F421105

General Info

Members Datasets Scaffolds Average Seq Length
358 205 716 208

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100074984|Ga0070697_1000749842
Length 234
Sequence MNQSVALEAKDGSFELNPDANRLPYAVMSKQWRLAVATCLAAAAVGGGCSSTPSSRLHPTPPGLGLLPYSDADVEFMSGMIPHHAQAVIMAGWAPSHGARPDVAVLCERIVVGQRDEIATMQTWLGDRGLPVPDATSTRHKMTMNGTTHEMLMPGMLTDEEMAELDRARGPEFDRLFLLGMIKHHQGAIDMVDVLFKSYGAAQDETVFKFASDVYADQSTEISRMNEMLGNHRQ

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
141 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
142 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
143 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
144 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
145 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
155 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.7
Nodule 0
Rhizoplane 3.63
Rhizosphere 89.66
Stem 0
Stem Tuber 0
Unclassified 14.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100074984 3300005536 Bacteria 2780
2 Ga0065704_10297003 3300005289 Bacteria 892
3 Ga0065712_10001231 3300005290 Bacteria 9475
4 Ga0065707_10006222 3300005295 Bacteria 3389
5 Ga0065707_10168142 3300005295 Unclassified 1506
6 Ga0070683_100029734 3300005329 Bacteria 4951
7 Ga0070690_100248170 3300005330 Bacteria 1258
8 Ga0070670_100129141 3300005331 Unclassified 2181
9 Ga0070670_100161066 3300005331 Bacteria 1944
10 Ga0070670_100199304 3300005331 Bacteria 1739
11 Ga0070670_100433892 3300005331 Bacteria 1163
12 Ga0068869_100178039 3300005334 Bacteria 1666
13 Ga0068869_100190110 3300005334 Bacteria 1614
14 Ga0068869_100388159 3300005334 Bacteria 1146
15 Ga0070666_10058535 3300005335 Bacteria 2606
16 Ga0070666_10486567 3300005335 Bacteria 894
17 Ga0068868_100267785 3300005338 Bacteria 1443
18 Ga0068868_100316062 3300005338 Bacteria 1329
19 Ga0070660_100159171 3300005339 Bacteria 1819
20 Ga0070660_100298676 3300005339 Bacteria 1320
21 Ga0070689_100070300 3300005340 Bacteria 2733
22 Ga0070689_100135536 3300005340 Bacteria 1977
23 Ga0070691_10037817 3300005341 Bacteria 2278
24 Ga0070687_100044461 3300005343 Bacteria 2262
25 Ga0070661_100190028 3300005344 Unclassified 1566
26 Ga0070669_100010874 3300005353 Bacteria 6459
27 Ga0070669_100084751 3300005353 Bacteria 2365
28 Ga0070669_100298149 3300005353 Bacteria 1296
29 Ga0070675_100438079 3300005354 Unclassified 1171
30 Ga0070671_100309702 3300005355 Bacteria 1345
31 Ga0070674_100185894 3300005356 Bacteria 1595
32 Ga0070674_100487692 3300005356 Bacteria 1024
33 Ga0070673_100009151 3300005364 Bacteria 6636
34 Ga0070688_100128956 3300005365 Bacteria 1704
35 Ga0070688_100131005 3300005365 Bacteria 1692
36 Ga0070688_100188899 3300005365 Bacteria 1434
37 Ga0070659_100309520 3300005366 Bacteria 1319
38 Ga0070667_100014834 3300005367 Bacteria 6437
39 Ga0070667_100263558 3300005367 Bacteria 1544
40 Ga0070709_10210834 3300005434 Unclassified 1381
41 Ga0070701_10216732 3300005438 Bacteria 1139
42 Ga0070705_100135135 3300005440 Bacteria 1614
43 Ga0070700_100019079 3300005441 Bacteria 3953
44 Ga0070694_100003495 3300005444 Bacteria 9400
45 Ga0070678_100172544 3300005456 Bacteria 1763
46 Ga0070678_100779395 3300005456 Unclassified 867
47 Ga0070681_10034746 3300005458 Bacteria 5062
48 Ga0068867_100031933 3300005459 Unclassified 3805
49 Ga0068867_100057451 3300005459 Bacteria 2882
50 Ga0068867_100220273 3300005459 Bacteria 1529
51 Ga0070685_10173894 3300005466 Bacteria 1382
52 Ga0070706_100235338 3300005467 Bacteria 1710
53 Ga0070707_100200965 3300005468 Bacteria 1943
54 Ga0070707_101266332 3300005468 Bacteria 704
