F421366

General Info

Members Datasets Scaffolds Average Seq Length
358 278 716 230

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2936361878|2936365501
Length 278
Sequence EVLFLIWKNLKTLWRHKIFMIMIILLGEILLEWKGIDYGGSVNMHDINLFLALGAGFMSFISPCCLPLYPAFLSYITGMSVGELQSENAMLQKRSLLHTLFFLIGFSVIFIAIGFGTTFVGSFFREYKDLIRQLGGIFIIFFGLMIVGVFKPEFMMRDRRIEFKHRPSGYIGSILIGMAFAAGWTPCTGPILSIVISLAATNPSSGVIYMTAYSLGFAIPFFILSFFVGRLKWIKRHSGKIMQIGGYIMIVMGIMLFFDWMTKIITIFQSLFGGFSGF

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
45 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
71 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
72 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
73 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
74 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
75 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
76 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
77 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
78 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
79 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
82 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
83 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
84 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
85 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
91 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
92 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
93 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
94 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
95 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
96 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
97 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
118 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
119 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
127 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
128 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
129 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
130 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
131 2554235283 Bacillus safensis VK Isolate Rhizosphere
132 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
133 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
134 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
135 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
136 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
137 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
138 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
139 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
140 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
141 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
142 2643221729 Bacillus sp. Root11 Isolate Unclassified
143 2643221730 Bacillus sp. Root131 Isolate Unclassified
144 2643221731 Bacillus sp. Root147 Isolate Unclassified
145 2643221732 Bacillus sp. Root239 Isolate Unclassified
146 2643221735 Bacillus sp. Root920 Isolate Unclassified
147 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
148 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
149 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
150 2684622632 Bacillus cereus 905 Isolate Unclassified
151 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
152 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
153 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
154 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
155 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
156 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
157 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
158 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
159 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
160 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
161 2738541295 Bacillus sp. OK085 Isolate Unclassified
162 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
163 2738541358 Bacillus sp. OV752 Isolate Unclassified
164 2738543006 Bacillus sp. OK077 Isolate Unclassified
165 2738543010 Bacillus sp. YR335 Isolate Unclassified
166 2738543017 Bacillus sp. OV186 Isolate Unclassified
167 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
168 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
169 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
170 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
171 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
172 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
173 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
174 2811994870 Bacillus sp. JB4 Isolate Unclassified
175 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
176 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
177 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
178 2818991441 Niallia circulans 3243 Isolate Rhizosphere
179 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
