F421271

General Info

Members Datasets Scaffolds Average Seq Length
358 163 716 204

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0027707|Ga0466967_0027707_3275_3916
Length 213
Sequence MSGSLAGSPRTPYRIETERLVLRCYDPDDAPLLKDAVDRSLDHLRQWMPWTPDEPEPIDAVYERLRDFRALYDRDENWIMGVFSPDDSRCLGGTGLHPRQGEGGLEIGYWIAADEVGRGYATELSAVLTRVGFDCFGADRIEIRVDPANEVSERVPAKLGFTKEATLRRRLPEKQGSELRDVNIWTLFRDEVAGSPVEAYGYRAYDALGRAVP

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
68 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
69 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
70 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
71 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
72 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
82 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
83 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
84 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
106 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
122 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 11.17
Rhizosphere 87.99
Stem 0
Stem Tuber 0
Unclassified 2.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0027707 3300045976 Bacteria 4717
2 Ga0070658_10012381 3300005327 Bacteria 6847
3 Ga0070658_10035124 3300005327 Bacteria 4036
4 Ga0070680_100007180 3300005336 Bacteria 8491
5 Ga0070680_100230068 3300005336 Bacteria 1566
6 Ga0070682_100026952 3300005337 Bacteria 3444
7 Ga0070660_100024580 3300005339 Bacteria 4469
8 Ga0070660_100118816 3300005339 Bacteria 2108
9 Ga0070660_100562873 3300005339 Bacteria 951
10 Ga0070661_100167247 3300005344 Bacteria 1668
11 Ga0070661_100228215 3300005344 Bacteria 1430
12 Ga0070659_100049217 3300005366 Bacteria 3313
13 Ga0070659_100076035 3300005366 Bacteria 2678
14 Ga0070709_10333604 3300005434 Bacteria 1116
15 Ga0070714_100052153 3300005435 Bacteria 3488
16 Ga0070714_100100449 3300005435 Bacteria 2548
17 Ga0070714_100249506 3300005435 Bacteria 1640
18 Ga0070714_100363716 3300005435 Bacteria 1361
19 Ga0070714_100386213 3300005435 Bacteria 1321
20 Ga0070714_100487780 3300005435 Bacteria 1174
21 Ga0070713_100019797 3300005436 Bacteria 5150
22 Ga0070678_100055599 3300005456 Bacteria 2890
23 Ga0070681_10005445 3300005458 Bacteria 12298
24 Ga0070681_10015929 3300005458 Bacteria 7496
25 Ga0070681_10033960 3300005458 Bacteria 5121
26 Ga0070681_10082262 3300005458 Bacteria 3175
27 Ga0070681_10113908 3300005458 Bacteria 2643
28 Ga0070707_100004403 3300005468 Bacteria 13200
29 Ga0070698_100387164 3300005471 Bacteria 1331
30 Ga0070679_100004975 3300005530 Bacteria 12267
31 Ga0070679_100045238 3300005530 Bacteria 4387
32 Ga0070679_100319873 3300005530 Bacteria 1501
33 Ga0070679_100847575 3300005530 Bacteria 857
34 Ga0070695_100000051 3300005545 Bacteria 46328
35 Ga0070696_100010904 3300005546 Bacteria 6092
36 Ga0070665_100090552 3300005548 Bacteria 3065
37 Ga0068855_100099142 3300005563 Bacteria 3356
38 Ga0068855_100146103 3300005563 Bacteria 2692
39 Ga0070664_100345423 3300005564 Bacteria 1352
40 Ga0068857_100029244 3300005577 Bacteria 4863
41 Ga0068857_100140649 3300005577 Bacteria 2181
42 Ga0068856_100229577 3300005614 Bacteria 1871
43 Ga0068856_100389460 3300005614 Bacteria 1413
44 Ga0068852_100083696 3300005616 Bacteria 2837
45 Ga0068852_100629703 3300005616 Bacteria 1079
46 Ga0068852_100894036 3300005616 Bacteria 905
47 Ga0070717_10006751 3300006028 Bacteria 8466
48 Ga0070717_10009595 3300006028 Bacteria 7281
49 Ga0105240_10109230 3300009093 Bacteria 3350