55 Ga0070698_100150045 3300005471 Bacteria 2279
56 Ga0070699_100638159 3300005518 Bacteria 972
57 Ga0070684_100003160 3300005535 Bacteria 12306
58 Ga0070672_100003070 3300005543 Bacteria 10768
59 Ga0070672_100006037 3300005543 Bacteria 8092
60 Ga0070672_100133552 3300005543 Bacteria 2042
61 Ga0070695_100072247 3300005545 Bacteria 2262
62 Ga0070695_100317129 3300005545 Bacteria 1157
63 Ga0070693_100003881 3300005547 Bacteria 7011
64 Ga0070665_100002994 3300005548 Bacteria 18235
65 Ga0070704_100065900 3300005549 Bacteria 2609
66 Ga0070704_100169903 3300005549 Unclassified 1733
67 Ga0070704_100333976 3300005549 Bacteria 1274
68 Ga0068855_100131267 3300005563 Bacteria 2861
69 Ga0070664_100066065 3300005564 Bacteria 3088
70 Ga0068857_100336467 3300005577 Bacteria 1396
71 Ga0068854_100008709 3300005578 Bacteria 6528
72 Ga0068856_100147118 3300005614 Bacteria 2363
73 Ga0068852_100581618 3300005616 Bacteria 1123
74 Ga0068859_100035464 3300005617 Bacteria 5005
75 Ga0068859_100255676 3300005617 Bacteria 1842
76 Ga0068864_100004841 3300005618 Bacteria 11031
77 Ga0068864_100330116 3300005618 Unclassified 1435
78 Ga0068864_100345390 3300005618 Bacteria 1403
79 Ga0068864_100352892 3300005618 Bacteria 1388
80 Ga0068864_101048560 3300005618 Unclassified 810
81 Ga0068866_10102981 3300005718 Bacteria 1578
82 Ga0068861_100219295 3300005719 Bacteria 1607
83 Ga0068861_100315507 3300005719 Bacteria 1360
84 Ga0068851_10031190 3300005834 Bacteria 2646
85 Ga0068863_100045139 3300005841 Bacteria 4182
86 Ga0068863_100045318 3300005841 Bacteria 4174
87 Ga0068863_100281853 3300005841 Bacteria 1610
88 Ga0068858_100022610 3300005842 Bacteria 5864
89 Ga0068858_100043725 3300005842 Bacteria 4153
90 Ga0068858_100083491 3300005842 Bacteria 2971
91 Ga0068858_100310837 3300005842 Unclassified 1505
92 Ga0068860_100038433 3300005843 Bacteria 4578
93 Ga0068862_100053453 3300005844 Bacteria 3458
94 Ga0068862_100468731 3300005844 Bacteria 1190
95 Ga0081455_10462645 3300005937 Unclassified 863
96 Ga0075365_10011119 3300006038 Bacteria 5280
97 Ga0075365_10051998 3300006038 Bacteria 2708
98 Ga0075363_100333618 3300006048 Bacteria 884
99 Ga0075364_10022425 3300006051 Bacteria 3987
100 Ga0075364_10042520 3300006051 Unclassified 2952
101 Ga0075364_10238052 3300006051 Bacteria 1236
102 Ga0075362_10000539 3300006177 Bacteria 11035
103 Ga0075369_10301146 3300006186 Bacteria 749
104 Ga0075369_10310644 3300006186 Bacteria 737
105 Ga0075366_10449260 3300006195 Bacteria 795
106 Ga0097621_100005426 3300006237 Bacteria 8990
107 Ga0075370_10070896 3300006353 Bacteria 1993
108 Ga0068871_100082369 3300006358 Unclassified 2668
109 Ga0068871_100779732 3300006358 Bacteria 880
110 Ga0075428_100625978 3300006844 Bacteria 1149
111 Ga0075428_101009248 3300006844 Bacteria 881
112 Ga0075431_101091302 3300006847 Bacteria 763
113 Ga0075433_10719793 3300006852 Bacteria 874
114 Ga0075434_100000329 3300006871 Bacteria 34114
115 Ga0075434_100059362 3300006871 Bacteria 3802
116 Ga0075434_100234230 3300006871 Bacteria 1856
117 Ga0075434_100241453 3300006871 Bacteria 1826
118 Ga0068865_100001714 3300006881 Bacteria 12862
119 Ga0068865_100124865 3300006881 Bacteria 1920
120 Ga0075436_100000648 3300006914 Bacteria 22906
121 Ga0075436_100015599 3300006914 Bacteria 5202
122 Ga0075436_100042892 3300006914 Bacteria 3119
123 Ga0075436_100128449 3300006914 Bacteria 1776
124 Ga0097620_100035464 3300006931 Bacteria 5005
125 Ga0097620_100255679 3300006931 Bacteria 1842
126 Ga0075435_100000043 3300007076 Bacteria 64194
127 Ga0075435_100003365 3300007076 Bacteria 10842
