F421162

General Info

Members Datasets Scaffolds Average Seq Length
358 226 716 296

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10484350|Ga0114129_104843503
Length 351
Sequence MAGASVTAIGGDGSSSDPLQAASAGTASSTAAQAREVTRRRMPECRSVKALVTGATGFVGGRLAKRLAADGVEVRCLVRDKDRARHLAAGGHELHEGDVTRPETLRGAGKGVDVAYYLVHGMGRGASDDFEQQERGAAAAFAEMATREGIGRIVYLGGLGETPGSKHLRSRHETALVLADKGPPLTYFRAAMVVGAGSESYKTLRYLVQRLPAMIAPAWLKTRTQPIAIDDVLEYLAAAPRIDAAAGREVQIGGPDVLSYGDMLDRMAVALGTYRRPKLPVPLLTPWLSSLWIGLVTPVDAGVARPLIEGLSTETVVTDPSGAALFDVDPTPFDDALRSAIAEDGQSGGTT

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
120 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
121 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
122 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
123 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
219 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
223 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
224 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.07
Nodule 0
Rhizoplane 14.25
Rhizosphere 82.4
Stem 0
Stem Tuber 0
Unclassified 3.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10484350 3300009147 Bacteria 1618
2 LJQas_1005904 3300000549 Bacteria 1538
3 Ga0070683_100009420 3300005329 Bacteria 8351
4 Ga0070683_100037511 3300005329 Bacteria 4437
5 Ga0070683_100190802 3300005329 Bacteria 1945
6 Ga0070677_10000276 3300005333 Bacteria 18000
7 Ga0070680_100025010 3300005336 Unclassified 4773
8 Ga0070682_100050853 3300005337 Bacteria 2589
9 Ga0068868_100000508 3300005338 Bacteria 25991
10 Ga0070689_100045148 3300005340 Bacteria 3392
11 Ga0070689_100070159 3300005340 Bacteria 2735
12 Ga0070691_10000054 3300005341 Bacteria 32149
13 Ga0070661_100070387 3300005344 Bacteria 2573
14 Ga0070668_100120500 3300005347 Bacteria 2096
15 Ga0070675_100182458 3300005354 Bacteria 1815
16 Ga0070674_100000009 3300005356 Bacteria 143336
17 Ga0070674_100033644 3300005356 Bacteria 3414
18 Ga0070673_100310018 3300005364 Bacteria 1392
19 Ga0070688_100000012 3300005365 Bacteria 79406
20 Ga0070659_100155396 3300005366 Bacteria 1868
21 Ga0070709_10135901 3300005434 Bacteria 1684
22 Ga0070709_10158526 3300005434 Bacteria 1571
23 Ga0070713_100001168 3300005436 Bacteria 16776
24 Ga0070711_100017447 3300005439 Bacteria 4572
25 Ga0070711_100049182 3300005439 Bacteria 2887
26 Ga0070711_100068626 3300005439 Bacteria 2492
27 Ga0070700_100004227 3300005441 Bacteria 7494
28 Ga0070662_100000001 3300005457 Bacteria 317995
29 Ga0070662_100022005 3300005457 Bacteria 4359
30 Ga0070681_10028122 3300005458 Bacteria 5653
31 Ga0068867_100003954 3300005459 Bacteria 10428
32 Ga0070679_100000247 3300005530 Bacteria 45331
33 Ga0070684_100004954 3300005535 Bacteria 10161
34 Ga0070684_100056567 3300005535 Bacteria 3424
35 Ga0070684_100073640 3300005535 Bacteria 3010
36 Ga0068853_100000161 3300005539 Bacteria 45752
37 Ga0070686_100038418 3300005544 Bacteria 2976
38 Ga0070686_100297179 3300005544 Bacteria 1196
39 Ga0070695_100132372 3300005545 Bacteria 1720
40 Ga0070693_100003835 3300005547 Bacteria 7043
41 Ga0070704_100095660 3300005549 Bacteria 2225
42 Ga0068855_100161358 3300005563 Bacteria 2544
43 Ga0070664_100011624 3300005564 Bacteria 7144
44 Ga0068854_100079484 3300005578 Bacteria 2418
45 Ga0068856_100005497 3300005614 Bacteria 12485
46 Ga0068856_100364047 3300005614 Bacteria 1464
47 Ga0070702_100041710 3300005615 Bacteria 2576
48 Ga0070702_100105295 3300005615 Unclassified 1738
49 Ga0068852_100058553 3300005616 Bacteria 3338
50 Ga0068859_100290460 3300005617 Bacteria 1728
51 Ga0068864_100106782 3300005618 Bacteria 2490
52 Ga0068866_10000003 3300005718 Bacteria 281675
53 Ga0068861_100018255 3300005719 Bacteria 4995
54 Ga0068863_100008698 3300005841 Bacteria 9918
55 Ga0068858_100000009 3300005842 Bacteria 237748
56 Ga0068858_100187313 3300005842 Bacteria 1955