180 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
181 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
182 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
183 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
184 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
185 2842682962 Bacillus sp. R-72492 Isolate Unclassified
186 2842882022 Bacillus sp. R-71893 Isolate Unclassified
187 2849139964 Bacillus sp. R-71875 Isolate Unclassified
188 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
189 2857581216 Bacillus sp. R-71922 Isolate Unclassified
190 2857586860 Bacillus sp. R-71935 Isolate Unclassified
191 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
192 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
193 2860837431 Bacillus sp. WR11 Isolate Unclassified
194 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
195 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
196 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
197 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
198 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
199 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
200 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
201 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
202 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
203 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
204 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
205 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
206 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
207 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
208 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
209 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
210 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
211 2919720352 Priestia megaterium 4340 Isolate Unclassified
212 2919726948 Bacillus pumilus 4489 Isolate Unclassified
213 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
214 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
215 2929004312 Priestia megaterium 1104 Isolate Unclassified
216 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
217 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
218 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
219 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
220 2938917290 Bacillus sp. CR71 Isolate Unclassified
221 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
222 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
223 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
224 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
225 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
226 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
227 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
228 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
229 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
230 2965761152 Bacillus sp. COPE52 Isolate Unclassified
231 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
232 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
233 2969141011 Bacillus velezensis MH25 Isolate Unclassified
234 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
235 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
236 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
237 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
238 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
239 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
240 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
241 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
242 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
243 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
244 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
245 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
246 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
247 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
248 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
249 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
250 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
251 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
252 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
253 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
254 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
255 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
256 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
257 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
258 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
259 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
260 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
261 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
262 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