50 Ga0105240_10263089 3300009093 Bacteria 1989
51 Ga0105240_10911144 3300009093 Unclassified 945
52 Ga0105245_10123972 3300009098 Bacteria 2416
53 Ga0105245_10373645 3300009098 Bacteria 1418
54 Ga0105243_10741300 3300009148 Bacteria 962
55 Ga0105248_10107441 3300009177 Bacteria 3147
56 Ga0105248_10333725 3300009177 Bacteria 1708
57 Ga0105248_11194805 3300009177 Bacteria 860
58 Ga0105238_10347118 3300009551 Bacteria 1473
59 Ga0105238_10652264 3300009551 Bacteria 1063
60 Ga0105239_10283194 3300010375 Bacteria 1866
61 Ga0157373_10079554 3300013100 Bacteria 2312
62 Ga0157371_10136180 3300013102 Bacteria 1749
63 Ga0157371_10858612 3300013102 Bacteria 686
64 Ga0157370_10275383 3300013104 Bacteria 1555
65 Ga0157370_10481219 3300013104 Bacteria 1141
66 Ga0157369_10071129 3300013105 Bacteria 3736
67 Ga0157369_10209001 3300013105 Bacteria 2046
68 Ga0157369_10248908 3300013105 Bacteria 1855
69 Ga0157374_10131182 3300013296 Bacteria 2425
70 Ga0157374_10555199 3300013296 Bacteria 1156
71 Ga0157378_10483394 3300013297 Bacteria 1234
72 Ga0157372_10116257 3300013307 Bacteria 3067
73 Ga0157372_10162216 3300013307 Bacteria 2584
74 Ga0157372_10194591 3300013307 Bacteria 2349
75 Ga0157372_10317159 3300013307 Bacteria 1815
76 Ga0157372_10488242 3300013307 Bacteria 1436
77 Ga0157375_10330842 3300013308 Bacteria 1688
78 Ga0163163_10161789 3300014325 Bacteria 2284
79 Ga0157376_10144226 3300014969 Bacteria 2140
80 Ga0206356_11860155 3300020070 Bacteria 774
81 Ga0206353_10974204 3300020082 Bacteria 2061
82 Ga0207707_10001299 3300025912 Bacteria 23250
83 Ga0207707_10005034 3300025912 Bacteria 11604
84 Ga0207707_10103597 3300025912 Bacteria 2487
85 Ga0207707_10279152 3300025912 Bacteria 1447
86 Ga0207707_10430426 3300025912 Unclassified 1130
87 Ga0207695_10661081 3300025913 Unclassified 926
88 Ga0207660_10019855 3300025917 Bacteria 4500
89 Ga0207660_10049265 3300025917 Bacteria 2985
90 Ga0207660_10304346 3300025917 Bacteria 1270
91 Ga0207657_10003902 3300025919 Bacteria 15819
92 Ga0207657_10006468 3300025919 Bacteria 12142
93 Ga0207657_10010548 3300025919 Bacteria 9213
94 Ga0207657_10447792 3300025919 Bacteria 1013
95 Ga0207657_10669065 3300025919 Bacteria 808
96 Ga0207652_10056726 3300025921 Bacteria 3372
97 Ga0207652_10130013 3300025921 Bacteria 2245
98 Ga0207652_10156236 3300025921 Bacteria 2044
99 Ga0207652_10211880 3300025921 Bacteria 1745
100 Ga0207652_10707125 3300025921 Bacteria 899
101 Ga0207646_10004001 3300025922 Bacteria 16316
102 Ga0207687_10058241 3300025927 Bacteria 2717
103 Ga0207687_10635797 3300025927 Bacteria 902
104 Ga0207700_10022274 3300025928 Bacteria 4344
105 Ga0207664_10016431 3300025929 Bacteria 5399
106 Ga0207664_10040267 3300025929 Bacteria 3633
107 Ga0207664_10055914 3300025929 Bacteria 3132
108 Ga0207664_10352520 3300025929 Bacteria 1303
109 Ga0207664_10432032 3300025929 Bacteria 1174
110 Ga0207690_10022838 3300025932 Bacteria 3896
111 Ga0207690_10392521 3300025932 Bacteria 1105
112 Ga0207661_10783080 3300025944 Bacteria 878
113 Ga0207661_11180826 3300025944 Bacteria 704
114 Ga0207679_10205363 3300025945 Unclassified 1648
115 Ga0207667_10119804 3300025949 Bacteria 2712
116 Ga0207667_10555223 3300025949 Bacteria 1161
117 Ga0207677_10913083 3300026023 Unclassified 792
118 Ga0207639_10575903 3300026041 Bacteria 1036
119 Ga0207639_10634029 3300026041 Bacteria 988
120 Ga0207639_10918004 3300026041 Bacteria 819
121 Ga0207678_10406811 3300026067 Bacteria 1179
122 Ga0207702_10649863 3300026078 Bacteria 1037
