F421086

General Info

Members Datasets Scaffolds Average Seq Length
358 213 716 98

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10052563|Ga0070710_100525632
Length 106
Sequence MAMFFVVMRRSGPEWAPSRPIEQQSGWEEHAAFMDALVDEGFVVLGGPLADEHRVVLAVEAASAQAVRDTLARDPWDATHLVIDSIDAWTIRLDGRGARRSAGPAA

Samples

Sample ID Description Type Environment
1 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
57 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
117 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
118 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.51
Nodule 0
Rhizoplane 7.82
Rhizosphere 88.83
Stem 0
Stem Tuber 0
Unclassified 12.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070710_10052563 3300005437 Bacteria 2292
2 Ga0065704_10513325 3300005289 Unclassified 659
3 Ga0070658_10101305 3300005327 Bacteria 2381
4 Ga0068869_101775385 3300005334 Bacteria 551
5 Ga0070680_100019986 3300005336 Bacteria 5309
6 Ga0068868_100008890 3300005338 Bacteria 7200
7 Ga0068868_100859473 3300005338 Bacteria 822
8 Ga0070660_100041988 3300005339 Bacteria 3489
9 Ga0070660_100339940 3300005339 Bacteria 1235
10 Ga0070689_100409342 3300005340 Bacteria 1148
11 Ga0070689_100694597 3300005340 Bacteria 888
12 Ga0070691_10836507 3300005341 Bacteria 563
13 Ga0070687_100154003 3300005343 Bacteria 1352
14 Ga0070692_10436918 3300005345 Bacteria 834
15 Ga0070668_100609739 3300005347 Bacteria 956
16 Ga0070671_100737313 3300005355 Unclassified 856
17 Ga0070659_100008456 3300005366 Bacteria 7520
18 Ga0070659_100039397 3300005366 Bacteria 3689
19 Ga0070659_100926239 3300005366 Bacteria 762
20 Ga0070703_10111344 3300005406 Bacteria 980
21 Ga0070709_11092591 3300005434 Unclassified 638
22 Ga0070714_100139769 3300005435 Bacteria 2172
23 Ga0070714_100297752 3300005435 Unclassified 1503
24 Ga0070713_100751314 3300005436 Unclassified 933
25 Ga0070710_10620755 3300005437 Bacteria 755
26 Ga0070694_100059647 3300005444 Unclassified 2599
27 Ga0070678_100302511 3300005456 Bacteria 1359
28 Ga0070662_100163863 3300005457 Bacteria 1741
29 Ga0070681_10000019 3300005458 Bacteria 124774
30 Ga0070685_10121096 3300005466 Bacteria 1625
31 Ga0070699_100000003 3300005518 Bacteria 418047
32 Ga0070679_100002044 3300005530 Bacteria 18111
33 Ga0070684_100355974 3300005535 Bacteria 1347
34 Ga0070684_100376476 3300005535 Bacteria 1307
35 Ga0070697_100605420 3300005536 Bacteria 963
36 Ga0068853_101362602 3300005539 Bacteria 686
37 Ga0070672_100203991 3300005543 Bacteria 1654
38 Ga0070686_100096144 3300005544 Bacteria 1991
39 Ga0070695_101429608 3300005545 Bacteria 574
40 Ga0070695_101461256 3300005545 Bacteria 568
41 Ga0070696_100747293 3300005546 Bacteria 801
42 Ga0070664_101761738 3300005564 Unclassified 587
43 Ga0070702_100022415 3300005615 Bacteria 3339
44 Ga0068859_101002323 3300005617 Bacteria 917
45 Ga0068864_102153757 3300005618 Unclassified 564
46 Ga0068861_100028955 3300005719 Bacteria 4045
47 Ga0068870_10757875 3300005840 Bacteria 675