263 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
264 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
265 8022653035 Bacillus sp. Rc4 Isolate Unclassified
266 8022792930 Bacillus sp. Xin Isolate Rhizosphere
267 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
268 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
269 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
270 8023438354 Bacillus sp. BH2 Isolate Unclassified
271 8023444577 Bacillus sp. BH32 Isolate Unclassified
272 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
273 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
274 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
275 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
276 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
277 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
278 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 45.25
Metatranscriptomes 7.54
Isolates 47.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.94
Nodule 0.28
Rhizoplane 5.31
Rhizosphere 56.42
Stem 0
Stem Tuber 0
Unclassified 2.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1008243 3300002987 Bacteria 2886
2 JGI25151J46595_10000012 3300003187 Bacteria 254028
3 JGI25151J46595_10008156 3300003187 Bacteria 5065
4 JGI25151J46595_10016816 3300003187 Bacteria 3191
5 JGI25151J46595_10031402 3300003187 Bacteria 2075
6 rootH1_10063339 3300003316 Bacteria 2471
7 rootL2_10038944 3300003322 Bacteria 12732
8 Ga0006562J51391_1000136 3300003578 Bacteria 13430
9 Ga0006562J51391_1000145 3300003578 Bacteria 1620
10 Ga0006562J51391_1000405 3300003578 Bacteria 7090
11 Ga0055538_1000310 3300003751 Bacteria 23455
12 Ga0055532_1003768 3300003758 Bacteria 2468
13 Ga0055536_1006675 3300003781 Bacteria 5311
14 Ga0055528_1008270 3300003790 Bacteria 4489
15 Ga0070705_100065564 3300005440 Bacteria 2174
16 Ga0070700_100216574 3300005441 Bacteria 1354
17 Ga0070708_100502150 3300005445 Unclassified 1144
18 Ga0070706_100562801 3300005467 Bacteria 1060
19 Ga0070707_100079675 3300005468 Bacteria 3161
20 Ga0070707_100176089 3300005468 Bacteria 2085
21 Ga0070698_100021400 3300005471 Bacteria 6774
22 Ga0070698_100048033 3300005471 Unclassified 4362
23 Ga0070699_100002490 3300005518 Bacteria 16555
24 Ga0070699_100008201 3300005518 Bacteria 9065
25 Ga0070699_100228996 3300005518 Bacteria 1657
26 Ga0070696_100265956 3300005546 Bacteria 1302
27 Ga0070704_100021376 3300005549 Bacteria 4193
28 Ga0068857_100081794 3300005577 Unclassified 2884
29 Ga0068859_100154836 3300005617 Bacteria 2369
30 Ga0068864_100041075 3300005618 Bacteria 3956
31 Ga0068863_100123545 3300005841 Bacteria 2470
32 Ga0068858_100383354 3300005842 Unclassified 1349
33 Ga0068862_100032230 3300005844 Bacteria 4427
34 Ga0075428_100001714 3300006844 Bacteria 23418
35 Ga0075428_100271958 3300006844 Unclassified 1823
36 Ga0075430_100001001 3300006846 Bacteria 22342
37 Ga0075431_100003717 3300006847 Bacteria 14828
38 Ga0075431_100263985 3300006847 Bacteria 1747
39 Ga0075431_100319341 3300006847 Bacteria 1566
40 Ga0075434_100463600 3300006871 Bacteria 1288
41 Ga0075429_100009977 3300006880 Bacteria 8232
42 Ga0075429_100010699 3300006880 Archaea 7936
43 Ga0097620_100154831 3300006931 Bacteria 2369
44 Ga0105251_10008911 3300009011 Bacteria 6001
45 Ga0105244_10000887 3300009036 Bacteria 25375
46 Ga0105244_10052709 3300009036 Bacteria 2070
47 Ga0105250_10000681 3300009092 Bacteria 21336
48 Ga0105250_10146221 3300009092 Bacteria 982
49 Ga0105250_10156022 3300009092 Bacteria 951
50 Ga0114129_10009408 3300009147 Bacteria 13928
51 Ga0105243_10010071 3300009148 Bacteria 7188
52 Ga0105249_10038545 3300009553 Bacteria 4337
53 Ga0105246_10035905 3300011119 Bacteria 3316
54 Ga0105246_10054808 3300011119 Bacteria 2749
55 Ga0157371_10014885 3300013102 Bacteria 5855
56 Ga0157378_10022596 3300013297 Bacteria 5534
57 Ga0163163_10019256 3300014325 Bacteria 6407
58 Ga0209784_100100 3300025224 Bacteria 101657
59 Ga0209147_100118 3300025229 Bacteria 143578
60 Ga0209147_100245 3300025229 Bacteria 52865
61 Ga0209147_101621 3300025229 Bacteria 7518
62 Ga0209673_1002220 3300025273 Bacteria 14130
63 Ga0209130_1000955 3300025284 Bacteria 22866
64 Ga0209130_1002439 3300025284 Bacteria 9312
65 Ga0209130_1010110 3300025284 Bacteria 2623
66 Ga0209675_1027208 3300025291 Bacteria 1410
67 Ga0209675_1034426 3300025291 Bacteria 1165
68 Ga0209676_1000874 3300025292 Bacteria 38585
69 Ga0209025_1000001 3300025294 Bacteria 1888151
70 Ga0209025_1000101 3300025294 Bacteria 228507
71 Ga0209025_1000164 3300025294 Bacteria 165351
72 Ga0209025_1001100 3300025294 Bacteria 38938
73 Ga0209025_1004137 3300025294 Bacteria 12881
74 Ga0209025_1004177 3300025294 Bacteria 12766
75 Ga0209025_1008302 3300025294 Bacteria 7493
76 Ga0209025_1017758 3300025294 Bacteria 4084
77 Ga0209025_1018976 3300025294 Bacteria 3855
78 Ga0209025_1041299 3300025294 Bacteria 1978