123 Ga0207702_10828815 3300026078 Bacteria 915
124 Ga0207674_10014902 3300026116 Bacteria 8572
125 Ga0207674_10103071 3300026116 Bacteria 2833
126 Ga0207674_10355808 3300026116 Bacteria 1416
127 Ga0207698_10020421 3300026142 Bacteria 4559
128 Ga0268266_10122530 3300028379 Bacteria 2315
129 Ga0307405_10050452 3300031731 Bacteria 2577
130 Ga0307412_10041262 3300031911 Bacteria 2990
131 Ga0307416_100065560 3300032002 Bacteria 2985
132 Ga0307415_100221165 3300032126 Bacteria 1518
133 Ga0373936_0007310 3300035113 Bacteria 4156
134 Ga0373945_0002317 3300035116 Bacteria 5962
135 Ga0373945_0047586 3300035116 Bacteria 1569
136 Ga0373954_0136936 3300035118 Bacteria 1194
137 Ga0373943_0006312 3300035170 Bacteria 5320
138 Ga0373943_0033280 3300035170 Bacteria 2454
139 Ga0373946_0022388 3300035171 Bacteria 2459
140 Ga0373935_0048329 3300035692 Bacteria 2694
141 Ga0373927_0055659 3300035695 Bacteria 2558
142 Ga0373927_0187037 3300035695 Bacteria 1359
143 Ga0373947_0006189 3300035725 Bacteria 6961
144 Ga0373937_0001083 3300036401 Bacteria 22964
145 Ga0373925_0019924 3300037068 Bacteria 4880
146 Ga0373925_0119528 3300037068 Bacteria 2044
147 Ga0395899_0200092 3300037312 Bacteria 1394
148 Ga0395898_0014700 3300037466 Bacteria 8037
149 Ga0395898_0193778 3300037466 Bacteria 1942
150 Ga0395905_0335035 3300037471 Bacteria 1404
151 Ga0395901_0336542 3300038443 Bacteria 1560
152 Ga0436363_1436058 3300039450 Bacteria 1088
153 Ga0451804_0282728 3300041463 Bacteria 868
154 Ga0451853_1281464 3300041512 Bacteria 676
155 Ga0439448_0069790 3300042005 Bacteria 1170
156 Ga0466965_0032617 3300044683 Bacteria 2543
157 Ga0466965_0171365 3300044683 Bacteria 1142
158 Ga0466966_0005953 3300044684 Bacteria 8046
159 Ga0466966_0036393 3300044684 Bacteria 3177
160 Ga0466966_0081492 3300044684 Bacteria 2015
161 Ga0466961_0001970 3300044693 Bacteria 12775
162 Ga0466961_0051663 3300044693 Bacteria 2624
163 Ga0466961_0068836 3300044693 Bacteria 2247
164 Ga0466963_0000973 3300044694 Bacteria 14724
165 Ga0466963_0003108 3300044694 Bacteria 9413
166 Ga0466963_0006197 3300044694 Bacteria 7064
167 Ga0466963_0013284 3300044694 Bacteria 5054
168 Ga0466963_0016802 3300044694 Bacteria 4555
169 Ga0466963_0023105 3300044694 Bacteria 3943
170 Ga0466963_0301604 3300044694 Bacteria 1127
171 Ga0466963_0376525 3300044694 Bacteria 1000
172 Ga0466964_0021492 3300044706 Bacteria 2496
173 Ga0466964_0027803 3300044706 Bacteria 2223
174 Ga0466964_0037851 3300044706 Bacteria 1938
175 Ga0466971_0001635 3300044719 Bacteria 9455
176 Ga0466971_0001715 3300044719 Bacteria 9285
177 Ga0466971_0070938 3300044719 Bacteria 1582
178 Ga0466971_0078352 3300044719 Bacteria 1505
179 Ga0466968_0021179 3300044735 Bacteria 2631
180 Ga0466968_0025735 3300044735 Bacteria 2412
181 Ga0466968_0153559 3300044735 Bacteria 1059
182 Ga0466970_0170318 3300044765 Bacteria 1207
183 Ga0466970_0238204 3300044765 Bacteria 1018
184 Ga0466957_0001396 3300044842 Bacteria 12596
185 Ga0466957_0004732 3300044842 Bacteria 7622
186 Ga0466957_0005964 3300044842 Bacteria 6871
187 Ga0466957_0006816 3300044842 Bacteria 6452
188 Ga0466957_0033867 3300044842 Bacteria 3065
189 Ga0466960_0100515 3300044901 Bacteria 1489
190 Ga0466959_0001891 3300045049 Bacteria 13177
191 Ga0466959_0022066 3300045049 Bacteria 4702
192 Ga0466959_0034314 3300045049 Bacteria 3752
193 Ga0466959_0038031 3300045049 Bacteria 3556
194 Ga0466958_0001022 3300045836 Bacteria 12735
195 Ga0466958_0007538 3300045836 Bacteria 5990
196 Ga0466958_0010402 3300045836 Bacteria 5209