48 Ga0068860_100094283 3300005843 Bacteria 2853
49 Ga0070717_10255497 3300006028 Bacteria 1549
50 Ga0075365_10031622 3300006038 Bacteria 3396
51 Ga0075365_10051901 3300006038 Bacteria 2710
52 Ga0075368_10077589 3300006042 Bacteria 1349
53 Ga0075368_10376002 3300006042 Unclassified 621
54 Ga0070712_100424188 3300006175 Bacteria 1103
55 Ga0070712_101249025 3300006175 Bacteria 647
56 Ga0075366_10375296 3300006195 Bacteria 874
57 Ga0075428_100105789 3300006844 Bacteria 3068
58 Ga0075428_100726721 3300006844 Bacteria 1057
59 Ga0075428_101848197 3300006844 Bacteria 628
60 Ga0075430_100163774 3300006846 Bacteria 1851
61 Ga0075431_100536928 3300006847 Bacteria 1158
62 Ga0075434_100016948 3300006871 Bacteria 7009
63 Ga0075434_101534287 3300006871 Bacteria 675
64 Ga0075436_100129932 3300006914 Bacteria 1766
65 Ga0097620_101002619 3300006931 Bacteria 917
66 Ga0075435_100318188 3300007076 Bacteria 1332
67 Ga0111539_10047954 3300009094 Bacteria 5102
68 Ga0111539_10082291 3300009094 Bacteria 3786
69 Ga0111539_11378319 3300009094 Bacteria 818
70 Ga0111539_11613952 3300009094 Bacteria 752
71 Ga0114129_10591611 3300009147 Bacteria 1439
72 Ga0114129_10888310 3300009147 Bacteria 1130
73 Ga0114129_12257167 3300009147 Unclassified 654
74 Ga0114129_12576316 3300009147 Unclassified 607
75 Ga0114129_12861780 3300009147 Unclassified 572
76 Ga0105243_11505326 3300009148 Bacteria 697
77 Ga0105249_10004101 3300009553 Bacteria 12579
78 Ga0105249_10027097 3300009553 Bacteria 5169
79 Ga0105249_12690700 3300009553 Unclassified 569
80 Ga0099796_10307197 3300010159 Unclassified 674
81 Ga0157338_1083851 3300012515 Bacteria 520
82 Ga0157371_10084515 3300013102 Bacteria 2248
83 Ga0157369_12393519 3300013105 Bacteria 535
84 Ga0157378_10335303 3300013297 Bacteria 1473
85 Ga0163162_10082139 3300013306 Bacteria 3294
86 Ga0163162_10883687 3300013306 Bacteria 1008
87 Ga0157372_12053070 3300013307 Unclassified 657
88 Ga0157372_12210107 3300013307 Bacteria 632
89 Ga0157375_10526446 3300013308 Bacteria 1345
90 Ga0157375_11129077 3300013308 Bacteria 918
91 Ga0163163_10798383 3300014325 Bacteria 1007
92 Ga0157380_11781514 3300014326 Bacteria 675
93 Ga0157379_12406095 3300014968 Bacteria 526
94 Ga0157376_10097513 3300014969 Bacteria 2561
95 Ga0157376_11736544 3300014969 Unclassified 660
96 Ga0163161_10534837 3300017792 Bacteria 959
97 Ga0213874_10032157 3300021377 Bacteria 1522
98 Ga0207682_10257058 3300025893 Bacteria 814
99 Ga0207692_10294082 3300025898 Bacteria 986
100 Ga0207642_10412020 3300025899 Bacteria 811
101 Ga0207699_10730655 3300025906 Unclassified 726
102 Ga0207645_10060140 3300025907 Bacteria 2426
103 Ga0207643_10580223 3300025908 Bacteria 721
104 Ga0207705_10214305 3300025909 Bacteria 1461
105 Ga0207684_10085655 3300025910 Bacteria 2684
106 Ga0207707_10000046 3300025912 Bacteria 119404
107 Ga0207693_10253313 3300025915 Bacteria 1381
108 Ga0207693_10570646 3300025915 Bacteria 882
109 Ga0207660_10002144 3300025917 Bacteria 13097
110 Ga0207657_10031917 3300025919 Bacteria 4764