79 Ga0209025_1042552 3300025294 Bacteria 1928
80 Ga0209564_1048950 3300025295 Bacteria 1051
81 Ga0207696_1000894 3300025711 Bacteria 18496
82 Ga0207696_1008502 3300025711 Bacteria 3914
83 Ga0207696_1027169 3300025711 Bacteria 1766
84 Ga0207696_1069428 3300025711 Bacteria 982
85 Ga0207655_1001658 3300025728 Bacteria 19719
86 Ga0207655_1004920 3300025728 Bacteria 9268
87 Ga0207655_1024152 3300025728 Bacteria 2987
88 Ga0207713_1008672 3300025735 Bacteria 5813
89 Ga0207713_1013146 3300025735 Bacteria 4380
90 Ga0207643_10024578 3300025908 Bacteria 3325
91 Ga0207646_10117806 3300025922 Bacteria 2385
92 Ga0207644_10009938 3300025931 Bacteria 6261
93 Ga0207709_10330079 3300025935 Bacteria 1145
94 Ga0207708_10594871 3300026075 Bacteria 936
95 Ga0207676_10064747 3300026095 Bacteria 2908
96 Ga0207674_10024822 3300026116 Bacteria 6398
97 Ga0237817_10145 3300030083 Bacteria 21299
98 Ga0237817_10222 3300030083 Bacteria 14523
99 Ga0307408_100026503 3300031548 Bacteria 3983
100 Ga0307406_10078429 3300031901 Bacteria 2188
101 Ga0307406_10523773 3300031901 Bacteria 965
102 Ga0307412_10152927 3300031911 Bacteria 1705
103 Ga0307409_100214403 3300031995 Bacteria 1733
104 Ga0307416_100041105 3300032002 Bacteria 3599
105 Ga0451791_1356231 3300041451 Bacteria 1001
106 Ga0451577_0126347 3300042876 Unclassified 2292
107 Ga0466957_0225544 3300044842 Bacteria 1239
108 Ga0451576_0160186 3300045051 Unclassified 2348
109 Ga0466967_0070418 3300045976 Bacteria 3129
110 Ga0466967_0447509 3300045976 Bacteria 1262
111 Ga0495603_0020814 3300046455 Bacteria 3971
112 Ga0495590_0085371 3300046457 Bacteria 1114
113 Ga0495585_0031529 3300046492 Bacteria 3008
114 Ga0495622_0035466 3300046557 Bacteria 2326
115 Ga0495661_0133646 3300046665 Bacteria 1357
116 Ga0495660_0031597 3300046810 Bacteria 2977
117 Ga0495676_0117643 3300047321 Bacteria 1938
118 Ga0496100_0003596 3300048903 Bacteria 8098
119 Ga0496101_0000956 3300048904 Bacteria 17074
120 Ga0496103_0360432 3300048906 Bacteria 935
121 Ga0496104_0059552 3300048907 Bacteria 3615
122 Ga0496105_0000223 3300048908 Bacteria 38096
123 Ga0496106_0000732 3300048909 Bacteria 23648
124 Ga0496107_0001470 3300048910 Bacteria 14574
125 Ga0496108_0000827 3300048911 Bacteria 24087
126 Ga0496109_0000329 3300048912 Bacteria 44242
127 Ga0496110_0004369 3300048913 Bacteria 10941
128 Ga0496111_0000428 3300048914 Bacteria 21261
129 Ga0496111_0112523 3300048914 Bacteria 2005
130 Ga0496112_0002262 3300048915 Bacteria 15390
131 Ga0496112_0154611 3300048915 Bacteria 2261
132 Ga0496112_0415494 3300048915 Bacteria 1284
133 Ga0496113_0012360 3300048916 Bacteria 5736
134 Ga0496116_0024080 3300048919 Bacteria 4511
135 Ga0496116_0024504 3300048919 Bacteria 4461
136 Ga0496117_0044402 3300048920 Bacteria 3220
137 Ga0496118_0039952 3300048921 Bacteria 3737
138 Ga0496118_0078609 3300048921 Bacteria 2333
139 Ga0496119_0001865 3300048922 Bacteria 24350
140 Ga0496120_0018479 3300048923 Bacteria 4490
141 Ga0496121_0110947 3300048924 Bacteria 2092
142 Ga0496121_0251303 3300048924 Bacteria 1226
143 Ga0496122_0014797 3300048925 Bacteria 7516
144 Ga0496122_0063942 3300048925 Bacteria 2680
145 Ga0496122_0163790 3300048925 Bacteria 1352
146 Ga0496125_0000780 3300048928 Bacteria 52165
147 Ga0496126_0011783 3300048929 Bacteria 9001
148 Ga0501341_01032 3300049131 Bacteria 1322
149 Ga0501343_002092 3300049132 Bacteria 1407
150 Ga0501343_002250 3300049132 Bacteria 1369
151 Ga0501305_008086 3300049161 Bacteria 1352
152 Ga0501305_008109 3300049161 Bacteria 1351
153 Ga0501311_031806 3300049527 Bacteria 767
154 Ga0501312_006833 3300049528 Bacteria 1439
155 Ga0501312_009983 3300049528 Bacteria 1262
156 Ga0501312_012542 3300049528 Bacteria 1167
157 Ga0501312_012848 3300049528 Bacteria 1157
158 Ga0501315_004367 3300049531 Bacteria 1475
159 Ga0501315_008552 3300049531 Bacteria 1193
160 Ga0501316_005105 3300049532 Bacteria 1349
161 Ga0501316_007099 3300049532 Bacteria 1208
162 Ga0501317_006106 3300049533 Bacteria 1311
163 Ga0501321_004271 3300049537 Bacteria 1359
164 Ga0501327_01194 3300049543 Bacteria 1211
165 Ga0501330_000927 3300049546 Bacteria 1422
166 Ga0501330_001445 3300049546 Bacteria 1229
167 Ga0501331_00836 3300049547 Bacteria 1373
168 Ga0501334_01449 3300049550 Bacteria 1312
169 Ga0501335_002069 3300049551 Bacteria 1601
170 Ga0501336_001830 3300049552 Bacteria 1317
171 Ga0501338_09225 3300049554 Bacteria 655
172 Ga0501069_0061603 3300049585 Bacteria 2095
173 Ga0501070_0330296 3300049586 Bacteria 1239
174 Ga0501077_0023460 3300049593 Bacteria 3913
175 Ga0501202_026910 3300049652 Bacteria 1180
176 Ga0501233_071482 3300049668 Bacteria 880
177 Ga0501079_0796550 3300049741 Unclassified 744
178 nmdc:mga05p37_216308_c1 3300050507 Bacteria 1518
179 nmdc:mga05p37_41339_c1 3300050507 Bacteria 5660
180 nmdc:mga09592_123215_c1 3300050508 Bacteria 2227
181 nmdc:mga09592_15790_c1 3300050508 Bacteria 6170