57 Ga0068858_100215197 3300005842 Bacteria 1819
58 Ga0068860_100007927 3300005843 Bacteria 10598
59 Ga0068862_100001603 3300005844 Bacteria 20605
60 Ga0081455_10005473 3300005937 Bacteria 13921
61 Ga0081455_10034960 3300005937 Bacteria 4497
62 Ga0081455_10081553 3300005937 Bacteria 2649
63 Ga0081538_10002762 3300005981 Bacteria 16828
64 Ga0081538_10009437 3300005981 Bacteria 8148
65 Ga0081538_10041477 3300005981 Bacteria 2921
66 Ga0081540_1007910 3300005983 Bacteria 7506
67 Ga0081539_10002888 3300005985 Bacteria 22778
68 Ga0075365_10062467 3300006038 Unclassified 2491
69 Ga0075365_10085466 3300006038 Bacteria 2143
70 Ga0075365_10217243 3300006038 Bacteria 1341
71 Ga0075363_100038965 3300006048 Bacteria 2500
72 Ga0075364_10040419 3300006051 Bacteria 3025
73 Ga0075364_10066481 3300006051 Archaea 2368
74 Ga0075432_10043053 3300006058 Bacteria 1581
75 Ga0070715_10000001 3300006163 Bacteria 693690
76 Ga0070712_100002610 3300006175 Bacteria 11127
77 Ga0070712_100199203 3300006175 Bacteria 1572
78 Ga0068871_100132274 3300006358 Unclassified 2116
79 Ga0075428_100054617 3300006844 Bacteria 4377
80 Ga0075428_100467352 3300006844 Bacteria 1351
81 Ga0075428_100482976 3300006844 Bacteria 1326
82 Ga0075430_100020488 3300006846 Bacteria 5626
83 Ga0075430_100062924 3300006846 Bacteria 3117
84 Ga0075430_100483067 3300006846 Bacteria 1022
85 Ga0075431_100007184 3300006847 Bacteria 11075
86 Ga0075431_100050805 3300006847 Bacteria 4275
87 Ga0075431_100278133 3300006847 Bacteria 1695
88 Ga0075431_100307246 3300006847 Bacteria 1601
89 Ga0075433_10000337 3300006852 Bacteria 29062
90 Ga0075433_10193539 3300006852 Bacteria 1809
91 Ga0075434_100068271 3300006871 Bacteria 3541
92 Ga0068865_100178924 3300006881 Bacteria 1632
93 Ga0097620_100290447 3300006931 Bacteria 1728
94 Ga0075435_100067199 3300007076 Archaea 2918
95 Ga0111539_10190502 3300009094 Bacteria 2393
96 Ga0111539_10258684 3300009094 Bacteria 2026
97 Ga0111539_10489030 3300009094 Archaea 1433
98 Ga0105245_10000020 3300009098 Bacteria 181774
99 Ga0105245_10000179 3300009098 Bacteria 60347
100 Ga0105245_10022267 3300009098 Bacteria 5561
101 Ga0105245_10097131 3300009098 Unclassified 2720
102 Ga0114129_10153447 3300009147 Bacteria 3151
103 Ga0114129_10158271 3300009147 Archaea 3096
104 Ga0105242_10000959 3300009176 Bacteria 22497
105 Ga0105242_10001335 3300009176 Bacteria 19502
106 Ga0105249_10000080 3300009553 Bacteria 138080
107 Ga0105249_10020910 3300009553 Bacteria 5852
108 Ga0105239_10044943 3300010375 Bacteria 4841
109 Ga0105239_10150735 3300010375 Bacteria 2595
110 Ga0105246_10028081 3300011119 Bacteria 3694
111 Ga0157370_10024720 3300013104 Bacteria 5948
112 Ga0157369_10197163 3300013105 Bacteria 2114
113 Ga0157378_10340809 3300013297 Bacteria 1462
114 Ga0157375_10115361 3300013308 Bacteria 2789
115 Ga0157380_10000427 3300014326 Bacteria 25606
116 Ga0157380_10260791 3300014326 Bacteria 1574
117 Ga0157377_10116375 3300014745 Bacteria 1614
118 Ga0157379_10006880 3300014968 Bacteria 9832
119 Ga0157376_10474550 3300014969 Bacteria 1225
120 Ga0163161_10000027 3300017792 Bacteria 197774
121 Ga0207682_10000176 3300025893 Bacteria 29031
122 Ga0207642_10000002 3300025899 Bacteria 658166
123 Ga0207642_10084709 3300025899 Bacteria 1549
124 Ga0207710_10000180 3300025900 Bacteria 63999
125 Ga0207710_10066828 3300025900 Bacteria 1641
126 Ga0207688_10006484 3300025901 Bacteria 6370
127 Ga0207680_10002472 3300025903 Bacteria 8628
128 Ga0207685_10000005 3300025905 Bacteria 289944
129 Ga0207645_10173917 3300025907 Bacteria 1412
130 Ga0207705_10157980 3300025909 Bacteria 1702
131 Ga0207707_10035541 3300025912 Bacteria 4357
132 Ga0207693_10016601 3300025915 Bacteria 5882
133 Ga0207693_10020740 3300025915 Bacteria 5227
134 Ga0207693_10073986 3300025915 Bacteria 2667
135 Ga0207663_10006991 3300025916 Bacteria 5821