128 Ga0075435_100045980 3300007076 Bacteria 3500
129 Ga0075435_100087598 3300007076 Bacteria 2566
130 Ga0075435_100180576 3300007076 Bacteria 1783
131 Ga0075435_100542535 3300007076 Bacteria 1007
132 Ga0105240_10111742 3300009093 Bacteria 3304
133 Ga0105240_10184693 3300009093 Bacteria 2457
134 Ga0111539_10010813 3300009094 Bacteria 11489
135 Ga0111539_10032546 3300009094 Bacteria 6331
136 Ga0111539_10151383 3300009094 Bacteria 2715
137 Ga0111539_10205325 3300009094 Bacteria 2297
138 Ga0111539_10248576 3300009094 Bacteria 2071
139 Ga0111539_10366596 3300009094 Bacteria 1677
140 Ga0111539_10381080 3300009094 Bacteria 1642
141 Ga0111539_10518863 3300009094 Bacteria 1388
142 Ga0105245_11087781 3300009098 Unclassified 846
143 Ga0105247_10003326 3300009101 Bacteria 10531
144 Ga0105247_10026263 3300009101 Bacteria 3515
145 Ga0114129_10025481 3300009147 Bacteria 8381
146 Ga0114129_10093903 3300009147 Bacteria 4155
147 Ga0114129_10136229 3300009147 Bacteria 3369
148 Ga0114129_10150499 3300009147 Bacteria 3185
149 Ga0114129_10153352 3300009147 Bacteria 3152
150 Ga0114129_10296965 3300009147 Bacteria 2154
151 Ga0114129_10404747 3300009147 Bacteria 1798
152 Ga0105243_10419446 3300009148 Bacteria 1248
153 Ga0105242_10002034 3300009176 Bacteria 15919
154 Ga0105242_10591559 3300009176 Bacteria 1070
155 Ga0105248_10004398 3300009177 Bacteria 15595
156 Ga0105248_10009794 3300009177 Bacteria 10557
157 Ga0105248_10010555 3300009177 Bacteria 10177
158 Ga0105248_10367992 3300009177 Bacteria 1618
159 Ga0105248_10925578 3300009177 Unclassified 984
160 Ga0105238_10167602 3300009551 Bacteria 2172
161 Ga0105238_10526562 3300009551 Bacteria 1185
162 Ga0105249_10110048 3300009553 Bacteria 2603
163 Ga0105249_10537002 3300009553 Bacteria 1219
164 Ga0105239_10685553 3300010375 Bacteria 1171
165 Ga0157378_10111839 3300013297 Bacteria 2505
166 Ga0163162_11189070 3300013306 Unclassified 865
167 Ga0157375_10671636 3300013308 Bacteria 1191
168 Ga0163163_10003788 3300014325 Bacteria 12882
169 Ga0163163_10035451 3300014325 Bacteria 4840
170 Ga0163163_10070963 3300014325 Bacteria 3470
171 Ga0163163_11005711 3300014325 Bacteria 897
172 Ga0157380_10173438 3300014326 Bacteria 1887
173 Ga0157380_10517200 3300014326 Bacteria 1163
174 Ga0157380_11075314 3300014326 Bacteria 842
175 Ga0157377_10153900 3300014745 Unclassified 1424
176 Ga0157379_10029141 3300014968 Bacteria 4910
177 Ga0157379_10332463 3300014968 Bacteria 1388
178 Ga0157376_10011310 3300014969 Bacteria 6573
179 Ga0157376_10018430 3300014969 Bacteria 5352
180 Ga0207656_10069088 3300025321 Bacteria 1566
181 Ga0207710_10021468 3300025900 Bacteria 2767
182 Ga0207688_10216800 3300025901 Bacteria 1152
183 Ga0207688_10254893 3300025901 Unclassified 1064
184 Ga0207680_10251770 3300025903 Bacteria 1220
185 Ga0207680_10539856 3300025903 Bacteria 832
186 Ga0207699_10177999 3300025906 Unclassified 1428
187 Ga0207645_10003774 3300025907 Bacteria 11382
188 Ga0207643_10168863 3300025908 Bacteria 1319
189 Ga0207654_10267472 3300025911 Bacteria 1152
190 Ga0207695_10238210 3300025913 Bacteria 1722
191 Ga0207662_10007473 3300025918 Bacteria 5949
192 Ga0207649_10171993 3300025920 Unclassified 1510
193 Ga0207649_10255550 3300025920 Unclassified 1264
194 Ga0207652_10503518 3300025921 Bacteria 1090
195 Ga0207646_10174585 3300025922 Bacteria 1941
196 Ga0207681_10012417 3300025923 Bacteria 5258
197 Ga0207681_10518500 3300025923 Bacteria 978
198 Ga0207650_10085902 3300025925 Unclassified 2394
199 Ga0207650_10121077 3300025925 Bacteria 2037
200 Ga0207650_10207546 3300025925 Unclassified 1572