197 Ga0466958_0108914 3300045836 Bacteria 1728
198 Ga0466958_0582882 3300045836 Bacteria 727
199 Ga0466967_0000515 3300045976 Bacteria 18885
200 Ga0466967_0005935 3300045976 Bacteria 8567
201 Ga0466967_0019639 3300045976 Bacteria 5439
202 Ga0466967_0047591 3300045976 Bacteria 3739
203 Ga0466967_0050266 3300045976 Bacteria 3650
204 Ga0466967_0094023 3300045976 Bacteria 2729
205 Ga0466967_0122106 3300045976 Bacteria 2408
206 Ga0466967_0141991 3300045976 Bacteria 2237
207 Ga0466967_0191154 3300045976 Bacteria 1935
208 Ga0466967_0304582 3300045976 Bacteria 1534
209 Ga0466967_0379514 3300045976 Bacteria 1372
210 Ga0466967_0501579 3300045976 Bacteria 1191
211 Ga0466967_0529540 3300045976 Archaea 1158
212 Ga0466967_1294798 3300045976 Bacteria 726
213 Ga0466967_1411868 3300045976 Archaea 693
214 Ga0495592_0000506 3300046454 Bacteria 28374
215 Ga0495592_0066189 3300046454 Bacteria 2644
216 Ga0495592_0110077 3300046454 Bacteria 1950
217 Ga0495592_0289666 3300046454 Bacteria 1068
218 Ga0495629_0018937 3300046459 Bacteria 4923
219 Ga0495629_0104513 3300046459 Bacteria 1975
220 Ga0495641_0016873 3300046461 Bacteria 3828
221 Ga0495641_0048226 3300046461 Bacteria 1953
222 Ga0495641_0083597 3300046461 Bacteria 1430
223 Ga0495651_0000053 3300046462 Bacteria 85191
224 Ga0495651_0149463 3300046462 Bacteria 1686
225 Ga0495651_0205276 3300046462 Bacteria 1376
226 Ga0495651_0421911 3300046462 Bacteria 867
227 Ga0495653_0003595 3300046463 Bacteria 12501
228 Ga0495653_0070623 3300046463 Bacteria 2613
229 Ga0495653_0107411 3300046463 Bacteria 2011
230 Ga0495582_0006800 3300046473 Bacteria 6363
231 Ga0495582_0012992 3300046473 Bacteria 4587
232 Ga0495582_0155146 3300046473 Bacteria 1301
233 Ga0495639_0025359 3300046475 Bacteria 2614
234 Ga0495662_0105055 3300046476 Bacteria 1382
235 Ga0495664_0018315 3300046477 Bacteria 4010
236 Ga0495608_0002717 3300046511 Bacteria 12713
237 Ga0495618_0040821 3300046514 Bacteria 2921
238 Ga0495618_0041130 3300046514 Bacteria 2910
239 Ga0495618_0095832 3300046514 Bacteria 1897
240 Ga0495618_0191608 3300046514 Bacteria 1296
241 Ga0495618_0291311 3300046514 Bacteria 1016
242 Ga0495628_0000047 3300046516 Bacteria 97852
243 Ga0495628_0096488 3300046516 Bacteria 2284
244 Ga0495628_0141733 3300046516 Bacteria 1834
245 Ga0495630_0058556 3300046517 Bacteria 2888
246 Ga0495630_0241423 3300046517 Bacteria 1380
247 Ga0495630_0277417 3300046517 Bacteria 1280
248 Ga0495666_0002780 3300046526 Bacteria 8742
249 Ga0495652_0002275 3300046529 Bacteria 20029
250 Ga0495652_0019756 3300046529 Bacteria 5993
251 Ga0495665_0020725 3300046531 Bacteria 3530
252 Ga0495640_0162271 3300046533 Bacteria 1431
253 Ga0495640_0386354 3300046533 Bacteria 861
254 Ga0495586_0276858 3300046535 Bacteria 960
255 Ga0495587_0000418 3300046536 Bacteria 29887
256 Ga0495587_0052306 3300046536 Bacteria 2410
257 Ga0495645_0000016 3300046543 Bacteria 158415
258 Ga0495645_0072091 3300046543 Bacteria 2489
259 Ga0495667_0015075 3300046559 Bacteria 5217
260 Ga0495667_0045352 3300046559 Bacteria 2911
261 Ga0495667_0547142 3300046559 Unclassified 723
262 Ga0495635_0052463 3300046663 Bacteria 2809
263 Ga0495635_0202608 3300046663 Bacteria 1345
264 Ga0495599_0000016 3300046678 Bacteria 169605
265 Ga0495599_0011332 3300046678 Bacteria 5475
266 Ga0495623_0000320 3300046679 Bacteria 31219
267 Ga0495623_0034399 3300046679 Bacteria 3250
268 Ga0495646_0002371 3300046680 Bacteria 11549
269 Ga0495646_0083343 3300046680 Bacteria 1859