136 Ga0207663_10032688 3300025916 Bacteria 3091
137 Ga0207660_10015981 3300025917 Unclassified 4961
138 Ga0207652_10000323 3300025921 Bacteria 49536
139 Ga0207659_10039549 3300025926 Bacteria 3291
140 Ga0207687_10000013 3300025927 Bacteria 299826
141 Ga0207687_10001076 3300025927 Bacteria 18525
142 Ga0207687_10068566 3300025927 Unclassified 2527
143 Ga0207687_10279836 3300025927 Bacteria 1337
144 Ga0207700_10000081 3300025928 Bacteria 59083
145 Ga0207690_10072486 3300025932 Bacteria 2379
146 Ga0207706_10000003 3300025933 Bacteria 345011
147 Ga0207686_10000156 3300025934 Bacteria 51745
148 Ga0207686_10001163 3300025934 Bacteria 15181
149 Ga0207669_10000001 3300025937 Bacteria 377747
150 Ga0207669_10026186 3300025937 Bacteria 3168
151 Ga0207704_10206693 3300025938 Bacteria 1441
152 Ga0207661_10010893 3300025944 Bacteria 6563
153 Ga0207661_10137249 3300025944 Bacteria 2102
154 Ga0207679_10012795 3300025945 Bacteria 5483
155 Ga0207679_10162351 3300025945 Bacteria 1830
156 Ga0207651_10532780 3300025960 Unclassified 1019
157 Ga0207712_10000007 3300025961 Bacteria 539589
158 Ga0207640_10008413 3300025981 Bacteria 5731
159 Ga0207677_10000721 3300026023 Bacteria 19478
160 Ga0207703_10000207 3300026035 Bacteria 68866
161 Ga0207703_10179847 3300026035 Bacteria 1866
162 Ga0207639_10000536 3300026041 Bacteria 26077
163 Ga0207708_10002061 3300026075 Bacteria 14805
164 Ga0207702_10104002 3300026078 Bacteria 2512
165 Ga0207641_10000349 3300026088 Bacteria 55251
166 Ga0207641_10041339 3300026088 Bacteria 3863
167 Ga0207676_10019102 3300026095 Bacteria 4995
168 Ga0207675_100030823 3300026118 Bacteria 4995
169 Ga0207683_10031371 3300026121 Bacteria 4612
170 Ga0207683_10053122 3300026121 Bacteria 3552
171 Ga0207698_10004988 3300026142 Bacteria 8138
172 Ga0207428_10074978 3300027907 Bacteria 2652
173 Ga0268266_10000047 3300028379 Bacteria 310996
174 Ga0268265_10702984 3300028380 Bacteria 977
175 Ga0268264_10002520 3300028381 Bacteria 16098
176 Ga0265337_1000002 3300028556 Bacteria 139247
177 Ga0265326_10000007 3300028558 Bacteria 223057
178 Ga0265322_10000001 3300028654 Bacteria 543854
179 Ga0265336_10005833 3300028666 Bacteria 4501
180 Ga0265324_10000263 3300029957 Bacteria 39080
181 Ga0265332_10061629 3300031238 Bacteria 1604
182 Ga0265328_10005534 3300031239 Bacteria 5406
183 Ga0265320_10000002 3300031240 Bacteria 542875
184 Ga0265329_10014551 3300031242 Bacteria 2774
185 Ga0265331_10002898 3300031250 Bacteria 11337
186 Ga0265327_10000011 3300031251 Bacteria 543807
187 Ga0265314_10000058 3300031711 Bacteria 167476
188 Ga0307405_10040751 3300031731 Bacteria 2815
189 Ga0307413_10019108 3300031824 Bacteria 3612
190 Ga0307413_10042478 3300031824 Bacteria 2672
191 Ga0307410_10016315 3300031852 Bacteria 4427
192 Ga0307406_10015246 3300031901 Bacteria 4443
193 Ga0307407_10055229 3300031903 Bacteria 2294
194 Ga0307407_10080606 3300031903 Bacteria 1967
195 Ga0307412_10156620 3300031911 Bacteria 1687
196 Ga0307409_100009887 3300031995 Bacteria 5888
197 Ga0307409_100018268 3300031995 Bacteria 4707
198 Ga0307409_100175649 3300031995 Bacteria 1890
199 Ga0307416_100088657 3300032002 Bacteria 2646
200 Ga0307416_100125830 3300032002 Bacteria 2295
201 Ga0307416_100165788 3300032002 Bacteria 2049
202 Ga0307416_100224882 3300032002 Bacteria 1803
203 Ga0307411_10226454 3300032005 Bacteria 1454
204 Ga0307415_100008948 3300032126 Bacteria 5582
205 Ga0307415_100009943 3300032126 Bacteria 5363
206 Ga0307415_100214231 3300032126 Bacteria 1539
207 Ga0451807_1000803 3300041486 Bacteria 2721
208 Ga0451853_0959972 3300041512 Bacteria 5027
209 Ga0466963_0305365 3300044694 Unclassified 1119
210 Ga0466960_0058756 3300044901 Bacteria 1879
211 Ga0466967_0605819 3300045976 Bacteria 1081
212 Ga0495629_0000218 3300046459 Bacteria 51219
213 Ga0495629_0004724 3300046459 Bacteria 10209