201 Ga0207659_10355904 3300025926 Unclassified 1216
202 Ga0207659_10540892 3300025926 Unclassified 989
203 Ga0207687_10331966 3300025927 Bacteria 1234
204 Ga0207644_10050795 3300025931 Bacteria 2973
205 Ga0207644_10297630 3300025931 Bacteria 1299
206 Ga0207690_10145470 3300025932 Bacteria 1752
207 Ga0207690_10330996 3300025932 Bacteria 1200
208 Ga0207706_10062385 3300025933 Bacteria 3282
209 Ga0207706_10637769 3300025933 Bacteria 913
210 Ga0207686_10014526 3300025934 Bacteria 4385
211 Ga0207686_10121556 3300025934 Bacteria 1778
212 Ga0207709_10064205 3300025935 Bacteria 2304
213 Ga0207670_10277296 3300025936 Bacteria 1305
214 Ga0207665_10053541 3300025939 Bacteria 2720
215 Ga0207691_10003479 3300025940 Bacteria 15330
216 Ga0207691_10005060 3300025940 Bacteria 12722
217 Ga0207711_10006938 3300025941 Bacteria 9507
218 Ga0207711_10015791 3300025941 Bacteria 6264
219 Ga0207711_10030379 3300025941 Bacteria 4557
220 Ga0207689_10076849 3300025942 Bacteria 2745
221 Ga0207667_10168731 3300025949 Bacteria 2250
222 Ga0207712_10074707 3300025961 Bacteria 2448
223 Ga0207668_10723492 3300025972 Bacteria 876
224 Ga0207658_10094569 3300025986 Bacteria 2326
225 Ga0207658_10196575 3300025986 Bacteria 1680
226 Ga0207703_10037402 3300026035 Unclassified 3866
227 Ga0207703_10508350 3300026035 Unclassified 1132
228 Ga0207703_11019500 3300026035 Bacteria 794
229 Ga0207708_10022761 3300026075 Bacteria 4732
230 Ga0207702_10185616 3300026078 Unclassified 1918
231 Ga0207641_10001693 3300026088 Bacteria 21452
232 Ga0207641_10193650 3300026088 Bacteria 1870
233 Ga0207648_10033812 3300026089 Unclassified 4508
234 Ga0207648_10562086 3300026089 Bacteria 1049
235 Ga0207676_10025059 3300026095 Bacteria 4423
236 Ga0207676_10114928 3300026095 Bacteria 2259
237 Ga0207674_10259233 3300026116 Bacteria 1686
238 Ga0207675_100090294 3300026118 Bacteria 2880
239 Ga0207675_100117394 3300026118 Bacteria 2516
240 Ga0207683_10757027 3300026121 Bacteria 901
241 Ga0209813_10123427 3300027866 Bacteria 904
242 Ga0207428_10077460 3300027907 Bacteria 2603
243 Ga0207428_10614529 3300027907 Bacteria 782
244 Ga0268265_10005638 3300028380 Bacteria 8554
245 Ga0268265_10204316 3300028380 Bacteria 1716
246 Ga0268265_10367779 3300028380 Bacteria 1319
247 Ga0268264_10035780 3300028381 Bacteria 4088
248 Ga0268264_10156057 3300028381 Bacteria 2051
249 Ga0307413_10185091 3300031824 Bacteria 1489
250 Ga0373958_0058623 3300034819 Bacteria 829
251 Ga0373959_0000822 3300034820 Bacteria 5308
252 Ga0373938_0005472 3300034957 Bacteria 2159
253 Ga0373928_0075006 3300035084 Bacteria 843
254 Ga0373929_0001479 3300035085 Bacteria 4474
255 Ga0373940_0000434 3300035088 Bacteria 6369
256 Ga0373949_0000491 3300035090 Bacteria 13446
257 Ga0373949_0056606 3300035090 Bacteria 1000
258 Ga0373951_0000442 3300035091 Bacteria 12077
259 Ga0373952_0009794 3300035092 Bacteria 1842
260 Ga0373952_0022515 3300035092 Bacteria 1339
261 Ga0373932_0001162 3300035112 Bacteria 7577
262 Ga0373939_0001421 3300035114 Bacteria 5814
263 Ga0373941_0017781 3300035115 Unclassified 1954
264 Ga0373941_0078252 3300035115 Unclassified 1112
265 Ga0373941_0154399 3300035115 Bacteria 844
266 Ga0373960_0000257 3300035121 Bacteria 10019
267 Ga0373943_0075726 3300035170 Bacteria 1715
268 Ga0373942_0067327 3300035207 Bacteria 1038
269 Ga0373961_0012050 3300035241 Bacteria 2157
270 Ga0373962_0001873 3300035242 Bacteria 5014
271 Ga0373962_0062034 3300035242 Bacteria 1100
272 Ga0373931_0003706 3300035691 Bacteria 6916
273 Ga0373935_0317515 3300035692 Unclassified 1105
274 Ga0373947_0170700 3300035725 Unclassified 1411
