0496126_0000011_522046_522426 125
40 3300053077 Ga0495601_0452511 Ga0495601_0452511_241_621 125
41 3300003322 rootL2_10092510 rootL2_100925102 126
42 3300005331 Ga0070670_100010555 Ga0070670_1000105556 126
43 3300005336 Ga0070680_100612568 Ga0070680_1006125681 126
44 3300005338 Ga0068868_100053015 Ga0068868_1000530151 126
45 3300005338 Ga0068868_100547763 Ga0068868_1005477632 126
46 3300005339 Ga0070660_100225201 Ga0070660_1002252012 126
47 3300005340 Ga0070689_100088870 Ga0070689_1000888704 126
48 3300005343 Ga0070687_100333909 Ga0070687_1003339091 126
49 3300005347 Ga0070668_100286483 Ga0070668_1002864831 126
50 3300005355 Ga0070671_100011118 Ga0070671_1000111184 126
51 3300005356 Ga0070674_100296013 Ga0070674_1002960132 126
52 3300005364 Ga0070673_100005568 Ga0070673_1000055683 126
53 3300005365 Ga0070688_100066050 Ga0070688_1000660502 126
54 3300005367 Ga0070667_100107020 Ga0070667_1001070202 126
55 3300005434 Ga0070709_10062288 Ga0070709_100622883 126
56 3300005434 Ga0070709_10072552 Ga0070709_100725522 126
57 3300005435 Ga0070714_100026568 Ga0070714_1000265682 126
58 3300005436 Ga0070713_100030830 Ga0070713_1000308305 126
59 3300005436 Ga0070713_100389992 Ga0070713_1003899921 126
60 3300005436 Ga0070713_100530141 Ga0070713_1005301411 126
61 3300005437 Ga0070710_10041563 Ga0070710_100415633 126
62 3300005437 Ga0070710_10082995 Ga0070710_100829952 126
63 3300005437 Ga0070710_11228756 Ga0070710_112287561 126
64 3300005439 Ga0070711_100251052 Ga0070711_1002510522 126
65 3300005439 Ga0070711_100453746 Ga0070711_1004537462 126
66 3300005440 Ga0070705_100769057 Ga0070705_1007690571 126
67 3300005445 Ga0070708_100360821 Ga0070708_1003608212 126
68 3300005456 Ga0070678_100693400 Ga0070678_1006934002 126
69 3300005457 Ga0070662_100151876 Ga0070662_1001518762 126
70 3300005459 Ga0068867_101110630 Ga0068867_1011106301 126
71 3300005466 Ga0070685_10973898 Ga0070685_109738982 126
72 3300005467 Ga0070706_100434575 Ga0070706_1004345753 126
73 3300005468 Ga0070707_100515759 Ga0070707_1005157591 126
74 3300005468 Ga0070707_101034420 Ga0070707_1010344201 126
75 3300005471 Ga0070698_100334501 Ga0070698_1003345012 126
76 3300005471 Ga0070698_102133342 Ga0070698_1021333421 126
77 3300005518 Ga0070699_100384326 Ga0070699_1003843263 126
78 3300005518 Ga0070699_100421861 Ga0070699_1004218612 126
79 3300005530 Ga0070679_100087452 Ga0070679_1000874522 126
80 3300005536 Ga0070697_100046854 Ga0070697_1000468543 126
81 3300005536 Ga0070697_100786409 Ga0070697_1007864091 126
82 3300005543 Ga0070672_100219706 Ga0070672_1002197062 126
83 3300005545 Ga0070695_100869483 Ga0070695_1008694831 126
84 3300005548 Ga0070665_100158641 Ga0070665_1001586413 126
85 3300005548 Ga0070665_100280908 Ga0070665_1002809082 126
86 3300005548 Ga0070665_101658129 Ga0070665_1016581292 126
87 3300005549 Ga0070704_100148792 Ga0070704_1001487922 126
88 3300005577 Ga0068857_100086635 Ga0068857_1000866353 126
89 3300005614 Ga0068856_100525886 Ga0068856_1005258862 126
90 3300005616 Ga0068852_100758177 Ga0068852_1007581772 126