214 Ga0495629_0024568 3300046459 Bacteria 4291
215 Ga0495641_0000029 3300046461 Bacteria 97259
216 Ga0495653_0184359 3300046463 Bacteria 1429
217 Ga0495582_0000009 3300046473 Bacteria 123633
218 Ga0495662_0053129 3300046476 Bacteria 1957
219 Ga0495594_0000013 3300046499 Bacteria 103201
220 Ga0495606_0000211 3300046507 Bacteria 103386
221 Ga0495608_0000115 3300046511 Bacteria 56782
222 Ga0495628_0004871 3300046516 Bacteria 11819
223 Ga0495630_0004346 3300046517 Bacteria 9946
224 Ga0495630_0179098 3300046517 Bacteria 1616
225 Ga0495652_0013872 3300046529 Bacteria 7250
226 Ga0495640_0007286 3300046533 Bacteria 8715
227 Ga0495587_0037419 3300046536 Bacteria 2914
228 Ga0495621_0002863 3300046539 Bacteria 4698
229 Ga0495622_0000014 3300046557 Bacteria 182142
230 Ga0495667_0157846 3300046559 Bacteria 1459
231 Ga0495634_0000002 3300046642 Bacteria 247842
232 Ga0495634_0049711 3300046642 Bacteria 2818
233 Ga0495625_0000122 3300046660 Bacteria 121146
234 Ga0495625_0000204 3300046660 Bacteria 94356
235 Ga0495635_0000005 3300046663 Bacteria 302178
236 Ga0495588_0000198 3300046674 Bacteria 60956
237 Ga0495599_0004060 3300046678 Bacteria 8622
238 Ga0495658_0000002 3300046683 Bacteria 309651
239 Ga0495669_0000030 3300046684 Bacteria 102988
240 Ga0495613_0292839 3300046689 Bacteria 1128
241 Ga0495624_0000037 3300046690 Bacteria 83796
242 Ga0495672_0101951 3300047320 Bacteria 1555
243 Ga0495676_0000873 3300047321 Bacteria 25176
244 Ga0495676_0045518 3300047321 Bacteria 3571
245 Ga0495680_0008056 3300047322 Bacteria 9606
246 Ga0496100_0000010 3300048903 Bacteria 205204
247 Ga0496100_0086909 3300048903 Bacteria 2125
248 Ga0496101_0000025 3300048904 Bacteria 205204
249 Ga0496101_0000062 3300048904 Bacteria 126595
250 Ga0496101_0144866 3300048904 Bacteria 1813
251 Ga0496101_0297211 3300048904 Bacteria 1264
252 Ga0496101_0332994 3300048904 Bacteria 1192
253 Ga0496102_0000584 3300048905 Bacteria 38605
254 Ga0496102_0287885 3300048905 Bacteria 1548
255 Ga0496102_0353616 3300048905 Bacteria 1383
256 Ga0496103_0000043 3300048906 Bacteria 167983
257 Ga0496103_0000059 3300048906 Bacteria 139196
258 Ga0496103_0001133 3300048906 Bacteria 18515
259 Ga0496103_0356665 3300048906 Bacteria 940
260 Ga0496104_0000009 3300048907 Bacteria 488055
261 Ga0496104_0000727 3300048907 Bacteria 28357
262 Ga0496104_0041519 3300048907 Bacteria 4313
263 Ga0496105_0000007 3300048908 Bacteria 339658
264 Ga0496105_0006426 3300048908 Bacteria 9035
265 Ga0496105_0062966 3300048908 Bacteria 3060
266 Ga0496106_0000012 3300048909 Bacteria 205158
267 Ga0496106_0000145 3300048909 Bacteria 52447
268 Ga0496106_0002899 3300048909 Bacteria 12755
269 Ga0496106_0047384 3300048909 Bacteria 3235
270 Ga0496107_0000006 3300048910 Bacteria 258746
271 Ga0496107_0000010 3300048910 Bacteria 205188
272 Ga0496107_0120225 3300048910 Bacteria 1935
273 Ga0496107_0129660 3300048910 Bacteria 1861
274 Ga0496108_0000001 3300048911 Bacteria 919044
275 Ga0496108_0176888 3300048911 Bacteria 1847
276 Ga0496109_0000004 3300048912 Bacteria 404818
277 Ga0496109_0000028 3300048912 Bacteria 168138
278 Ga0496109_0135185 3300048912 Bacteria 2303
279 Ga0496109_0216325 3300048912 Bacteria 1802
280 Ga0496109_0233006 3300048912 Bacteria 1732
281 Ga0496110_0039244 3300048913 Bacteria 4122
282 Ga0496110_0316713 3300048913 Bacteria 1421
283 Ga0496111_0012104 3300048914 Bacteria 5834
284 Ga0496111_0012437 3300048914 Bacteria 5762
285 Ga0496112_0000006 3300048915 Bacteria 365227
286 Ga0496113_0004755 3300048916 Bacteria 8385
287 Ga0496113_0022251 3300048916 Bacteria 4481
288 Ga0496113_0023031 3300048916 Bacteria 4413
289 Ga0496113_0241773 3300048916 Bacteria 1440
290 Ga0496114_0003890 3300048917 Bacteria 11513
291 Ga0496114_0015415 3300048917 Bacteria 6147
292 Ga0496115_0000020 3300048918 Bacteria 171995
293 Ga0496115_0000034 3300048918 Bacteria 135380