275 Ga0373925_0272059 3300037068 Unclassified 1363
276 Ga0395901_0597915 3300038443 Unclassified 1113
277 Ga0451576_0086444 3300045051 Bacteria 3261
278 Ga0466967_0028686 3300045976 Bacteria 4650
279 Ga0495629_0337173 3300046459 Bacteria 1030
280 Ga0495608_0447837 3300046511 Unclassified 786
281 Ga0495628_0447897 3300046516 Bacteria 938
282 Ga0495630_0372151 3300046517 Bacteria 1094
283 Ga0495630_0561930 3300046517 Bacteria 875
284 Ga0495640_0224456 3300046533 Bacteria 1184
285 Ga0495586_0146114 3300046535 Bacteria 1329
286 Ga0495621_0129435 3300046539 Bacteria 981
287 Ga0495645_0013451 3300046543 Bacteria 5786
288 Ga0495635_0450601 3300046663 Bacteria 851
289 Ga0495599_0084099 3300046678 Bacteria 1987
290 Ga0495658_0201118 3300046683 Unclassified 1242
291 Ga0495658_0353838 3300046683 Unclassified 933
292 Ga0495613_0097344 3300046689 Unclassified 2127
293 Ga0495600_0429594 3300046809 Unclassified 819
294 Ga0495674_0417150 3300047319 Bacteria 1082
295 Ga0495684_0133040 3300047471 Bacteria 1867
296 Ga0495684_0231251 3300047471 Bacteria 1352
297 Ga0496105_0745411 3300048908 Unclassified 748
298 Ga0496105_0883448 3300048908 Bacteria 675
299 Ga0496106_0434555 3300048909 Bacteria 1055
300 Ga0496108_0007335 3300048911 Bacteria 8937
301 Ga0496109_0102957 3300048912 Unclassified 2649
302 Ga0496109_0323896 3300048912 Bacteria 1455
303 Ga0496112_0043012 3300048915 Bacteria 4421
304 Ga0496112_0279838 3300048915 Unclassified 1616
305 Ga0496112_0668134 3300048915 Bacteria 968
306 Ga0496112_0704957 3300048915 Bacteria 937
307 Ga0496113_0026183 3300048916 Bacteria 4167
308 Ga0496113_0093517 3300048916 Bacteria 2321
309 Ga0496114_0752602 3300048917 Bacteria 852
310 Ga0501034_0034035 3300049571 Bacteria 5166
311 Ga0501047_0516122 3300049581 Bacteria 1021
312 Ga0501074_0078083 3300049590 Bacteria 2376
313 Ga0501083_0131379 3300049744 Bacteria 1642
314 nmdc:mga03683_17920_c1 3300050489 Unclassified 2686
315 nmdc:mga00v17_10855_c1 3300050491 Bacteria 4990
316 nmdc:mga00v17_122181_c1 3300050491 Bacteria 1237
317 nmdc:mga00v17_555559_c1 3300050491 Unclassified 742
318 nmdc:mga0yw44_111114_c1 3300050492 Unclassified 1756
319 nmdc:mga0yw44_11742_c1 3300050492 Bacteria 4538
320 nmdc:mga0yw44_256809_c1 3300050492 Bacteria 1164
321 nmdc:mga0k408_388545_c1 3300050493 Bacteria 831
322 nmdc:mga0k408_5299_c1 3300050493 Bacteria 6849
323 nmdc:mga06z11_67875_c1 3300050494 Bacteria 1878
324 nmdc:mga04h51_50312_c1 3300050495 Bacteria 1396
325 nmdc:mga05p37_107094_c1 3300050507 Bacteria 3439
326 nmdc:mga05p37_114955_c1 3300050507 Bacteria 3308
327 nmdc:mga05p37_215527_c1 3300050507 Bacteria 2319
328 nmdc:mga05p37_467688_c1 3300050507 Bacteria 1456
329 nmdc:mga05p37_506477_c1 3300050507 Unclassified 1384
330 nmdc:mga05p37_741590_c1 3300050507 Bacteria 1084
331 nmdc:mga09592_305770_c1 3300050508 Bacteria 1378
332 nmdc:mga09592_743606_c1 3300050508 Bacteria 832
333 nmdc:mga06r32_185629_c1 3300050510 Viruses 2066
334 nmdc:mga08y16_232902_c1 3300050511 Bacteria 1905
335 nmdc:mga08y16_310567_c1 3300050511 Bacteria 1624
336 nmdc:mga08y16_376431_c1 3300050511 Bacteria 1456
337 nmdc:mga08y16_42762_c1 3300050511 Bacteria 4745
338 nmdc:mga08y16_45165_c1 3300050511 Bacteria 4616
339 nmdc:mga08y16_768200_c1 3300050511 Bacteria 959
340 nmdc:mga0n895_217309_c1 3300050512 Bacteria 1941
341 nmdc:mga0n895_258985_c1 3300050512 Unclassified 1765
342 nmdc:mga0n895_37869_c1 3300050512 Bacteria 4669
343 nmdc:mga0n895_9_c1 3300050512 Bacteria 119566
344 nmdc:mga0rr50_218838_c1 3300050513 Bacteria 1572
345 nmdc:mga0rr50_3273_c1 3300050513 Bacteria 9292