111 Ga0207657_10489810 3300025919 Bacteria 963
112 Ga0207652_10001128 3300025921 Bacteria 24033
113 Ga0207687_10183245 3300025927 Bacteria 1624
114 Ga0207700_10824579 3300025928 Unclassified 830
115 Ga0207664_10172764 3300025929 Bacteria 1851
116 Ga0207664_10363319 3300025929 Unclassified 1283
117 Ga0207690_10005392 3300025932 Bacteria 7535
118 Ga0207690_10041908 3300025932 Bacteria 3003
119 Ga0207706_10005235 3300025933 Bacteria 12103
120 Ga0207686_10316532 3300025934 Bacteria 1164
121 Ga0207686_10603475 3300025934 Bacteria 864
122 Ga0207691_10218467 3300025940 Bacteria 1653
123 Ga0207679_11166479 3300025945 Bacteria 707
124 Ga0207677_10003086 3300026023 Bacteria 8789
125 Ga0207708_10665683 3300026075 Bacteria 887
126 Ga0207675_100039332 3300026118 Bacteria 4414
127 Ga0207698_10887784 3300026142 Bacteria 898
128 Ga0209813_10152344 3300027866 Bacteria 829
129 Ga0207428_10096645 3300027907 Bacteria 2287
130 Ga0268264_10079146 3300028381 Bacteria 2804
131 Ga0268264_12467403 3300028381 Bacteria 525
132 Ga0307408_101199517 3300031548 Bacteria 708
133 Ga0307405_10115731 3300031731 Bacteria 1825
134 Ga0307412_12221966 3300031911 Bacteria 511
135 Ga0307409_100032560 3300031995 Bacteria 3782
136 Ga0307409_100117921 3300031995 Bacteria 2241
137 Ga0307416_100126541 3300032002 Bacteria 2290
138 Ga0307416_100190383 3300032002 Bacteria 1934
139 Ga0307415_100077960 3300032126 Bacteria 2355
140 Ga0373938_0046738 3300034957 Bacteria 978
141 Ga0373945_0177094 3300035116 Bacteria 876
142 Ga0373946_0303902 3300035171 Bacteria 789
143 Ga0373927_0305930 3300035695 Bacteria 1046
144 Ga0373947_0154158 3300035725 Bacteria 1481
145 Ga0373937_0359367 3300036401 Bacteria 1380
146 Ga0373937_1023258 3300036401 Bacteria 775
147 Ga0373937_1872761 3300036401 Bacteria 546
148 Ga0373925_0525074 3300037068 Bacteria 973
149 Ga0373925_0935163 3300037068 Bacteria 714
150 Ga0395898_0017038 3300037466 Bacteria 7421
151 Ga0395898_0465153 3300037466 Bacteria 1204
152 Ga0395905_0164070 3300037471 Bacteria 2088
153 Ga0395901_0021062 3300038443 Bacteria 6679
154 Ga0436365_0899590 3300039437 Unclassified 682
155 Ga0436363_0905731 3300039450 Bacteria 721
156 Ga0451800_1472712 3300041459 Bacteria 1277
157 Ga0466969_0452194 3300044656 Bacteria 584
158 Ga0466965_0451317 3300044683 Bacteria 716
159 Ga0466961_0117245 3300044693 Bacteria 1673
160 Ga0466964_0303235 3300044706 Bacteria 806
161 Ga0466968_0051876 3300044735 Bacteria 1754
162 Ga0466970_0298625 3300044765 Bacteria 908
163 Ga0466960_0066245 3300044901 Bacteria 1785
164 Ga0466960_1047973 3300044901 Unclassified 502
165 Ga0466967_0093814 3300045976 Bacteria 2732
166 Ga0466967_0206519 3300045976 Bacteria 1862
167 Ga0495603_0055150 3300046455 Bacteria 2355
168 Ga0495603_0164188 3300046455 Bacteria 1288
169 Ga0495603_0166846 3300046455 Bacteria 1276
170 Ga0495651_0270153 3300046462 Bacteria 1153
171 Ga0495653_0124665 3300046463 Bacteria 1831
172 Ga0495653_0413998 3300046463 Bacteria 854