91 3300005616 Ga0068852_101856977 Ga0068852_1018569772 126
92 3300005718 Ga0068866_11253616 Ga0068866_112536161 126
93 3300005719 Ga0068861_100101215 Ga0068861_1001012153 126
94 3300005842 Ga0068858_100418608 Ga0068858_1004186082 126
95 3300005844 Ga0068862_100202936 Ga0068862_1002029362 126
96 3300005844 Ga0068862_100638404 Ga0068862_1006384042 126
97 3300005937 Ga0081455_10015831 Ga0081455_100158313 126
98 3300005937 Ga0081455_10216127 Ga0081455_102161272 126
99 3300005937 Ga0081455_10217651 Ga0081455_102176512 126
100 3300005985 Ga0081539_10132533 Ga0081539_101325332 126
101 3300006028 Ga0070717_10019143 Ga0070717_100191435 126
102 3300006028 Ga0070717_10308206 Ga0070717_103082062 126
103 3300006038 Ga0075365_10130107 Ga0075365_101301073 126
104 3300006038 Ga0075365_10399038 Ga0075365_103990382 126
105 3300006042 Ga0075368_10101021 Ga0075368_101010212 126
106 3300006051 Ga0075364_10211032 Ga0075364_102110322 126
107 3300006175 Ga0070712_100796655 Ga0070712_1007966551 126
108 3300006175 Ga0070712_100899268 Ga0070712_1008992681 126
109 3300006175 Ga0070712_101116149 Ga0070712_1011161491 126
110 3300006175 Ga0070712_101697601 Ga0070712_1016976011 126
111 3300006177 Ga0075362_10008888 Ga0075362_100088884 126
112 3300006177 Ga0075362_10158807 Ga0075362_101588072 126
113 3300006178 Ga0075367_10017801 Ga0075367_100178013 126
114 3300006178 Ga0075367_10836131 Ga0075367_108361311 126
115 3300006186 Ga0075369_10000465 Ga0075369_100004655 126
116 3300006237 Ga0097621_101258781 Ga0097621_1012587811 126
117 3300006353 Ga0075370_10114344 Ga0075370_101143443 126
118 3300006353 Ga0075370_10304600 Ga0075370_103046002 126
119 3300006844 Ga0075428_101917269 Ga0075428_1019172691 126
120 3300006852 Ga0075433_10279194 Ga0075433_102791942 126
121 3300006871 Ga0075434_100018455 Ga0075434_1000184556 126
122 3300006871 Ga0075434_100079291 Ga0075434_1000792914 126
123 3300006871 Ga0075434_101029231 Ga0075434_1010292311 126
124 3300006914 Ga0075436_101233445 Ga0075436_1012334451 126
125 3300007265 Ga0099794_10183915 Ga0099794_101839152 126
126 3300009093 Ga0105240_11190071 Ga0105240_111900712 126
127 3300009093 Ga0105240_11216769 Ga0105240_112167691 126
128 3300009094 Ga0111539_10300307 Ga0111539_103003072 126
129 3300009098 Ga0105245_10141475 Ga0105245_101414753 126
130 3300009098 Ga0105245_10413522 Ga0105245_104135221 126
131 3300009101 Ga0105247_10149405 Ga0105247_101494051 126
132 3300009147 Ga0114129_10183079 Ga0114129_101830793 126
133 3300009148 Ga0105243_11435898 Ga0105243_114358982 126
134 3300009174 Ga0105241_12283460 Ga0105241_122834601 126
135 3300009176 Ga0105242_10202828 Ga0105242_102028282 126
136 3300009176 Ga0105242_11789140 Ga0105242_117891401 126
137 3300009177 Ga0105248_10039421 Ga0105248_100394217 126
138 3300009545 Ga0105237_10356093 Ga0105237_103560932 126
139 3300009545 Ga0105237_11691672 Ga0105237_116916721 126
140 3300009551 Ga0105238_10005950 Ga0105238_1000595013 126
141 3300009553 Ga0105249_10051142 Ga0105249_100511426 126
142 3300009553 Ga0105249_11259422 Ga0105249_112594222 126