270 Ga0495646_0202623 3300046680 Bacteria 1080
271 Ga0495647_0062940 3300046681 Bacteria 1468
272 Ga0495658_0021340 3300046683 Bacteria 3413
273 Ga0495658_0069860 3300046683 Bacteria 2036
274 Ga0495658_0133239 3300046683 Bacteria 1514
275 Ga0495613_0087750 3300046689 Bacteria 2254
276 Ga0495613_0546519 3300046689 Bacteria 775
277 Ga0495624_0035948 3300046690 Bacteria 3195
278 Ga0495600_0010146 3300046809 Bacteria 5840
279 Ga0495600_0045425 3300046809 Bacteria 2866
280 Ga0495600_0457219 3300046809 Bacteria 789
281 Ga0495581_0010844 3300047315 Bacteria 5268
282 Ga0495581_0398442 3300047315 Unclassified 803
283 Ga0495604_0000004 3300047317 Bacteria 456385
284 Ga0495674_0076041 3300047319 Bacteria 2888
285 Ga0495674_0236248 3300047319 Bacteria 1507
286 Ga0495674_0418028 3300047319 Bacteria 1080
287 Ga0495674_0647333 3300047319 Bacteria 833
288 Ga0495676_0085775 3300047321 Bacteria 2371
289 Ga0495680_0002564 3300047322 Bacteria 18528
290 Ga0495680_0038072 3300047322 Bacteria 3847
291 Ga0495675_0003345 3300047444 Bacteria 9654
292 Ga0495684_0056689 3300047471 Bacteria 2986
293 Ga0495684_0067136 3300047471 Bacteria 2727
294 Ga0495593_0018855 3300047673 Bacteria 3872
295 Ga0495602_0000036 3300048088 Bacteria 133584
296 Ga0495602_0192702 3300048088 Bacteria 1561
297 Ga0495614_0002281 3300048089 Bacteria 8519
298 Ga0496100_0002792 3300048903 Bacteria 8933
299 Ga0496100_0525025 3300048903 Bacteria 914
300 Ga0496100_0903888 3300048903 Bacteria 693
301 Ga0496101_0007947 3300048904 Bacteria 6910
302 Ga0496102_0015350 3300048905 Bacteria 6671
303 Ga0496102_0099657 3300048905 Bacteria 2697
304 Ga0496102_0533638 3300048905 Bacteria 1096
305 Ga0496102_0616735 3300048905 Bacteria 1008
306 Ga0496103_0206569 3300048906 Bacteria 1263
307 Ga0496104_0090212 3300048907 Bacteria 2928
308 Ga0496105_0004097 3300048908 Bacteria 10923
309 Ga0496105_0452388 3300048908 Bacteria 1013
310 Ga0496106_0007397 3300048909 Bacteria 8115
311 Ga0496106_0350553 3300048909 Bacteria 1186
312 Ga0496107_0006807 3300048910 Bacteria 7873
313 Ga0496107_0114200 3300048910 Bacteria 1987
314 Ga0496108_0012269 3300048911 Bacteria 6969
315 Ga0496108_0031630 3300048911 Bacteria 4392
316 Ga0496108_0239855 3300048911 Bacteria 1577
317 Ga0496108_0335205 3300048911 Bacteria 1319
318 Ga0496109_0005610 3300048912 Bacteria 10505
319 Ga0496109_0013286 3300048912 Bacteria 7133
320 Ga0496109_0558733 3300048912 Bacteria 1079
321 Ga0496109_0767229 3300048912 Bacteria 902
322 Ga0496110_0002777 3300048913 Bacteria 13210
323 Ga0496110_0946694 3300048913 Bacteria 768
324 Ga0496111_0003566 3300048914 Bacteria 9638
325 Ga0496111_0303133 3300048914 Unclassified 1184
326 Ga0496111_0763814 3300048914 Bacteria 701
327 Ga0496112_0008385 3300048915 Bacteria 9256
328 Ga0496112_0124248 3300048915 Bacteria 2551
329 Ga0496112_0881275 3300048915 Unclassified 818
330 Ga0496113_0047189 3300048916 Bacteria 3200
331 Ga0496113_0056535 3300048916 Bacteria 2946
332 Ga0496114_0000135 3300048917 Bacteria 53370
333 Ga0496114_0769709 3300048917 Bacteria 840
334 Ga0496115_0040038 3300048918 Bacteria 3724
335 Ga0496115_0303623 3300048918 Bacteria 1308
336 Ga0496115_0471684 3300048918 Bacteria 1012
337 Ga0501067_0000899 3300049583 Bacteria 15969
338 Ga0501069_0003948 3300049585 Bacteria 7648
339 Ga0501069_0003980 3300049585 Bacteria 7625
340 Ga0501070_0186388 3300049586 Bacteria 1707
341 Ga0501074_0161787 3300049590 Bacteria 1599
342 Ga0501074_0168416 3300049590 Bacteria 1564
343 Ga0495601_0000287 3300053077 Bacteria 26962