182 nmdc:mga09592_3318_c1 3300050508 Bacteria 13028
183 nmdc:mga0qj67_5867_c1 3300050509 Bacteria 8994
184 nmdc:mga06r32_1160509_c1 3300050510 Bacteria 720
185 nmdc:mga06r32_244686_c1 3300050510 Bacteria 1781
186 nmdc:mga06r32_269720_c1 3300050510 Bacteria 1689
187 nmdc:mga06r32_859_c1 3300050510 Bacteria 26990
188 nmdc:mga0n895_591612_c1 3300050512 Bacteria 1112
189 nmdc:mga0n895_82494_c1 3300050512 Bacteria 3205
190 2936365501 2936361878 Bacteria 5632809
191 2511699678 2511231119 Bacteria 4019861
192 2540606918 2540341094 Bacteria 4061186
193 2545555868 2545555800 Bacteria 4222588
194 2550901928 2548877040 Bacteria 7507281
195 2555470278 2554235283 Bacteria 3683090
196 2571531015 2571042143 Bacteria 6986194
197 2573039689 2571042588 Bacteria 5045676
198 2578337879 2576861424 Bacteria 5270569
199 2578929289 2576861599 Bacteria 4217202
200 2580930308 2579778775 Bacteria 5360914
201 2587737443 2585428059 Bacteria 8696589
202 2595088656 2593339131 Bacteria 5116855
203 2601638941 2600255286 Bacteria 5390125
204 2621276206 2619619294 Bacteria 5575484
205 2631983079 2630968484 Bacteria 3876276
206 2644704228 2643221729 Bacteria 6621700
207 2644705497 2643221729 Bacteria 6621700
208 2644708922 2643221730 Bacteria 6523787
209 2644710192 2643221730 Bacteria 6523787
210 2644716235 2643221731 Bacteria 5623886
211 2644723895 2643221732 Bacteria 5756404
212 2644740092 2643221735 Bacteria 3676263
213 2651533100 2648501850 Bacteria 3975476
214 2672335442 2671180330 Bacteria 5521719
215 2674419471 2671180844 Bacteria 4164150
216 2685149653 2684622632 Bacteria 5380049
217 2685151627 2684622632 Bacteria 5380049
218 2686996961 2684623153 Bacteria 3878815
219 2687498266 2687453109 Bacteria 3860091
220 2695627640 2695420354 Bacteria 3922431
221 2698321594 2695420987 Bacteria 6152737
222 2705995518 2703719227 Bacteria 5631989
223 2717916565 2716884898 Bacteria 3928789
224 2721506787 2718218445 Bacteria 5113413
225 2723604750 2721755693 Bacteria 6126117
226 2728534639 2728368933 Bacteria 7044283
227 2730135388 2728369359 Bacteria 5621728
228 2738814863 2738541295 Bacteria 5730091
229 2738841024 2738541299 Bacteria 4020721
230 2738841200 2738541299 Bacteria 4020721
231 2739155220 2738541358 Bacteria 5932299
232 2739158594 2738541358 Bacteria 5932299
233 2739207459 2738543006 Bacteria 5904091
234 2739211076 2738543006 Bacteria 5904091
235 2739231148 2738543010 Bacteria 5583595
236 2739268272 2738543017 Bacteria 4271950
237 2745169441 2744054657 Bacteria 5016802
238 2753809808 2751185905 Bacteria 6142767
239 2757565311 2757320391 Bacteria 4746095
240 2777763778 2775507177 Bacteria 4384303
241 2802437006 2802428803 Bacteria 5806948
242 2808868673 2808606364 Bacteria 4465927
243 2809056936 2808606399 Bacteria 4021018
244 2812316155 2811994870 Bacteria 3776934
245 2816864302 2816332186 Bacteria 5331395
246 2817480110 2816332295 Bacteria 4352468
247 2817619080 2816332336 Bacteria 5207640
248 2819568232 2818991441 Bacteria 5062707
249 2819579198 2818991443 Bacteria 6598732
250 2819580797 2818991443 Bacteria 6598732
251 2819625330 2818991451 Bacteria 4697364
252 2819709704 2818991465 Bacteria 5388835
253 2819724891 2818991468 Bacteria 3723169
254 2823528115 2823526263 Bacteria 3765752
255 2831906813 2831905167 Bacteria 3319172
256 2842687311 2842682962 Bacteria 5589973
257 2842884036 2842882022 Bacteria 6158489
258 2849141058 2849139964 Bacteria 5613304
259 2849143632 2849139964 Bacteria 5613304
260 2852675455 2852673933 Bacteria 3347676
261 2857582140 2857581216 Bacteria 5522813
262 2857588342 2857586860 Bacteria 4354574
263 2857608368 2857604169 Bacteria 5111450
264 2857611409 2857609550 Bacteria 3753890
265 2860839377 2860837431 Bacteria 4202080
266 2877770479 2877768649 Bacteria 3957164
267 2880171467 2880169592 Bacteria 3900066
268 2881640798 2881636855 Bacteria 5205297
269 2881645707 2881644220 Bacteria 5302661
270 2889280660 2889276214 Bacteria 5979355
271 2897111497 2897109615 Bacteria 4009619
272 2898907952 2898907183 Bacteria 4067722
273 2904524934 2904524088 Bacteria 5887454
274 2904561202 2904560550 Bacteria 4029838
275 2904595409 2904595352 Bacteria 6124848
276 2904607303 2904606771 Bacteria 4684500
277 2908665612 2908665501 Bacteria 3678115
278 2915601837 2915597211 Bacteria 6475886
279 2919094282 2919093281 Bacteria 3660974
280 2919146477 2919143609 Bacteria 6219228
281 2919414424 2919414237 Bacteria 5429133
282 2919518393 2919517244 Bacteria 5858162
283 2919722755 2919720352 Bacteria 5986006
284 2919730572 2919726948 Bacteria 3696050
285 2928096684 2928093941 Bacteria 5965005
286 2928512579 2928510474 Bacteria 4815308
287 2929005911 2929004312 Bacteria 5678476
288 2929186973 2929183550 Bacteria 6377511
289 2929234927 2929233124 Bacteria 5948380
290 2929237315 2929233124 Bacteria 5948380
291 2936343297 2936340661 Bacteria 5139038
292 2938652795 2938649242 Bacteria 7118381