143 3300010159 Ga0099796_10411278 Ga0099796_104112781 126
144 3300011119 Ga0105246_10034209 Ga0105246_100342093 126
145 3300011119 Ga0105246_10495901 Ga0105246_104959012 126
146 3300011119 Ga0105246_11115777 Ga0105246_111157772 126
147 3300013105 Ga0157369_10282052 Ga0157369_102820522 126
148 3300013296 Ga0157374_10314615 Ga0157374_103146152 126
149 3300013297 Ga0157378_11388037 Ga0157378_113880371 126
150 3300013297 Ga0157378_11613466 Ga0157378_116134662 126
151 3300013306 Ga0163162_10100520 Ga0163162_101005201 126
152 3300013306 Ga0163162_10863321 Ga0163162_108633212 126
153 3300013306 Ga0163162_12854426 Ga0163162_128544261 126
154 3300013308 Ga0157375_11529497 Ga0157375_115294971 126
155 3300014325 Ga0163163_10093208 Ga0163163_100932083 126
156 3300014325 Ga0163163_10766205 Ga0163163_107662051 126
157 3300014325 Ga0163163_11318984 Ga0163163_113189841 126
158 3300014325 Ga0163163_12478501 Ga0163163_124785012 126
159 3300014326 Ga0157380_12579238 Ga0157380_125792381 126
160 3300014968 Ga0157379_10265202 Ga0157379_102652022 126
161 3300014969 Ga0157376_10463740 Ga0157376_104637402 126
162 3300014969 Ga0157376_11162982 Ga0157376_111629822 126
163 3300014969 Ga0157376_11595076 Ga0157376_115950762 126
164 3300021361 Ga0213872_10278444 Ga0213872_102784441 126
165 3300021441 Ga0213871_10009804 Ga0213871_100098043 126
166 3300024225 Ga0224572_1002937 Ga0224572_10029372 126
167 3300024227 Ga0228598_1001219 Ga0228598_10012196 126
168 3300024227 Ga0228598_1095049 Ga0228598_10950492 126
169 3300025302 Ga0207426_1015432 Ga0207426_10154321 126
170 3300025898 Ga0207692_10031867 Ga0207692_100318672 126
171 3300025900 Ga0207710_10512101 Ga0207710_105121011 126
172 3300025905 Ga0207685_10596191 Ga0207685_105961911 126
173 3300025907 Ga0207645_10614879 Ga0207645_106148792 126
174 3300025910 Ga0207684_10307346 Ga0207684_103073462 126
175 3300025915 Ga0207693_10978771 Ga0207693_109787711 126
176 3300025915 Ga0207693_10985293 Ga0207693_109852931 126
177 3300025915 Ga0207693_11099741 Ga0207693_110997411 126
178 3300025916 Ga0207663_10389927 Ga0207663_103899272 126
179 3300025916 Ga0207663_11072644 Ga0207663_110726441 126
180 3300025917 Ga0207660_10100823 Ga0207660_101008232 126
181 3300025918 Ga0207662_10367081 Ga0207662_103670811 126
182 3300025921 Ga0207652_10125681 Ga0207652_101256813 126
183 3300025921 Ga0207652_11735476 Ga0207652_117354761 126
184 3300025922 Ga0207646_10462173 Ga0207646_104621732 126
185 3300025922 Ga0207646_10799931 Ga0207646_107999312 126
186 3300025924 Ga0207694_10009235 Ga0207694_100092352 126
187 3300025925 Ga0207650_10003824 Ga0207650_100038243 126
188 3300025928 Ga0207700_10044404 Ga0207700_100444042 126
189 3300025928 Ga0207700_11312791 Ga0207700_113127912 126
190 3300025929 Ga0207664_10128234 Ga0207664_101282342 126
191 3300025931 Ga0207644_10005697 Ga0207644_100056975 126
192 3300025931 Ga0207644_10503665 Ga0207644_105036653 126
193 3300025933 Ga0207706_10165229 Ga0207706_101652292 126
194 3300025934 Ga0207686_11282752 Ga0207686_112827521 126