344 Ga0495601_0024194 3300053077 Bacteria 3739
345 Ga0495601_0230538 3300053077 Bacteria 1209
346 Ga0495601_0252528 3300053077 Bacteria 1151
347 Ga0495601_0487076 3300053077 Bacteria 796
348 Ga0495612_0072659 3300053078 Bacteria 1436
349 Ga0495595_0025882 3300053084 Bacteria 2603
350 Ga0495619_0012837 3300053085 Bacteria 5276
351 Ga0495619_0191630 3300053085 Bacteria 1415
352 Ga0495619_0319238 3300053085 Bacteria 1075
353 Ga0500566_0066170 3300053094 Bacteria 2037
354 Ga0466962_0001294 3300061719 Bacteria 11553
355 Ga0466962_0003814 3300061719 Bacteria 7202
356 Ga0466962_0004651 3300061719 Bacteria 6592
357 Ga0466962_0219079 3300061719 Unclassified 932
358 Ga0530510_0013892 3300061734 Bacteria 5671
359 Ga0466967_0027707
360 Ga0070658_10012381
361 Ga0070658_10035124
362 Ga0070680_100007180
363 Ga0070680_100230068
364 Ga0070682_100026952
365 Ga0070660_100024580
366 Ga0070660_100118816
367 Ga0070660_100562873
368 Ga0070661_100167247
369 Ga0070661_100228215
370 Ga0070659_100049217
371 Ga0070659_100076035
372 Ga0070709_10333604
373 Ga0070714_100052153
374 Ga0070714_100100449
375 Ga0070714_100249506
376 Ga0070714_100363716
377 Ga0070714_100386213
378 Ga0070714_100487780
379 Ga0070713_100019797
380 Ga0070678_100055599
381 Ga0070681_10005445
382 Ga0070681_10015929
383 Ga0070681_10033960
384 Ga0070681_10082262
385 Ga0070681_10113908
386 Ga0070707_100004403
387 Ga0070698_100387164
388 Ga0070679_100004975
389 Ga0070679_100045238
390 Ga0070679_100319873
391 Ga0070679_100847575
392 Ga0070695_100000051
393 Ga0070696_100010904
394 Ga0070665_100090552
395 Ga0068855_100099142
396 Ga0068855_100146103
397 Ga0070664_100345423
398 Ga0068857_100029244
399 Ga0068857_100140649
400 Ga0068856_100229577
401 Ga0068856_100389460
402 Ga0068852_100083696
403 Ga0068852_100629703
404 Ga0068852_100894036
405 Ga0070717_10006751
406 Ga0070717_10009595
407 Ga0105240_10109230
408 Ga0105240_10263089
409 Ga0105240_10911144
410 Ga0105245_10123972
411 Ga0105245_10373645
412 Ga0105243_10741300
413 Ga0105248_10107441
414 Ga0105248_10333725
415 Ga0105248_11194805
416 Ga0105238_10347118
417 Ga0105238_10652264
418 Ga0105239_10283194
419 Ga0157373_10079554
420 Ga0157371_10136180
421 Ga0157371_10858612
422 Ga0157370_10275383
423 Ga0157370_10481219
424 Ga0157369_10071129
425 Ga0157369_10209001
426 Ga0157369_10248908
427 Ga0157374_10131182
428 Ga0157374_10555199
429 Ga0157378_10483394
430 Ga0157372_10116257
431 Ga0157372_10162216
432 Ga0157372_10194591
433 Ga0157372_10317159
434 Ga0157372_10488242
435 Ga0157375_10330842
436 Ga0163163_10161789
437 Ga0157376_10144226
438 Ga0206356_11860155
439 Ga0206353_10974204
440 Ga0207707_10001299
441 Ga0207707_10005034
442 Ga0207707_10103597
443 Ga0207707_10279152
444 Ga0207707_10430426
445 Ga0207695_10661081
446 Ga0207660_10019855
447 Ga0207660_10049265
448 Ga0207660_10304346
449 Ga0207657_10003902
450 Ga0207657_10006468
451 Ga0207657_10010548
452 Ga0207657_10447792
453 Ga0207657_10669065
454 Ga0207652_10056726
455 Ga0207652_10130013
456 Ga0207652_10156236
457 Ga0207652_10211880
458 Ga0207652_10707125
459 Ga0207646_10004001
460 Ga0207687_10058241
461 Ga0207687_10635797
462 Ga0207700_10022274
463 Ga0207664_10016431
464 Ga0207664_10040267
465 Ga0207664_10055914
466 Ga0207664_10352520
467 Ga0207664_10432032
468 Ga0207690_10022838
469 Ga0207690_10392521
470 Ga0207661_10783080
471 Ga0207661_11180826
472 Ga0207679_10205363
473 Ga0207667_10119804
474 Ga0207667_10555223
475 Ga0207677_10913083
476 Ga0207639_10575903