294 Ga0496115_0000199 3300048918 Bacteria 56119
295 Ga0496115_0114512 3300048918 Bacteria 2216
296 Ga0501031_0088310 3300049568 Bacteria 2021
297 Ga0501031_0247638 3300049568 Bacteria 1158
298 Ga0501036_0057142 3300049572 Bacteria 3305
299 Ga0501036_0488270 3300049572 Bacteria 1025
300 Ga0501038_0082894 3300049574 Bacteria 2700
301 Ga0501038_0335634 3300049574 Bacteria 1180
302 Ga0501039_0028879 3300049575 Bacteria 4271
303 Ga0501039_0175166 3300049575 Bacteria 1687
304 Ga0501040_0064024 3300049576 Bacteria 2531
305 Ga0501040_0085592 3300049576 Bacteria 2188
306 Ga0501040_0095387 3300049576 Bacteria 2070
307 Ga0501041_0179969 3300049577 Bacteria 1323
308 Ga0501069_0185268 3300049585 Bacteria 1204
309 Ga0501071_0043682 3300049587 Bacteria 3214
310 Ga0501071_0193712 3300049587 Bacteria 1525
311 Ga0501072_0034749 3300049588 Bacteria 3950
312 Ga0501072_0045491 3300049588 Unclassified 3452
313 Ga0501072_0212616 3300049588 Bacteria 1541
314 Ga0501072_0242877 3300049588 Bacteria 1434
315 Ga0501074_0043611 3300049590 Bacteria 3247
316 Ga0501074_0426050 3300049590 Unclassified 941
317 Ga0501075_0000711 3300049591 Bacteria 20613
318 Ga0501075_0141236 3300049591 Bacteria 1835
319 Ga0501075_0376318 3300049591 Bacteria 1082
320 Ga0501077_0122735 3300049593 Bacteria 1647
321 Ga0501077_0226147 3300049593 Bacteria 1189
322 Ga0501079_0111813 3300049741 Bacteria 2123
323 Ga0501079_0118646 3300049741 Bacteria 2057
324 Ga0501080_0026010 3300049742 Bacteria 5438
325 Ga0501081_0024332 3300049743 Bacteria 4066
326 Ga0501081_0024852 3300049743 Bacteria 4025
327 Ga0501044_0552158 3300049823 Unclassified 1049
328 nmdc:mga03n38_64636_c1 3300050490 Bacteria 1675
329 nmdc:mga00v17_97430_c1 3300050491 Bacteria 1854
330 nmdc:mga05p37_622955_c1 3300050507 Bacteria 1214
331 nmdc:mga09592_20187_c1 3300050508 Bacteria 5476
332 nmdc:mga0qj67_25472_c1 3300050509 Bacteria 4571
333 nmdc:mga0qj67_455739_c1 3300050509 Bacteria 1030
334 nmdc:mga06r32_103071_c1 3300050510 Bacteria 2801
335 nmdc:mga06r32_24785_c1 3300050510 Bacteria 5575
336 nmdc:mga06r32_302501_c1 3300050510 Bacteria 1585
337 nmdc:mga08y16_181106_c1 3300050511 Bacteria 2188
338 nmdc:mga0n895_11649_c1 3300050512 Bacteria 7856
339 nmdc:mga0rr50_271435_c1 3300050513 Archaea 1414
340 nmdc:mga08x19_238146_c1 3300050514 Archaea 1254
341 nmdc:mga0a205_45869_c1 3300050515 Bacteria 4215
342 nmdc:mga0a205_4_c1 3300050515 Bacteria 168154
343 Ga0495601_0000066 3300053077 Bacteria 56855
344 Ga0495601_0012696 3300053077 Bacteria 5053
345 Ga0495601_0106516 3300053077 Bacteria 1813
346 Ga0495601_0156871 3300053077 Bacteria 1486
347 Ga0495612_0014413 3300053078 Bacteria 3179
348 Ga0495612_0027047 3300053078 Bacteria 2306
349 Ga0495612_0042092 3300053078 Bacteria 1864
350 Ga0495655_0000011 3300053083 Bacteria 118490
351 Ga0495595_0000113 3300053084 Bacteria 36421
352 Ga0495619_0000001 3300053085 Bacteria 586054
353 Ga0500641_0011397 3300053096 Bacteria 3225
354 Ga0500614_001661 3300053123 Bacteria 5212
355 Ga0500628_000058 3300053129 Bacteria 32870
356 Ga0501082_0155137 3300060353 Bacteria 1989
357 Ga0501082_0156037 3300060353 Bacteria 1983
358 Ga0530510_0073002 3300061734 Bacteria 2490
359 Ga0114129_10484350
360 LJQas_1005904
361 Ga0070683_100009420
362 Ga0070683_100037511
363 Ga0070683_100190802
364 Ga0070677_10000276
365 Ga0070680_100025010
366 Ga0070682_100050853
367 Ga0068868_100000508
368 Ga0070689_100045148
369 Ga0070689_100070159
370 Ga0070691_10000054
371 Ga0070661_100070387
372 Ga0070668_100120500
373 Ga0070675_100182458
374 Ga0070674_100000009
375 Ga0070674_100033644
376 Ga0070673_100310018
377 Ga0070688_100000012
378 Ga0070659_100155396
379 Ga0070709_10135901
380 Ga0070709_10158526
381 Ga0070713_100001168
382 Ga0070711_100017447
383 Ga0070711_100049182
384 Ga0070711_100068626
385 Ga0070700_100004227
386 Ga0070662_100000001