346 nmdc:mga0rr50_439813_c1 3300050513 Bacteria 1104
347 nmdc:mga0rr50_46356_c1 3300050513 Bacteria 3200
348 nmdc:mga0rr50_62_c1 3300050513 Bacteria 64188
349 nmdc:mga08x19_107984_c1 3300050514 Bacteria 1853
350 nmdc:mga08x19_1129_c1 3300050514 Bacteria 16640
351 nmdc:mga08x19_18976_c1 3300050514 Bacteria 4217
352 nmdc:mga0a205_119584_c1 3300050515 Bacteria 2533
353 nmdc:mga0a205_154859_c1 3300050515 Unclassified 2190
354 nmdc:mga0a205_220442_c1 3300050515 Bacteria 1782
355 nmdc:mga0a205_248521_c1 3300050515 Bacteria 1659
356 nmdc:mga0a205_671382_c1 3300050515 Bacteria 887
357 Ga0495595_0234941 3300053084 Unclassified 916
358 Ga0500658_0083851 3300053134 Bacteria 1368
359 Ga0070697_100074984
360 Ga0065704_10297003
361 Ga0065712_10001231
362 Ga0065707_10006222
363 Ga0065707_10168142
364 Ga0070683_100029734
365 Ga0070690_100248170
366 Ga0070670_100129141
367 Ga0070670_100161066
368 Ga0070670_100199304
369 Ga0070670_100433892
370 Ga0068869_100178039
371 Ga0068869_100190110
372 Ga0068869_100388159
373 Ga0070666_10058535
374 Ga0070666_10486567
375 Ga0068868_100267785
376 Ga0068868_100316062
377 Ga0070660_100159171
378 Ga0070660_100298676
379 Ga0070689_100070300
380 Ga0070689_100135536
381 Ga0070691_10037817
382 Ga0070687_100044461
383 Ga0070661_100190028
384 Ga0070669_100010874
385 Ga0070669_100084751
386 Ga0070669_100298149
387 Ga0070675_100438079
388 Ga0070671_100309702
389 Ga0070674_100185894
390 Ga0070674_100487692
391 Ga0070673_100009151
392 Ga0070688_100128956
393 Ga0070688_100131005
394 Ga0070688_100188899
395 Ga0070659_100309520
396 Ga0070667_100014834
397 Ga0070667_100263558
398 Ga0070709_10210834
399 Ga0070701_10216732
400 Ga0070705_100135135
401 Ga0070700_100019079
402 Ga0070694_100003495
403 Ga0070678_100172544
404 Ga0070678_100779395
405 Ga0070681_10034746
406 Ga0068867_100031933
407 Ga0068867_100057451
408 Ga0068867_100220273
409 Ga0070685_10173894
410 Ga0070706_100235338
411 Ga0070707_100200965
412 Ga0070707_101266332
413 Ga0070698_100150045
414 Ga0070699_100638159
415 Ga0070684_100003160
416 Ga0070672_100003070
417 Ga0070672_100006037
418 Ga0070672_100133552
419 Ga0070695_100072247
420 Ga0070695_100317129
421 Ga0070693_100003881
422 Ga0070665_100002994
423 Ga0070704_100065900
424 Ga0070704_100169903
425 Ga0070704_100333976
426 Ga0068855_100131267
427 Ga0070664_100066065
428 Ga0068857_100336467
429 Ga0068854_100008709
430 Ga0068856_100147118
431 Ga0068852_100581618
432 Ga0068859_100035464
433 Ga0068859_100255676
434 Ga0068864_100004841
435 Ga0068864_100330116
436 Ga0068864_100345390
437 Ga0068864_100352892
438 Ga0068864_101048560
439 Ga0068866_10102981
440 Ga0068861_100219295
441 Ga0068861_100315507
442 Ga0068851_10031190
443 Ga0068863_100045139
444 Ga0068863_100045318
445 Ga0068863_100281853
446 Ga0068858_100022610
447 Ga0068858_100043725
448 Ga0068858_100083491
449 Ga0068858_100310837
450 Ga0068860_100038433
451 Ga0068862_100053453
452 Ga0068862_100468731
453 Ga0081455_10462645
454 Ga0075365_10011119
455 Ga0075365_10051998
456 Ga0075363_100333618
457 Ga0075364_10022425
458 Ga0075364_10042520
459 Ga0075364_10238052
460 Ga0075362_10000539
461 Ga0075369_10301146
462 Ga0075369_10310644
463 Ga0075366_10449260
464 Ga0097621_100005426
465 Ga0075370_10070896
466 Ga0068871_100082369
467 Ga0068871_100779732
468 Ga0075428_100625978
469 Ga0075428_101009248
470 Ga0075431_101091302
471 Ga0075433_10719793
472 Ga0075434_100000329
473 Ga0075434_100059362
474 Ga0075434_100234230
475 Ga0075434_100241453
476 Ga0068865_100001714
477 Ga0068865_100124865
478 Ga0075436_100000648
479 Ga0075436_100015599