195 3300025937 Ga0207669_10788581 Ga0207669_107885811 126
196 3300025938 Ga0207704_11576599 Ga0207704_115765991 126
197 3300025939 Ga0207665_10108353 Ga0207665_101083533 126
198 3300025939 Ga0207665_10473338 Ga0207665_104733382 126
199 3300025940 Ga0207691_10256151 Ga0207691_102561512 126
200 3300025940 Ga0207691_11598255 Ga0207691_115982551 126
201 3300025972 Ga0207668_10152017 Ga0207668_101520172 126
202 3300025981 Ga0207640_10408058 Ga0207640_104080582 126
203 3300025986 Ga0207658_10309611 Ga0207658_103096112 126
204 3300026023 Ga0207677_10028907 Ga0207677_100289071 126
205 3300026023 Ga0207677_10771545 Ga0207677_107715452 126
206 3300026035 Ga0207703_10886700 Ga0207703_108867002 126
207 3300026078 Ga0207702_10860120 Ga0207702_108601201 126
208 3300026116 Ga0207674_10102499 Ga0207674_101024993 126
209 3300026121 Ga0207683_10338174 Ga0207683_103381742 126
210 3300028379 Ga0268266_10102283 Ga0268266_101022832 126
211 3300028379 Ga0268266_10113033 Ga0268266_101130333 126
212 3300028380 Ga0268265_11235681 Ga0268265_112356812 126
213 3300031090 Ga0265760_10121180 Ga0265760_101211801 126
214 3300031238 Ga0265332_10060556 Ga0265332_100605562 126
215 3300031247 Ga0265340_10247508 Ga0265340_102475082 126
216 3300031616 Ga0307508_10450891 Ga0307508_104508911 126
217 3300031712 Ga0265342_10397521 Ga0265342_103975212 126
218 3300035083 Ga0373926_0192807 Ga0373926_0192807_160_540 126
219 3300035085 Ga0373929_0015705 Ga0373929_0015705_852_1232 126
220 3300035086 Ga0373934_0030430 Ga0373934_0030430_785_1165 126
221 3300035111 Ga0373923_0022625 Ga0373923_0022625_1269_1649 126
222 3300035111 Ga0373923_0629898 Ga0373923_0629898_31_411 126
223 3300035112 Ga0373932_0069590 Ga0373932_0069590_633_1013 126
224 3300035113 Ga0373936_0089887 Ga0373936_0089887_105_485 126
225 3300035113 Ga0373936_0432445 Ga0373936_0432445_129_509 126
226 3300035116 Ga0373945_0079836 Ga0373945_0079836_83_463 126
227 3300035117 Ga0373953_0249908 Ga0373953_0249908_149_529 126
228 3300035119 Ga0373956_0114881 Ga0373956_0114881_406_819 126
229 3300035120 Ga0373957_0351506 Ga0373957_0351506_223_603 126
230 3300035691 Ga0373931_0059221 Ga0373931_0059221_267_647 126
231 3300035692 Ga0373935_0169936 Ga0373935_0169936_406_786 126
232 3300035695 Ga0373927_0085151 Ga0373927_0085151_1153_1533 126
233 3300035695 Ga0373927_0268542 Ga0373927_0268542_154_534 126
234 3300035695 Ga0373927_0745471 Ga0373927_0745471_245_625 126
235 3300035724 Ga0373933_0118208 Ga0373933_0118208_38_418 126
236 3300035724 Ga0373933_0656452 Ga0373933_0656452_189_569 126
237 3300035725 Ga0373947_1011642 Ga0373947_1011642_84_464 126
238 3300036401 Ga0373937_0169884 Ga0373937_0169884_1561_1950 126
239 3300036401 Ga0373937_0271255 Ga0373937_0271255_1135_1524 126
240 3300036401 Ga0373937_0486652 Ga0373937_0486652_198_593 126
241 3300036401 Ga0373937_1082829 Ga0373937_1082829_294_674 126
242 3300037068 Ga0373925_0053850 Ga0373925_0053850_936_1316 126
243 3300037068 Ga0373925_0147157 Ga0373925_0147157_1264_1644 126
244 3300037068 Ga0373925_0380895 Ga0373925_0380895_654_1034 126