387 Ga0070662_100022005
388 Ga0070681_10028122
389 Ga0068867_100003954
390 Ga0070679_100000247
391 Ga0070684_100004954
392 Ga0070684_100056567
393 Ga0070684_100073640
394 Ga0068853_100000161
395 Ga0070686_100038418
396 Ga0070686_100297179
397 Ga0070695_100132372
398 Ga0070693_100003835
399 Ga0070704_100095660
400 Ga0068855_100161358
401 Ga0070664_100011624
402 Ga0068854_100079484
403 Ga0068856_100005497
404 Ga0068856_100364047
405 Ga0070702_100041710
406 Ga0070702_100105295
407 Ga0068852_100058553
408 Ga0068859_100290460
409 Ga0068864_100106782
410 Ga0068866_10000003
411 Ga0068861_100018255
412 Ga0068863_100008698
413 Ga0068858_100000009
414 Ga0068858_100187313
415 Ga0068858_100215197
416 Ga0068860_100007927
417 Ga0068862_100001603
418 Ga0081455_10005473
419 Ga0081455_10034960
420 Ga0081455_10081553
421 Ga0081538_10002762
422 Ga0081538_10009437
423 Ga0081538_10041477
424 Ga0081540_1007910
425 Ga0081539_10002888
426 Ga0075365_10062467
427 Ga0075365_10085466
428 Ga0075365_10217243
429 Ga0075363_100038965
430 Ga0075364_10040419
431 Ga0075364_10066481
432 Ga0075432_10043053
433 Ga0070715_10000001
434 Ga0070712_100002610
435 Ga0070712_100199203
436 Ga0068871_100132274
437 Ga0075428_100054617
438 Ga0075428_100467352
439 Ga0075428_100482976
440 Ga0075430_100020488
441 Ga0075430_100062924
442 Ga0075430_100483067
443 Ga0075431_100007184
444 Ga0075431_100050805
445 Ga0075431_100278133
446 Ga0075431_100307246
447 Ga0075433_10000337
448 Ga0075433_10193539
449 Ga0075434_100068271
450 Ga0068865_100178924
451 Ga0097620_100290447
452 Ga0075435_100067199
453 Ga0111539_10190502
454 Ga0111539_10258684
455 Ga0111539_10489030
456 Ga0105245_10000020
457 Ga0105245_10000179
458 Ga0105245_10022267
459 Ga0105245_10097131
460 Ga0114129_10153447
461 Ga0114129_10158271
462 Ga0105242_10000959
463 Ga0105242_10001335
464 Ga0105249_10000080
465 Ga0105249_10020910
466 Ga0105239_10044943
467 Ga0105239_10150735
468 Ga0105246_10028081
469 Ga0157370_10024720
470 Ga0157369_10197163
471 Ga0157378_10340809
472 Ga0157375_10115361
473 Ga0157380_10000427
474 Ga0157380_10260791
475 Ga0157377_10116375
476 Ga0157379_10006880
477 Ga0157376_10474550
478 Ga0163161_10000027
479 Ga0207682_10000176
480 Ga0207642_10000002
481 Ga0207642_10084709
482 Ga0207710_10000180
483 Ga0207710_10066828
484 Ga0207688_10006484
485 Ga0207680_10002472
486 Ga0207685_10000005
487 Ga0207645_10173917
488 Ga0207705_10157980
489 Ga0207707_10035541
490 Ga0207693_10016601
491 Ga0207693_10020740
492 Ga0207693_10073986
493 Ga0207663_10006991
494 Ga0207663_10032688
495 Ga0207660_10015981
496 Ga0207652_10000323
497 Ga0207659_10039549
498 Ga0207687_10000013
499 Ga0207687_10001076
500 Ga0207687_10068566
501 Ga0207687_10279836
502 Ga0207700_10000081
503 Ga0207690_10072486
504 Ga0207706_10000003
505 Ga0207686_10000156
506 Ga0207686_10001163
507 Ga0207669_10000001
508 Ga0207669_10026186
509 Ga0207704_10206693
510 Ga0207661_10010893
511 Ga0207661_10137249
512 Ga0207679_10012795
513 Ga0207679_10162351
514 Ga0207651_10532780
515 Ga0207712_10000007
516 Ga0207640_10008413
517 Ga0207677_10000721
518 Ga0207703_10000207
519 Ga0207703_10179847
520 Ga0207639_10000536
521 Ga0207708_10002061
522 Ga0207702_10104002
523 Ga0207641_10000349
524 Ga0207641_10041339
525 Ga0207676_10019102
526 Ga0207675_100030823
527 Ga0207683_10031371
528 Ga0207683_10053122
529 Ga0207698_10004988
530 Ga0207428_10074978
531 Ga0268266_10000047
532 Ga0268265_10702984
533 Ga0268264_10002520
534 Ga0265337_1000002
535 Ga0265326_10000007
536 Ga0265322_10000001
537 Ga0265336_10005833
538 Ga0265324_10000263
539 Ga0265332_10061629
540 Ga0265328_10005534
541 Ga0265320_10000002
542 Ga0265329_10014551
543 Ga0265331_10002898
544 Ga0265327_10000011
545 Ga0265314_10000058
546 Ga0307405_10040751
547 Ga0307413_10019108
548 Ga0307413_10042478
549 Ga0307410_10016315
550 Ga0307406_10015246