480 Ga0075436_100042892
481 Ga0075436_100128449
482 Ga0097620_100035464
483 Ga0097620_100255679
484 Ga0075435_100000043
485 Ga0075435_100003365
486 Ga0075435_100045980
487 Ga0075435_100087598
488 Ga0075435_100180576
489 Ga0075435_100542535
490 Ga0105240_10111742
491 Ga0105240_10184693
492 Ga0111539_10010813
493 Ga0111539_10032546
494 Ga0111539_10151383
495 Ga0111539_10205325
496 Ga0111539_10248576
497 Ga0111539_10366596
498 Ga0111539_10381080
499 Ga0111539_10518863
500 Ga0105245_11087781
501 Ga0105247_10003326
502 Ga0105247_10026263
503 Ga0114129_10025481
504 Ga0114129_10093903
505 Ga0114129_10136229
506 Ga0114129_10150499
507 Ga0114129_10153352
508 Ga0114129_10296965
509 Ga0114129_10404747
510 Ga0105243_10419446
511 Ga0105242_10002034
512 Ga0105242_10591559
513 Ga0105248_10004398
514 Ga0105248_10009794
515 Ga0105248_10010555
516 Ga0105248_10367992
517 Ga0105248_10925578
518 Ga0105238_10167602
519 Ga0105238_10526562
520 Ga0105249_10110048
521 Ga0105249_10537002
522 Ga0105239_10685553
523 Ga0157378_10111839
524 Ga0163162_11189070
525 Ga0157375_10671636
526 Ga0163163_10003788
527 Ga0163163_10035451
528 Ga0163163_10070963
529 Ga0163163_11005711
530 Ga0157380_10173438
531 Ga0157380_10517200
532 Ga0157380_11075314
533 Ga0157377_10153900
534 Ga0157379_10029141
535 Ga0157379_10332463
536 Ga0157376_10011310
537 Ga0157376_10018430
538 Ga0207656_10069088
539 Ga0207710_10021468
540 Ga0207688_10216800
541 Ga0207688_10254893
542 Ga0207680_10251770
543 Ga0207680_10539856
544 Ga0207699_10177999
545 Ga0207645_10003774
546 Ga0207643_10168863
547 Ga0207654_10267472
548 Ga0207695_10238210
549 Ga0207662_10007473
550 Ga0207649_10171993
551 Ga0207649_10255550
552 Ga0207652_10503518
553 Ga0207646_10174585
554 Ga0207681_10012417
555 Ga0207681_10518500
556 Ga0207650_10085902
557 Ga0207650_10121077
558 Ga0207650_10207546
559 Ga0207659_10355904
560 Ga0207659_10540892
561 Ga0207687_10331966
562 Ga0207644_10050795
563 Ga0207644_10297630
564 Ga0207690_10145470
565 Ga0207690_10330996
566 Ga0207706_10062385
567 Ga0207706_10637769
568 Ga0207686_10014526
569 Ga0207686_10121556
570 Ga0207709_10064205
571 Ga0207670_10277296
572 Ga0207665_10053541
573 Ga0207691_10003479
574 Ga0207691_10005060
575 Ga0207711_10006938
576 Ga0207711_10015791
577 Ga0207711_10030379
578 Ga0207689_10076849
579 Ga0207667_10168731
580 Ga0207712_10074707
581 Ga0207668_10723492
582 Ga0207658_10094569
583 Ga0207658_10196575
584 Ga0207703_10037402
585 Ga0207703_10508350
586 Ga0207703_11019500
587 Ga0207708_10022761
588 Ga0207702_10185616
589 Ga0207641_10001693
590 Ga0207641_10193650
591 Ga0207648_10033812
592 Ga0207648_10562086
593 Ga0207676_10025059
594 Ga0207676_10114928
595 Ga0207674_10259233
596 Ga0207675_100090294
597 Ga0207675_100117394
598 Ga0207683_10757027
599 Ga0209813_10123427
600 Ga0207428_10077460
601 Ga0207428_10614529
602 Ga0268265_10005638
603 Ga0268265_10204316
604 Ga0268265_10367779
605 Ga0268264_10035780
606 Ga0268264_10156057
607 Ga0307413_10185091
608 Ga0373958_0058623
609 Ga0373959_0000822
610 Ga0373938_0005472
611 Ga0373928_0075006
612 Ga0373929_0001479
613 Ga0373940_0000434
614 Ga0373949_0000491
615 Ga0373949_0056606
616 Ga0373951_0000442
617 Ga0373952_0009794
618 Ga0373952_0022515
619 Ga0373932_0001162
620 Ga0373939_0001421
621 Ga0373941_0017781
622 Ga0373941_0078252
623 Ga0373941_0154399
624 Ga0373960_0000257
625 Ga0373943_0075726
626 Ga0373942_0067327
627 Ga0373961_0012050
628 Ga0373962_0001873
629 Ga0373962_0062034
630 Ga0373931_0003706
631 Ga0373935_0317515
632 Ga0373947_0170700
633 Ga0373925_0272059
634 Ga0395901_0597915