245 3300037068 Ga0373925_0460370 Ga0373925_0460370_271_651 126
246 3300037418 Ga0395900_0582240 Ga0395900_0582240_116_496 126
247 3300037471 Ga0395905_0517251 Ga0395905_0517251_163_588 126
248 3300037471 Ga0395905_0651923 Ga0395905_0651923_212_592 126
249 3300037853 Ga0436364_0288519 Ga0436364_0288519_480_860 126
250 3300037853 Ga0436364_1115421 Ga0436364_1115421_277_657 126
251 3300039438 Ga0436360_0493755 Ga0436360_0493755_228_608 126
252 3300039438 Ga0436360_0512015 Ga0436360_0512015_232_612 126
253 3300039438 Ga0436360_0956297 Ga0436360_0956297_90_470 126
254 3300039438 Ga0436360_1186751 Ga0436360_1186751_253_633 126
255 3300039438 Ga0436360_1228710 Ga0436360_1228710_148_528 126
256 3300039447 Ga0436361_0113657 Ga0436361_0113657_381_761 126
257 3300039447 Ga0436361_0446965 Ga0436361_0446965_989_1381 126
258 3300039447 Ga0436361_0528238 Ga0436361_0528238_136_516 126
259 3300039447 Ga0436361_0845388 Ga0436361_0845388_365_781 126
260 3300039453 Ga0436362_1232017 Ga0436362_1232017_113_493 126
261 3300041452 Ga0451793_0829803 Ga0451793_0829803_232_612 126
262 3300041498 Ga0451841_0644793 Ga0451841_0644793_66_467 126
263 3300046454 Ga0495592_0186851 Ga0495592_0186851_170_622 126
264 3300046460 Ga0495638_0302870 Ga0495638_0302870_87_467 126
265 3300046462 Ga0495651_0036717 Ga0495651_0036717_862_1242 126
266 3300046463 Ga0495653_0046048 Ga0495653_0046048_66_446 126
267 3300046473 Ga0495582_0264505 Ga0495582_0264505_437_817 126
268 3300046475 Ga0495639_0155717 Ga0495639_0155717_210_590 126
269 3300046476 Ga0495662_0449104 Ga0495662_0449104_171_551 126
270 3300046477 Ga0495664_0156059 Ga0495664_0156059_133_513 126
271 3300046511 Ga0495608_0077268 Ga0495608_0077268_244_624 126
272 3300046511 Ga0495608_0174323 Ga0495608_0174323_811_1191 126
273 3300046516 Ga0495628_0293569 Ga0495628_0293569_500_880 126
274 3300046520 Ga0495637_0140612 Ga0495637_0140612_367_747 126
275 3300046526 Ga0495666_0363945 Ga0495666_0363945_166_546 126
276 3300046529 Ga0495652_0174425 Ga0495652_0174425_1205_1585 126
277 3300046533 Ga0495640_0291821 Ga0495640_0291821_527_979 126
278 3300046536 Ga0495587_0184752 Ga0495587_0184752_142_522 126
279 3300046538 Ga0495609_0311442 Ga0495609_0311442_220_600 126
280 3300046543 Ga0495645_0483283 Ga0495645_0483283_64_444 126
281 3300046559 Ga0495667_0100214 Ga0495667_0100214_910_1290 126
282 3300046615 Ga0495656_0566306 Ga0495656_0566306_164_544 126
283 3300046642 Ga0495634_0270665 Ga0495634_0270665_461_913 126
284 3300046663 Ga0495635_0145145 Ga0495635_0145145_296_676 126
285 3300046675 Ga0495657_0603662 Ga0495657_0603662_189_569 126
286 3300046678 Ga0495599_0385775 Ga0495599_0385775_315_695 126
287 3300046680 Ga0495646_0130198 Ga0495646_0130198_112_492 126
288 3300046683 Ga0495658_0314555 Ga0495658_0314555_225_605 126
289 3300046689 Ga0495613_0551025 Ga0495613_0551025_30_410 126
290 3300046689 Ga0495613_0905609 Ga0495613_0905609_104_484 126
291 3300046809 Ga0495600_0205844 Ga0495600_0205844_461_841 126