173 Ga0495582_0047556 3300046473 Unclassified 2363
174 Ga0495582_0238540 3300046473 Bacteria 1042
175 Ga0495582_0460074 3300046473 Unclassified 735
176 Ga0495664_0626665 3300046477 Bacteria 638
177 Ga0495584_0023754 3300046491 Bacteria 3108
178 Ga0495584_0079544 3300046491 Bacteria 1649
179 Ga0495594_0025587 3300046499 Bacteria 3172
180 Ga0495608_0477477 3300046511 Bacteria 757
181 Ga0495618_0071250 3300046514 Bacteria 2211
182 Ga0495618_0247571 3300046514 Bacteria 1119
183 Ga0495630_0283119 3300046517 Bacteria 1267
184 Ga0495630_0305408 3300046517 Bacteria 1216
185 Ga0495630_0367425 3300046517 Bacteria 1102
186 Ga0495587_0334732 3300046536 Unclassified 845
187 Ga0495587_0403361 3300046536 Bacteria 760
188 Ga0495645_0216927 3300046543 Unclassified 1289
189 Ga0495667_0280133 3300046559 Bacteria 1058
190 Ga0495635_0091762 3300046663 Bacteria 2077
191 Ga0495635_0156349 3300046663 Bacteria 1552
192 Ga0495635_0306782 3300046663 Bacteria 1064
193 Ga0495635_0934235 3300046663 Bacteria 554
194 Ga0495659_0027014 3300046664 Bacteria 1977
195 Ga0495659_0400287 3300046664 Bacteria 592
196 Ga0495657_0215187 3300046675 Bacteria 1167
197 Ga0495646_0571089 3300046680 Bacteria 576
198 Ga0495658_0021837 3300046683 Unclassified 3379
199 Ga0495658_0307730 3300046683 Bacteria 1003
200 Ga0495600_0375475 3300046809 Unclassified 888
201 Ga0495600_0451439 3300046809 Bacteria 795
202 Ga0495660_0228677 3300046810 Bacteria 873
203 Ga0495581_0368420 3300047315 Bacteria 839
204 Ga0495604_0044272 3300047317 Bacteria 3479
205 Ga0495674_0587545 3300047319 Bacteria 883
206 Ga0495674_0875224 3300047319 Unclassified 695
207 Ga0495674_1354906 3300047319 Bacteria 532
208 Ga0495676_0114421 3300047321 Bacteria 1974
209 Ga0495676_0183299 3300047321 Bacteria 1466
210 Ga0495680_0058332 3300047322 Bacteria 2983
211 Ga0495680_0136525 3300047322 Unclassified 1798
212 Ga0495593_0457705 3300047673 Bacteria 639
213 Ga0495602_0785191 3300048088 Bacteria 641
214 Ga0495614_0516348 3300048089 Bacteria 569
215 Ga0496101_0052268 3300048904 Unclassified 2946
216 Ga0496105_0266914 3300048908 Bacteria 1383
217 Ga0496105_0336801 3300048908 Unclassified 1207
218 Ga0496105_0894051 3300048908 Bacteria 670
219 Ga0496106_0053905 3300048909 Bacteria 3038
220 Ga0496106_0191216 3300048909 Bacteria 1627
221 Ga0496106_0246818 3300048909 Bacteria 1427
222 Ga0496107_0060313 3300048910 Bacteria 2746
223 Ga0496107_0443834 3300048910 Unclassified 964
224 Ga0496108_0042439 3300048911 Bacteria 3797
225 Ga0496109_0070941 3300048912 Bacteria 3198
226 Ga0496109_0111937 3300048912 Unclassified 2538
227 Ga0496109_0699623 3300048912 Bacteria 951
228 Ga0496109_0740294 3300048912 Bacteria 921
229 Ga0496109_0832326 3300048912 Unclassified 861
230 Ga0496109_0907854 3300048912 Bacteria 819
231 Ga0496110_0144406 3300048913 Unclassified 2152
232 Ga0496110_0258128 3300048913 Bacteria 1586
233 Ga0496110_0547348 3300048913 Unclassified 1052
234 Ga0496111_0568977 3300048914 Bacteria 831