293 2938917299 2938917290 Bacteria 5914775
294 2938919100 2938917290 Bacteria 5914775
295 2938921499 2938917290 Bacteria 5914775
296 2939594641 2939593269 Bacteria 4798695
297 2939679956 2939679117 Bacteria 6921672
298 2939706421 2939702853 Bacteria 5139229
299 2947430366 2947426588 Bacteria 5357194
300 2954774378 2954773129 Bacteria 3741715
301 2956899811 2956897341 Bacteria 5447711
302 2960320380 2960319331 Bacteria 5502575
303 2960379645 2960375949 Bacteria 5361395
304 2962292823 2962290636 Bacteria 4072939
305 2965762962 2965761152 Bacteria 5806513
306 2965764905 2965761152 Bacteria 5806513
307 2968560326 2968558590 Bacteria 6956864
308 2969138766 2969136845 Bacteria 3923176
309 2969142934 2969141011 Bacteria 4118468
310 2969766815 2969765954 Bacteria 4216713
311 2969772562 2969770375 Bacteria 4271280
312 2971512480 2971511577 Bacteria 5404012
313 2971895247 2971893375 Bacteria 3929648
314 2977258213 2977254563 Bacteria 4828420
315 2979085392 2979083700 Bacteria 5894929
316 2979087245 2979083700 Bacteria 5894929
317 2980128487 2980125574 Bacteria 5567337
318 2980128784 2980125574 Bacteria 5567337
319 2980178131 2980176882 Bacteria 5397533
320 2980494568 2980492589 Bacteria 4072961
321 2981285065 2981284811 Bacteria 4641497
322 2981290010 2981289755 Bacteria 4641509
323 2981981355 2981980479 Bacteria 4641628
324 2981986248 2981985349 Bacteria 4641497
325 2988230606 2988225383 Bacteria 7221625
326 2990279226 2990275345 Bacteria 4887158
327 2996635581 2996632988 Bacteria 6921523
328 2996711173 2996706504 Bacteria 5757485
329 3001267727 3001267043 Bacteria 4823521
330 3001273202 3001272096 Bacteria 4729684
331 3001893355 3001892409 Bacteria 6328293
332 3006830194 3006826541 Bacteria 4678913
333 3006860455 3006858327 Bacteria 4317835
334 3006881077 3006879489 Bacteria 4064221
335 3006970438 3006969106 Bacteria 4739423
336 3006974944 3006973921 Bacteria 4423788
337 3006979347 3006978542 Bacteria 5328100
338 3006985216 3006984091 Bacteria 4207523
339 3006989505 3006988479 Bacteria 4767936
340 648170789 648028048 Bacteria 5394884
341 8022622915 8022621104 Bacteria 5241040
342 8022631091 8022630665 Bacteria 3886130
343 8022656527 8022653035 Bacteria 4035078
344 8022798482 8022792930 Bacteria 5693794
345 8022895331 8022893055 Bacteria 5300455
346 8022916886 8022914991 Bacteria 5584517
347 8022949266 8022948649 Bacteria 5366783
348 8023440405 8023438354 Bacteria 5779374
349 8023442213 8023438354 Bacteria 5779374
350 8023447311 8023444577 Bacteria 5661597
351 8023448190 8023444577 Bacteria 5661597
352 8051952569 8051952484 Bacteria 3926774
353 8052174877 8052174270 Bacteria 3881265
354 8054281780 8054280661 Bacteria 4232245
355 8054469782 8054465665 Bacteria 7323556
356 8055533840 8055531788 Bacteria 5249694
357 8057586080 8057582654 Bacteria 5218944
358 8057634300 8057632132 Bacteria 4726859
359 JGI25159J45721_1008243
360 JGI25151J46595_10000012
361 JGI25151J46595_10008156
362 JGI25151J46595_10016816
363 JGI25151J46595_10031402
364 rootH1_10063339
365 rootL2_10038944
366 Ga0006562J51391_1000136
367 Ga0006562J51391_1000145
368 Ga0006562J51391_1000405
369 Ga0055538_1000310
370 Ga0055532_1003768
371 Ga0055536_1006675
372 Ga0055528_1008270
373 Ga0070705_100065564
374 Ga0070700_100216574
375 Ga0070708_100502150
376 Ga0070706_100562801
377 Ga0070707_100079675
378 Ga0070707_100176089
379 Ga0070698_100021400
380 Ga0070698_100048033
381 Ga0070699_100002490
382 Ga0070699_100008201
383 Ga0070699_100228996
384 Ga0070696_100265956
385 Ga0070704_100021376
386 Ga0068857_100081794
387 Ga0068859_100154836
388 Ga0068864_100041075
389 Ga0068863_100123545
390 Ga0068858_100383354
391 Ga0068862_100032230
392 Ga0075428_100001714
393 Ga0075428_100271958
394 Ga0075430_100001001
395 Ga0075431_100003717
396 Ga0075431_100263985
397 Ga0075431_100319341
398 Ga0075434_100463600
399 Ga0075429_100009977
400 Ga0075429_100010699
401 Ga0097620_100154831
402 Ga0105251_10008911
403 Ga0105244_10000887
404 Ga0105244_10052709
405 Ga0105250_10000681
406 Ga0105250_10146221
407 Ga0105250_10156022
408 Ga0114129_10009408
409 Ga0105243_10010071
410 Ga0105249_10038545
411 Ga0105246_10035905
412 Ga0105246_10054808
413 Ga0157371_10014885
414 Ga0157378_10022596
415 Ga0163163_10019256
416 Ga0209784_100100
417 Ga0209147_100118
418 Ga0209147_100245
419 Ga0209147_101621
420 Ga0209673_1002220
421 Ga0209130_1000955
422 Ga0209130_1002439
423 Ga0209130_1010110
424 Ga0209675_1027208
425 Ga0209675_1034426
426 Ga0209676_1000874
427 Ga0209025_1000001
428 Ga0209025_1000101
429 Ga0209025_1000164
430 Ga0209025_1001100
431 Ga0209025_1004137
432 Ga0209025_1004177
433 Ga0209025_1008302
434 Ga0209025_1017758
435 Ga0209025_1018976
436 Ga0209025_1041299
437 Ga0209025_1042552
438 Ga0209564_1048950
439 Ga0207696_1000894
440 Ga0207696_1008502
441 Ga0207696_1027169
442 Ga0207696_1069428
443 Ga0207655_1001658
444 Ga0207655_1004920