477 Ga0207639_10634029
478 Ga0207639_10918004
479 Ga0207678_10406811
480 Ga0207702_10649863
481 Ga0207702_10828815
482 Ga0207674_10014902
483 Ga0207674_10103071
484 Ga0207674_10355808
485 Ga0207698_10020421
486 Ga0268266_10122530
487 Ga0307405_10050452
488 Ga0307412_10041262
489 Ga0307416_100065560
490 Ga0307415_100221165
491 Ga0373936_0007310
492 Ga0373945_0002317
493 Ga0373945_0047586
494 Ga0373954_0136936
495 Ga0373943_0006312
496 Ga0373943_0033280
497 Ga0373946_0022388
498 Ga0373935_0048329
499 Ga0373927_0055659
500 Ga0373927_0187037
501 Ga0373947_0006189
502 Ga0373937_0001083
503 Ga0373925_0019924
504 Ga0373925_0119528
505 Ga0395899_0200092
506 Ga0395898_0014700
507 Ga0395898_0193778
508 Ga0395905_0335035
509 Ga0395901_0336542
510 Ga0436363_1436058
511 Ga0451804_0282728
512 Ga0451853_1281464
513 Ga0439448_0069790
514 Ga0466965_0032617
515 Ga0466965_0171365
516 Ga0466966_0005953
517 Ga0466966_0036393
518 Ga0466966_0081492
519 Ga0466961_0001970
520 Ga0466961_0051663
521 Ga0466961_0068836
522 Ga0466963_0000973
523 Ga0466963_0003108
524 Ga0466963_0006197
525 Ga0466963_0013284
526 Ga0466963_0016802
527 Ga0466963_0023105
528 Ga0466963_0301604
529 Ga0466963_0376525
530 Ga0466964_0021492
531 Ga0466964_0027803
532 Ga0466964_0037851
533 Ga0466971_0001635
534 Ga0466971_0001715
535 Ga0466971_0070938
536 Ga0466971_0078352
537 Ga0466968_0021179
538 Ga0466968_0025735
539 Ga0466968_0153559
540 Ga0466970_0170318
541 Ga0466970_0238204
542 Ga0466957_0001396
543 Ga0466957_0004732
544 Ga0466957_0005964
545 Ga0466957_0006816
546 Ga0466957_0033867
547 Ga0466960_0100515
548 Ga0466959_0001891
549 Ga0466959_0022066
550 Ga0466959_0034314
551 Ga0466959_0038031
552 Ga0466958_0001022
553 Ga0466958_0007538
554 Ga0466958_0010402
555 Ga0466958_0108914
556 Ga0466958_0582882
557 Ga0466967_0000515
558 Ga0466967_0005935
559 Ga0466967_0019639
560 Ga0466967_0047591
561 Ga0466967_0050266
562 Ga0466967_0094023
563 Ga0466967_0122106
564 Ga0466967_0141991
565 Ga0466967_0191154
566 Ga0466967_0304582
567 Ga0466967_0379514
568 Ga0466967_0501579
569 Ga0466967_0529540
570 Ga0466967_1294798
571 Ga0466967_1411868
572 Ga0495592_0000506
573 Ga0495592_0066189
574 Ga0495592_0110077
575 Ga0495592_0289666
576 Ga0495629_0018937
577 Ga0495629_0104513
578 Ga0495641_0016873
579 Ga0495641_0048226
580 Ga0495641_0083597
581 Ga0495651_0000053
582 Ga0495651_0149463
583 Ga0495651_0205276
584 Ga0495651_0421911
585 Ga0495653_0003595
586 Ga0495653_0070623
587 Ga0495653_0107411
588 Ga0495582_0006800
589 Ga0495582_0012992
590 Ga0495582_0155146
591 Ga0495639_0025359
592 Ga0495662_0105055
593 Ga0495664_0018315
594 Ga0495608_0002717
595 Ga0495618_0040821
596 Ga0495618_0041130
597 Ga0495618_0095832
598 Ga0495618_0191608
599 Ga0495618_0291311
600 Ga0495628_0000047
601 Ga0495628_0096488
602 Ga0495628_0141733
603 Ga0495630_0058556
604 Ga0495630_0241423
605 Ga0495630_0277417
606 Ga0495666_0002780
607 Ga0495652_0002275
608 Ga0495652_0019756
609 Ga0495665_0020725
610 Ga0495640_0162271
611 Ga0495640_0386354
612 Ga0495586_0276858
613 Ga0495587_0000418
614 Ga0495587_0052306
615 Ga0495645_0000016
616 Ga0495645_0072091
617 Ga0495667_0015075
618 Ga0495667_0045352
619 Ga0495667_0547142
620 Ga0495635_0052463
621 Ga0495635_0202608
622 Ga0495599_0000016
623 Ga0495599_0011332
624 Ga0495623_0000320
625 Ga0495623_0034399
626 Ga0495646_0002371
627 Ga0495646_0083343
628 Ga0495646_0202623
629 Ga0495647_0062940
630 Ga0495658_0021340
631 Ga0495658_0069860
632 Ga0495658_0133239
633 Ga0495613_0087750