551 Ga0307407_10055229
552 Ga0307407_10080606
553 Ga0307412_10156620
554 Ga0307409_100009887
555 Ga0307409_100018268
556 Ga0307409_100175649
557 Ga0307416_100088657
558 Ga0307416_100125830
559 Ga0307416_100165788
560 Ga0307416_100224882
561 Ga0307411_10226454
562 Ga0307415_100008948
563 Ga0307415_100009943
564 Ga0307415_100214231
565 Ga0451807_1000803
566 Ga0451853_0959972
567 Ga0466963_0305365
568 Ga0466960_0058756
569 Ga0466967_0605819
570 Ga0495629_0000218
571 Ga0495629_0004724
572 Ga0495629_0024568
573 Ga0495641_0000029
574 Ga0495653_0184359
575 Ga0495582_0000009
576 Ga0495662_0053129
577 Ga0495594_0000013
578 Ga0495606_0000211
579 Ga0495608_0000115
580 Ga0495628_0004871
581 Ga0495630_0004346
582 Ga0495630_0179098
583 Ga0495652_0013872
584 Ga0495640_0007286
585 Ga0495587_0037419
586 Ga0495621_0002863
587 Ga0495622_0000014
588 Ga0495667_0157846
589 Ga0495634_0000002
590 Ga0495634_0049711
591 Ga0495625_0000122
592 Ga0495625_0000204
593 Ga0495635_0000005
594 Ga0495588_0000198
595 Ga0495599_0004060
596 Ga0495658_0000002
597 Ga0495669_0000030
598 Ga0495613_0292839
599 Ga0495624_0000037
600 Ga0495672_0101951
601 Ga0495676_0000873
602 Ga0495676_0045518
603 Ga0495680_0008056
604 Ga0496100_0000010
605 Ga0496100_0086909
606 Ga0496101_0000025
607 Ga0496101_0000062
608 Ga0496101_0144866
609 Ga0496101_0297211
610 Ga0496101_0332994
611 Ga0496102_0000584
612 Ga0496102_0287885
613 Ga0496102_0353616
614 Ga0496103_0000043
615 Ga0496103_0000059
616 Ga0496103_0001133
617 Ga0496103_0356665
618 Ga0496104_0000009
619 Ga0496104_0000727
620 Ga0496104_0041519
621 Ga0496105_0000007
622 Ga0496105_0006426
623 Ga0496105_0062966
624 Ga0496106_0000012
625 Ga0496106_0000145
626 Ga0496106_0002899
627 Ga0496106_0047384
628 Ga0496107_0000006
629 Ga0496107_0000010
630 Ga0496107_0120225
631 Ga0496107_0129660
632 Ga0496108_0000001
633 Ga0496108_0176888
634 Ga0496109_0000004
635 Ga0496109_0000028
636 Ga0496109_0135185
637 Ga0496109_0216325
638 Ga0496109_0233006
639 Ga0496110_0039244
640 Ga0496110_0316713
641 Ga0496111_0012104
642 Ga0496111_0012437
643 Ga0496112_0000006
644 Ga0496113_0004755
645 Ga0496113_0022251
646 Ga0496113_0023031
647 Ga0496113_0241773
648 Ga0496114_0003890
649 Ga0496114_0015415
650 Ga0496115_0000020
651 Ga0496115_0000034
652 Ga0496115_0000199
653 Ga0496115_0114512
654 Ga0501031_0088310
655 Ga0501031_0247638
656 Ga0501036_0057142
657 Ga0501036_0488270
658 Ga0501038_0082894
659 Ga0501038_0335634
660 Ga0501039_0028879
661 Ga0501039_0175166
662 Ga0501040_0064024
663 Ga0501040_0085592
664 Ga0501040_0095387
665 Ga0501041_0179969
666 Ga0501069_0185268
667 Ga0501071_0043682
668 Ga0501071_0193712
669 Ga0501072_0034749
670 Ga0501072_0045491
671 Ga0501072_0212616
672 Ga0501072_0242877
673 Ga0501074_0043611
674 Ga0501074_0426050
675 Ga0501075_0000711
676 Ga0501075_0141236
677 Ga0501075_0376318
678 Ga0501077_0122735
679 Ga0501077_0226147
680 Ga0501079_0111813
681 Ga0501079_0118646
682 Ga0501080_0026010
683 Ga0501081_0024332
684 Ga0501081_0024852
685 Ga0501044_0552158
686 nmdc:mga03n38_64636_c1
687 nmdc:mga00v17_97430_c1
688 nmdc:mga05p37_622955_c1
689 nmdc:mga09592_20187_c1
690 nmdc:mga0qj67_25472_c1
691 nmdc:mga0qj67_455739_c1
692 nmdc:mga06r32_103071_c1
693 nmdc:mga06r32_24785_c1
694 nmdc:mga06r32_302501_c1
695 nmdc:mga08y16_181106_c1
696 nmdc:mga0n895_11649_c1
697 nmdc:mga0rr50_271435_c1
698 nmdc:mga08x19_238146_c1
699 nmdc:mga0a205_45869_c1
700 nmdc:mga0a205_4_c1
701 Ga0495601_0000066
702 Ga0495601_0012696
703 Ga0495601_0106516
704 Ga0495601_0156871
705 Ga0495612_0014413
706 Ga0495612_0027047
707 Ga0495612_0042092
708 Ga0495655_0000011
709 Ga0495595_0000113
710 Ga0495619_0000001
711 Ga0500641_0011397
712 Ga0500614_001661
713 Ga0500628_000058
714 Ga0501082_0155137
715 Ga0501082_0156037
716 Ga0530510_0073002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