445 Ga0207655_1024152
446 Ga0207713_1008672
447 Ga0207713_1013146
448 Ga0207643_10024578
449 Ga0207646_10117806
450 Ga0207644_10009938
451 Ga0207709_10330079
452 Ga0207708_10594871
453 Ga0207676_10064747
454 Ga0207674_10024822
455 Ga0237817_10145
456 Ga0237817_10222
457 Ga0307408_100026503
458 Ga0307406_10078429
459 Ga0307406_10523773
460 Ga0307412_10152927
461 Ga0307409_100214403
462 Ga0307416_100041105
463 Ga0451791_1356231
464 Ga0451577_0126347
465 Ga0466957_0225544
466 Ga0451576_0160186
467 Ga0466967_0070418
468 Ga0466967_0447509
469 Ga0495603_0020814
470 Ga0495590_0085371
471 Ga0495585_0031529
472 Ga0495622_0035466
473 Ga0495661_0133646
474 Ga0495660_0031597
475 Ga0495676_0117643
476 Ga0496100_0003596
477 Ga0496101_0000956
478 Ga0496103_0360432
479 Ga0496104_0059552
480 Ga0496105_0000223
481 Ga0496106_0000732
482 Ga0496107_0001470
483 Ga0496108_0000827
484 Ga0496109_0000329
485 Ga0496110_0004369
486 Ga0496111_0000428
487 Ga0496111_0112523
488 Ga0496112_0002262
489 Ga0496112_0154611
490 Ga0496112_0415494
491 Ga0496113_0012360
492 Ga0496116_0024080
493 Ga0496116_0024504
494 Ga0496117_0044402
495 Ga0496118_0039952
496 Ga0496118_0078609
497 Ga0496119_0001865
498 Ga0496120_0018479
499 Ga0496121_0110947
500 Ga0496121_0251303
501 Ga0496122_0014797
502 Ga0496122_0063942
503 Ga0496122_0163790
504 Ga0496125_0000780
505 Ga0496126_0011783
506 Ga0501341_01032
507 Ga0501343_002092
508 Ga0501343_002250
509 Ga0501305_008086
510 Ga0501305_008109
511 Ga0501311_031806
512 Ga0501312_006833
513 Ga0501312_009983
514 Ga0501312_012542
515 Ga0501312_012848
516 Ga0501315_004367
517 Ga0501315_008552
518 Ga0501316_005105
519 Ga0501316_007099
520 Ga0501317_006106
521 Ga0501321_004271
522 Ga0501327_01194
523 Ga0501330_000927
524 Ga0501330_001445
525 Ga0501331_00836
526 Ga0501334_01449
527 Ga0501335_002069
528 Ga0501336_001830
529 Ga0501338_09225
530 Ga0501069_0061603
531 Ga0501070_0330296
532 Ga0501077_0023460
533 Ga0501202_026910
534 Ga0501233_071482
535 Ga0501079_0796550
536 nmdc:mga05p37_216308_c1
537 nmdc:mga05p37_41339_c1
538 nmdc:mga09592_123215_c1
539 nmdc:mga09592_15790_c1
540 nmdc:mga09592_3318_c1
541 nmdc:mga0qj67_5867_c1
542 nmdc:mga06r32_1160509_c1
543 nmdc:mga06r32_244686_c1
544 nmdc:mga06r32_269720_c1
545 nmdc:mga06r32_859_c1
546 nmdc:mga0n895_591612_c1
547 nmdc:mga0n895_82494_c1
548 2936365501
549 2511699678
550 2540606918
551 2545555868
552 2550901928
553 2555470278
554 2571531015
555 2573039689
556 2578337879
557 2578929289
558 2580930308
559 2587737443
560 2595088656
561 2601638941
562 2621276206
563 2631983079
564 2644704228
565 2644705497
566 2644708922
567 2644710192
568 2644716235
569 2644723895
570 2644740092
571 2651533100
572 2672335442
573 2674419471
574 2685149653
575 2685151627
576 2686996961
577 2687498266
578 2695627640
579 2698321594
580 2705995518
581 2717916565
582 2721506787
583 2723604750
584 2728534639
585 2730135388
586 2738814863
587 2738841024
588 2738841200
589 2739155220
590 2739158594
591 2739207459
592 2739211076
593 2739231148
594 2739268272
595 2745169441
596 2753809808
597 2757565311
598 2777763778
599 2802437006
600 2808868673
601 2809056936
602 2812316155
603 2816864302
604 2817480110
605 2817619080
606 2819568232
607 2819579198
608 2819580797
609 2819625330
610 2819709704
611 2819724891
612 2823528115
613 2831906813
614 2842687311
615 2842884036
616 2849141058
617 2849143632
618 2852675455
619 2857582140
620 2857588342
621 2857608368
622 2857611409
623 2860839377
624 2877770479
625 2880171467
626 2881640798
627 2881645707
628 2889280660
629 2897111497
630 2898907952
631 2904524934
632 2904561202
633 2904595409
634 2904607303
635 2908665612
636 2915601837
637 2919094282
638 2919146477
639 2919414424
640 2919518393
641 2919722755
642 2919730572
643 2928096684
644 2928512579
645 2929005911
646 2929186973
647 2929234927
648 2929237315
649 2936343297
650 2938652795
651 2938917299
652 2938919100
653 2938921499
654 2939594641
655 2939679956
656 2939706421
657 2947430366
658 2954774378
659 2956899811
660 2960320380
661 2960379645
662 2962292823
663 2965762962
664 2965764905
665 2968560326
666 2969138766
667 2969142934
668 2969766815
669 2969772562
670 2971512480
671 2971895247
672 2977258213
673 2979085392
674 2979087245
675 2980128487
676 2980128784
677 2980178131
678 2980494568
679 2981285065
680 2981290010
681 2981981355
682 2981986248
683 2988230606
684 2990279226
685 2996635581
686 2996711173
687 3001267727
688 3001273202
689 3001893355
690 3006830194
691 3006860455
692 3006881077
693 3006970438
694 3006974944
695 3006979347
696 3006985216
697 3006989505
698 648170789
699 8022622915
700 8022631091
701 8022656527
702 8022798482
703 8022895331
704 8022916886
705 8022949266
706 8023440405
707 8023442213
708 8023447311
709 8023448190
710 8051952569
711 8052174877
712 8054281780
713 8054469782
714 8055533840
715 8057586080
716 8057634300