634 Ga0495613_0546519
635 Ga0495624_0035948
636 Ga0495600_0010146
637 Ga0495600_0045425
638 Ga0495600_0457219
639 Ga0495581_0010844
640 Ga0495581_0398442
641 Ga0495604_0000004
642 Ga0495674_0076041
643 Ga0495674_0236248
644 Ga0495674_0418028
645 Ga0495674_0647333
646 Ga0495676_0085775
647 Ga0495680_0002564
648 Ga0495680_0038072
649 Ga0495675_0003345
650 Ga0495684_0056689
651 Ga0495684_0067136
652 Ga0495593_0018855
653 Ga0495602_0000036
654 Ga0495602_0192702
655 Ga0495614_0002281
656 Ga0496100_0002792
657 Ga0496100_0525025
658 Ga0496100_0903888
659 Ga0496101_0007947
660 Ga0496102_0015350
661 Ga0496102_0099657
662 Ga0496102_0533638
663 Ga0496102_0616735
664 Ga0496103_0206569
665 Ga0496104_0090212
666 Ga0496105_0004097
667 Ga0496105_0452388
668 Ga0496106_0007397
669 Ga0496106_0350553
670 Ga0496107_0006807
671 Ga0496107_0114200
672 Ga0496108_0012269
673 Ga0496108_0031630
674 Ga0496108_0239855
675 Ga0496108_0335205
676 Ga0496109_0005610
677 Ga0496109_0013286
678 Ga0496109_0558733
679 Ga0496109_0767229
680 Ga0496110_0002777
681 Ga0496110_0946694
682 Ga0496111_0003566
683 Ga0496111_0303133
684 Ga0496111_0763814
685 Ga0496112_0008385
686 Ga0496112_0124248
687 Ga0496112_0881275
688 Ga0496113_0047189
689 Ga0496113_0056535
690 Ga0496114_0000135
691 Ga0496114_0769709
692 Ga0496115_0040038
693 Ga0496115_0303623
694 Ga0496115_0471684
695 Ga0501067_0000899
696 Ga0501069_0003948
697 Ga0501069_0003980
698 Ga0501070_0186388
699 Ga0501074_0161787
700 Ga0501074_0168416
701 Ga0495601_0000287
702 Ga0495601_0024194
703 Ga0495601_0230538
704 Ga0495601_0252528
705 Ga0495601_0487076
706 Ga0495612_0072659
707 Ga0495595_0025882
708 Ga0495619_0012837
709 Ga0495619_0191630
710 Ga0495619_0319238
711 Ga0500566_0066170
712 Ga0466962_0001294
713 Ga0466962_0003814
714 Ga0466962_0004651
715 Ga0466962_0219079
716 Ga0530510_0013892

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

19

162

0.88

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

41

161

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nsl-assembly1.cif.gz_D crystal structure of probable acetyltransferase 0.9076 16 185
1nsl-assembly1.cif.gz_F crystal structure of probable acetyltransferase 0.9064 16 185
1nsl-assembly1.cif.gz_B crystal structure of probable acetyltransferase 0.9032 16 185
3r96-assembly1.cif.gz_A crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with acetyl-coa and amp 0.8889 16 182
3fbu-assembly2.cif.gz_B-2 the crystal structure of the acetyltransferase (gnat family) from bacillus anthracis 0.8853 12 184
ID Description Score Start End Superfamily
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9101 113 184 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.898 133 182 3.40.630.30
1nslB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8964 11 185 3.40.630.30
af_P0A948_10_192_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8934 12 182 3.40.630.30
af_O05578_9_186_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8933 18 184 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A6L6AAW3-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9353 100 182 GO:0005737
GO:0008999
AF-A0A848SZ29-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9345 11 198 GO:0005737
GO:0008999
AF-A0A520Q5B7-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9272 8 207 GO:0016747
AF-A0A1H2D8K6-F1-model_v4 deleted 0.9263 8 182
AF-A0A3D1V4C0-F1-model_v4 N-acetyltransferase domain-containing protein 0.9239 77 188 GO:0005737
GO:0008999
GO:1990189

Map