292 3300047317 Ga0495604_0205042 Ga0495604_0205042_170_550 126
293 3300047319 Ga0495674_0195914 Ga0495674_0195914_239_691 126
294 3300047444 Ga0495675_0413381 Ga0495675_0413381_208_597 126
295 3300047446 Ga0495679_036337 Ga0495679_036337_660_1040 126
296 3300047471 Ga0495684_0192138 Ga0495684_0192138_20_400 126
297 3300047471 Ga0495684_0356170 Ga0495684_0356170_578_958 126
298 3300047471 Ga0495684_0842313 Ga0495684_0842313_95_475 126
299 3300047472 Ga0495686_0114953 Ga0495686_0114953_206_586 126
300 3300048088 Ga0495602_0921615 Ga0495602_0921615_38_427 126
301 3300048089 Ga0495614_0082985 Ga0495614_0082985_945_1325 126
302 3300048903 Ga0496100_0035144 Ga0496100_0035144_1551_1946 126
303 3300048903 Ga0496100_0065168 Ga0496100_0065168_1839_2219 126
304 3300048903 Ga0496100_0466192 Ga0496100_0466192_283_663 126
305 3300048904 Ga0496101_0020184 Ga0496101_0020184_1487_1882 126
306 3300048904 Ga0496101_0774002 Ga0496101_0774002_123_503 126
307 3300048905 Ga0496102_0006503 Ga0496102_0006503_7127_7522 126
308 3300048905 Ga0496102_0174794 Ga0496102_0174794_663_1094 126
309 3300048905 Ga0496102_0329000 Ga0496102_0329000_1018_1398 126
310 3300048905 Ga0496102_0899713 Ga0496102_0899713_79_459 126
311 3300048906 Ga0496103_0037298 Ga0496103_0037298_1634_2029 126
312 3300048906 Ga0496103_0694918 Ga0496103_0694918_226_606 126
313 3300048907 Ga0496104_0005957 Ga0496104_0005957_8377_8757 126
314 3300048908 Ga0496105_0240591 Ga0496105_0240591_271_714 126
315 3300048909 Ga0496106_0023382 Ga0496106_0023382_1826_2221 126
316 3300048910 Ga0496107_0026526 Ga0496107_0026526_1339_1734 126
317 3300048910 Ga0496107_1133691 Ga0496107_1133691_146_526 126
318 3300048911 Ga0496108_0049710 Ga0496108_0049710_1712_2107 126
319 3300048911 Ga0496108_0074220 Ga0496108_0074220_623_1054 126
320 3300048912 Ga0496109_0012135 Ga0496109_0012135_5370_5765 126
321 3300048912 Ga0496109_0119324 Ga0496109_0119324_757_1137 126
322 3300048913 Ga0496110_0031712 Ga0496110_0031712_1787_2182 126
323 3300048913 Ga0496110_1058672 Ga0496110_1058672_297_677 126
324 3300048913 Ga0496110_1408812 Ga0496110_1408812_197_577 126
325 3300048914 Ga0496111_0046428 Ga0496111_0046428_1627_2070 126
326 3300048915 Ga0496112_0016141 Ga0496112_0016141_557_988 126
327 3300048915 Ga0496112_0017286 Ga0496112_0017286_4838_5233 126
328 3300048916 Ga0496113_0009750 Ga0496113_0009750_2387_2782 126
329 3300048917 Ga0496114_0720271 Ga0496114_0720271_209_589 126
330 3300048917 Ga0496114_1444217 Ga0496114_1444217_97_492 126
331 3300048924 Ga0496121_0101217 Ga0496121_0101217_580_960 126
332 3300048928 Ga0496125_0674473 Ga0496125_0674473_75_455 126
333 3300048929 Ga0496126_0153352 Ga0496126_0153352_89_469 126
334 3300048929 Ga0496126_1275597 Ga0496126_1275597_94_474 126
335 3300049586 Ga0501070_0995659 Ga0501070_0995659_16_396 126
336 3300049742 Ga0501080_0353371 Ga0501080_0353371_893_1273 126
337 3300050491 nmdc:mga00v17_174971_c1 nmdc:mga00v17_174971_c1_547_927 126
338 3300050493 nmdc:mga0k408_136336_c1 nmdc:mga0k408_136336_c1_72_452 126
339 3300050495 nmdc:mga04h51_486937_c1 nmdc:mga04h51_486937_c1_76_456 126