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02683

DsbD

Cytochrome C biogenesis protein transmembrane region

52

258

0.97

PF13386

DsbD_2

Cytochrome C biogenesis protein transmembrane region

76

255

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.4292 9 217
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.4221 9 217
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.4041 2 227
6ob6-assembly2.cif.gz_B human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.3941 2 216
4ja4-assembly3.cif.gz_C inward open conformation of the xylose transporter xyle from e. coli 0.39 2 219
ID Description Score Start End Superfamily
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5483 11 216 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5414 11 216 1.20.1250.20
af_Q7K2N3_269_463_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4565 4 215 1.20.1250.20
af_Q59XM0_407_678_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4564 2 216 1.20.1250.20
af_P0C0L7_256_445_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4546 1 219 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A0Q9QGF4-F1-model_v4 Cytochrome C biogenesis protein 0.8681 1 235 GO:0016020
GO:0017004
AF-A0A0Q9QGF4-F1-model_v4 Cytochrome C biogenesis protein 0.8647 1 235 GO:0016020
GO:0017004
AF-A0A839TL70-F1-model_v4 Cytochrome c-type biogenesis protein 0.8604 1 235 GO:0016020
GO:0017004
AF-A0A132N007-F1-model_v4 Cytochrome C biogenesis protein (Cytochrome c-type biogenesis protein CcdA) 0.8599 2 230 GO:0016020
GO:0017004
AF-A0A3A3GKR7-F1-model_v4 Cytochrome c biogenesis protein CcdA 0.8589 1 228 GO:0016020
GO:0017004

Map