235 Ga0496111_0763065 3300048914 Unclassified 701
236 Ga0496112_0011041 3300048915 Bacteria 8231
237 Ga0496112_0714490 3300048915 Unclassified 930
238 Ga0496112_0872537 3300048915 Unclassified 823
239 Ga0496113_0172406 3300048916 Bacteria 1714
240 Ga0496114_0832329 3300048917 Bacteria 802
241 Ga0496115_0265533 3300048918 Unclassified 1411
242 Ga0501031_0003728 3300049568 Bacteria 9810
243 Ga0501031_0007828 3300049568 Bacteria 6955
244 Ga0501032_0005989 3300049569 Bacteria 8970
245 Ga0501032_0046543 3300049569 Bacteria 2932
246 Ga0501032_0144215 3300049569 Bacteria 1568
247 Ga0501033_0023025 3300049570 Bacteria 4695
248 Ga0501033_0033589 3300049570 Bacteria 3852
249 Ga0501034_0009517 3300049571 Bacteria 10171
250 Ga0501036_0017794 3300049572 Bacteria 5950
251 Ga0501036_0018582 3300049572 Bacteria 5827
252 Ga0501036_0056372 3300049572 Bacteria 3329
253 Ga0501037_0059286 3300049573 Bacteria 2792
254 Ga0501037_0072583 3300049573 Bacteria 2503
255 Ga0501038_0018998 3300049574 Bacteria 6202
256 Ga0501038_0022410 3300049574 Bacteria 5661
257 Ga0501038_0130704 3300049574 Bacteria 2062
258 Ga0501039_0003035 3300049575 Bacteria 12560
259 Ga0501039_0017558 3300049575 Bacteria 5489
260 Ga0501039_0032235 3300049575 Bacteria 4039
261 Ga0501040_0002236 3300049576 Bacteria 12469
262 Ga0501040_0037235 3300049576 Bacteria 3304
263 Ga0501040_0232652 3300049576 Bacteria 1312
264 Ga0501041_0001742 3300049577 Bacteria 12214
265 Ga0501041_0003157 3300049577 Bacteria 9478
266 Ga0501041_0023835 3300049577 Bacteria 3671
267 Ga0501042_0000951 3300049578 Bacteria 16334
268 Ga0501042_0001351 3300049578 Bacteria 14363
269 Ga0501042_0022396 3300049578 Bacteria 4414
270 Ga0501043_0021182 3300049579 Bacteria 5096
271 Ga0501043_0149807 3300049579 Bacteria 1826
272 Ga0501043_0237956 3300049579 Bacteria 1405
273 Ga0501046_0003275 3300049580 Bacteria 14866
274 Ga0501046_0051083 3300049580 Bacteria 3264
275 Ga0501046_0113961 3300049580 Bacteria 2063
276 Ga0501047_0153572 3300049581 Bacteria 2176
277 Ga0501048_0003674 3300049582 Bacteria 11693
278 Ga0501048_0005330 3300049582 Bacteria 9786
279 Ga0501048_0058100 3300049582 Bacteria 2742
280 Ga0501067_0028718 3300049583 Bacteria 3082
281 Ga0501067_0245220 3300049583 Bacteria 997
282 Ga0501068_0028104 3300049584 Bacteria 3323
283 Ga0501068_0178019 3300049584 Bacteria 1344
284 Ga0501068_0683606 3300049584 Bacteria 671
285 Ga0501069_0001284 3300049585 Bacteria 12301
286 Ga0501070_0027878 3300049586 Bacteria 4737
287 Ga0501070_0502769 3300049586 Bacteria 974
288 Ga0501071_0010639 3300049587 Bacteria 6171
289 Ga0501071_0015958 3300049587 Bacteria 5160
290 Ga0501071_0051024 3300049587 Bacteria 2980
291 Ga0501072_0002116 3300049588 Bacteria 14790
292 Ga0501072_0017642 3300049588 Bacteria 5489
293 Ga0501072_0017836 3300049588 Bacteria 5458
294 Ga0501072_0314858 3300049588 Bacteria 1244
295 Ga0501073_0040196 3300049589 Bacteria 3311
296 Ga0501074_0019949 3300049590 Bacteria 4870
297 Ga0501074_0041401 3300049590 Bacteria 3335