340 3300050507 nmdc:mga05p37_216446_c1 nmdc:mga05p37_216446_c1_724_1137 126
341 3300050511 nmdc:mga08y16_534344_c1 nmdc:mga08y16_534344_c1_108_488 126
342 3300050512 nmdc:mga0n895_154169_c1 nmdc:mga0n895_154169_c1_1054_1437 126
343 3300050512 nmdc:mga0n895_941878_c1 nmdc:mga0n895_941878_c1_105_485 126
344 3300050512 nmdc:mga0n895_96764_c1 nmdc:mga0n895_96764_c1_1715_2128 126
345 3300050513 nmdc:mga0rr50_1358677_c1 nmdc:mga0rr50_1358677_c1_122_535 126
346 3300050515 nmdc:mga0a205_205619_c1 nmdc:mga0a205_205619_c1_880_1293 126
347 3300050516 nmdc:mga0sz30_396526_c1 nmdc:mga0sz30_396526_c1_27_407 126
348 3300053077 Ga0495601_0075244 Ga0495601_0075244_1504_1884 126
349 3300053077 Ga0495601_1089716 Ga0495601_1089716_63_443 126
350 3300053078 Ga0495612_0390183 Ga0495612_0390183_86_466 126
351 3300053085 Ga0495619_0204700 Ga0495619_0204700_23_403 126
352 3300053085 Ga0495619_0622611 Ga0495619_0622611_187_567 126
353 3300053092 Ga0500583_0402847 Ga0500583_0402847_119_499 126
354 3300053093 Ga0500651_0048689 Ga0500651_0048689_96_497 126
355 3300053096 Ga0500641_0002069 Ga0500641_0002069_6425_6805 126
356 3300053119 Ga0500595_198340 Ga0500595_198340_99_479 126
357 3300053130 Ga0500642_0004845 Ga0500642_0004845_1809_2189 126
358 3300053146 Ga0500588_0340955 Ga0500588_0340955_167_547 126
359 3300053727 Ga0500611_116788 Ga0500611_116788_163_543 126

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f40-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function (yp_677363.1) from cytophaga hutchinsonii atcc 33406 at 1.27 a resolution 0.9098 6 111
2bng-assembly1.cif.gz_B structure of an m.tuberculosis leh-like epoxide hydrolase 0.8798 1 108
5aii-assembly1.cif.gz_H discovery and characterization of thermophilic limonene-1,2-epoxide hydrolases from hot spring metagenomic libraries. ch55-sample-peg complex 0.878 8 108
1vzz-assembly1.cif.gz_A crystal structure of mutant enzyme y32f/d103l of ketosteroid isomerase from pseudomonas putida biotype b 0.8724 6 109
4kvh-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase fold protein hmuk_0747 0.8681 4 110
ID Description Score Start End Superfamily
3en8A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9572 5 110 3.10.450.50
3en8A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9144 5 110 3.10.450.50
2bngA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8857 3 108 3.10.450.50
5aiiN00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8802 8 108 3.10.450.50
3f40A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8795 6 111 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A838J2U5-F1-model_v4 Nuclear transport factor 2 family protein 0.9905 1 97
AF-A0A838J2U5-F1-model_v4 Nuclear transport factor 2 family protein 0.9805 1 97
AF-A0A6I5PEV7-F1-model_v4 deleted 0.948 65 108
AF-A0A7W0S7T6-F1-model_v4 deleted 0.9427 10 108
AF-A0A6J4VCE0-F1-model_v4 SnoaL-like domain-containing protein 0.9284 6 107

Feature Viewer

pLDDT pTM Quality
93.38 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map