635 Ga0451576_0086444
636 Ga0466967_0028686
637 Ga0495629_0337173
638 Ga0495608_0447837
639 Ga0495628_0447897
640 Ga0495630_0372151
641 Ga0495630_0561930
642 Ga0495640_0224456
643 Ga0495586_0146114
644 Ga0495621_0129435
645 Ga0495645_0013451
646 Ga0495635_0450601
647 Ga0495599_0084099
648 Ga0495658_0201118
649 Ga0495658_0353838
650 Ga0495613_0097344
651 Ga0495600_0429594
652 Ga0495674_0417150
653 Ga0495684_0133040
654 Ga0495684_0231251
655 Ga0496105_0745411
656 Ga0496105_0883448
657 Ga0496106_0434555
658 Ga0496108_0007335
659 Ga0496109_0102957
660 Ga0496109_0323896
661 Ga0496112_0043012
662 Ga0496112_0279838
663 Ga0496112_0668134
664 Ga0496112_0704957
665 Ga0496113_0026183
666 Ga0496113_0093517
667 Ga0496114_0752602
668 Ga0501034_0034035
669 Ga0501047_0516122
670 Ga0501074_0078083
671 Ga0501083_0131379
672 nmdc:mga03683_17920_c1
673 nmdc:mga00v17_10855_c1
674 nmdc:mga00v17_122181_c1
675 nmdc:mga00v17_555559_c1
676 nmdc:mga0yw44_111114_c1
677 nmdc:mga0yw44_11742_c1
678 nmdc:mga0yw44_256809_c1
679 nmdc:mga0k408_388545_c1
680 nmdc:mga0k408_5299_c1
681 nmdc:mga06z11_67875_c1
682 nmdc:mga04h51_50312_c1
683 nmdc:mga05p37_107094_c1
684 nmdc:mga05p37_114955_c1
685 nmdc:mga05p37_215527_c1
686 nmdc:mga05p37_467688_c1
687 nmdc:mga05p37_506477_c1
688 nmdc:mga05p37_741590_c1
689 nmdc:mga09592_305770_c1
690 nmdc:mga09592_743606_c1
691 nmdc:mga06r32_185629_c1
692 nmdc:mga08y16_232902_c1
693 nmdc:mga08y16_310567_c1
694 nmdc:mga08y16_376431_c1
695 nmdc:mga08y16_42762_c1
696 nmdc:mga08y16_45165_c1
697 nmdc:mga08y16_768200_c1
698 nmdc:mga0n895_217309_c1
699 nmdc:mga0n895_258985_c1
700 nmdc:mga0n895_37869_c1
701 nmdc:mga0n895_9_c1
702 nmdc:mga0rr50_218838_c1
703 nmdc:mga0rr50_3273_c1
704 nmdc:mga0rr50_439813_c1
705 nmdc:mga0rr50_46356_c1
706 nmdc:mga0rr50_62_c1
707 nmdc:mga08x19_107984_c1
708 nmdc:mga08x19_1129_c1
709 nmdc:mga08x19_18976_c1
710 nmdc:mga0a205_119584_c1
711 nmdc:mga0a205_154859_c1
712 nmdc:mga0a205_220442_c1
713 nmdc:mga0a205_248521_c1
714 nmdc:mga0a205_671382_c1
715 Ga0495595_0234941
716 Ga0500658_0083851

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03713

DUF305

Domain of unknown function (DUF305)

73

229

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ffc-assembly2.cif.gz_B copm in the cu(ii)-bound form 0.9087 48 207
5fej-assembly4.cif.gz_D copm in the cu(i)-bound form 0.903 48 207
2qf9-assembly1.cif.gz_B crystal structure of putative secreted protein duf305 from streptomyces coelicolor 0.8964 47 209
3bt5-assembly1.cif.gz_A crystal structure of duf305 fragment from deinococcus radiodurans 0.894 44 206
2qf9-assembly1.cif.gz_A crystal structure of putative secreted protein duf305 from streptomyces coelicolor 0.8933 47 209
ID Description Score Start End Superfamily
5ffcB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9087 48 207 1.20.1260.10
5fejD00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.903 48 207 1.20.1260.10
3bt5A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.894 44 206 1.20.1260.10
5fejA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8906 48 207 1.20.1260.10
5ffcB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8767 48 207 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A358R328-F1-model_v4 DUF305 domain-containing protein 0.9929 132 207
AF-A0A7C7KK27-F1-model_v4 DUF305 domain-containing protein 0.9848 129 206
AF-A0A4P5WJ95-F1-model_v4 DUF305 domain-containing protein 0.9759 44 206
AF-A0A358R328-F1-model_v4 DUF305 domain-containing protein 0.9677 132 207
AF-A0A6J4MJL2-F1-model_v4 DUF305 domain-containing protein 0.963 129 209

Map