50

238

0.85

PF05368

NmrA

NmrA-like family

50

236

0.8

PF13460

NAD_binding_10

NAD(P)H-binding

54

191

0.79

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

51

177

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
8esw-assembly1.cif.gz_A9 structure of mitochondrial complex i from drosophila melanogaster, flexible-class 1 0.8595 1 297
7w35-assembly1.cif.gz_J deactive state ci from dq-nadh dataset, subclass 3 0.8581 1 297
7ak6-assembly1.cif.gz_P cryo-em structure of nd6-p25l mutant respiratory complex i from mus musculus at 3.8 a 0.8544 1 297
6zr2-assembly1.cif.gz_P cryo-em structure of respiratory complex i in the active state from mus musculus at 3.1 a 0.8523 2 297
7r47-assembly1.cif.gz_P bovine complex i in the presence of im1761092, deactive class iii (composite map) 0.8519 1 297
ID Description Score Start End Superfamily
af_A0A368UI72_22_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8993 1 58 3.40.50.720
af_P75822_3_266_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.899 1 264 3.40.50.720
af_Q9SK66_71_329_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8979 3 235 3.40.50.720
af_P75822_3_266_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8925 1 264 3.40.50.720
af_A0A1D6GEP1_267_439_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8923 2 108 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A850APN1-F1-model_v4 SDR family oxidoreductase 0.9636 2 301 GO:0004029
GO:0005737
GO:0016020
AF-A0A3L7PUM1-F1-model_v4 SDR family oxidoreductase 0.9633 2 294 GO:0016020
GO:0044877
GO:1901006
AF-A0A848Y2K2-F1-model_v4 NAD(P)H-binding protein 0.963 2 301 GO:0044877
GO:1901006
AF-A0A4Q3SIH7-F1-model_v4 deleted 0.9622 62 301
AF-A0A813D119-F1-model_v4 deleted 0.9608 2 295

Map