298 Ga0501074_0059747 3300049590 Bacteria 2746
299 Ga0501075_0011372 3300049591 Bacteria 6300
300 Ga0501075_0015387 3300049591 Bacteria 5489
301 Ga0501075_0016716 3300049591 Bacteria 5291
302 Ga0501075_0363393 3300049591 Bacteria 1103
303 Ga0501076_0002607 3300049592 Bacteria 12408
304 Ga0501076_0004344 3300049592 Bacteria 10060
305 Ga0501076_0025932 3300049592 Bacteria 4538
306 Ga0501077_0011625 3300049593 Bacteria 5501
307 Ga0501077_0012460 3300049593 Bacteria 5323
308 Ga0501079_0004557 3300049741 Bacteria 10274
309 Ga0501079_0101812 3300049741 Bacteria 2227
310 Ga0501079_0160607 3300049741 Bacteria 1752
311 Ga0501080_0033276 3300049742 Bacteria 4810
312 Ga0501080_0103743 3300049742 Bacteria 2637
313 Ga0501080_0533435 3300049742 Bacteria 1046
314 Ga0501081_0002582 3300049743 Bacteria 11444
315 Ga0501081_0067651 3300049743 Bacteria 2486
316 Ga0501083_0034646 3300049744 Bacteria 3451
317 Ga0501083_0110841 3300049744 Bacteria 1805
318 Ga0501083_0204589 3300049744 Bacteria 1287
319 Ga0501035_0069810 3300049822 Bacteria 3113
320 Ga0501035_0099029 3300049822 Bacteria 2559
321 Ga0501044_0012156 3300049823 Bacteria 9321
322 Ga0501044_0905039 3300049823 Bacteria 757
323 Ga0501045_0004007 3300049824 Bacteria 10141
324 Ga0501045_0009171 3300049824 Bacteria 6913
325 Ga0501045_0046958 3300049824 Bacteria 3144
326 nmdc:mga0yw44_361258_c1 3300050492 Bacteria 979
327 nmdc:mga0yw44_65373_c1 3300050492 Bacteria 2241
328 nmdc:mga04h51_177338_c1 3300050495 Bacteria 828
329 nmdc:mga05p37_53561_c1 3300050507 Bacteria 4962
330 nmdc:mga09592_446931_c1 3300050508 Bacteria 1115
331 nmdc:mga0qj67_372800_c1 3300050509 Bacteria 1153
332 nmdc:mga06r32_1705048_c1 3300050510 Unclassified 567
333 nmdc:mga06r32_826802_c1 3300050510 Bacteria 886
334 nmdc:mga08y16_1452524_c1 3300050511 Bacteria 647
335 nmdc:mga08y16_597140_c1 3300050511 Bacteria 1113
336 nmdc:mga08y16_90257_c1 3300050511 Bacteria 3194
337 nmdc:mga08y16_996486_c1 3300050511 Bacteria 818
338 nmdc:mga0n895_39024_c1 3300050512 Bacteria 4604
339 nmdc:mga0rr50_1405151_c1 3300050513 Bacteria 591
340 nmdc:mga0rr50_207143_c1 3300050513 Bacteria 1614
341 nmdc:mga08x19_46104_c1 3300050514 Unclassified 2787
342 nmdc:mga08x19_677122_c1 3300050514 Unclassified 732
343 Ga0495601_0058938 3300053077 Bacteria 2434
344 Ga0495601_0199482 3300053077 Bacteria 1308
345 Ga0495595_0047819 3300053084 Bacteria 1974
346 Ga0495595_0070465 3300053084 Bacteria 1652
347 Ga0495595_0305028 3300053084 Unclassified 801
348 Ga0495619_0014773 3300053085 Bacteria 4933
349 Ga0495619_0133275 3300053085 Bacteria 1708
350 Ga0501084_0011533 3300054114 Bacteria 7317
351 Ga0501084_0019424 3300054114 Bacteria 5661
352 Ga0501082_0006606 3300060353 Bacteria 10036
353 Ga0501082_0021021 3300060353 Bacteria 5629
354 Ga0501082_0034753 3300060353 Bacteria 4345
355 Ga0501082_0522407 3300060353 Bacteria 1038
356 Ga0530510_0006534 3300061734 Bacteria 8123
357 Ga0530510_0016608 3300061734 Bacteria 5211
358 Ga0530510_0064609 3300061734 Bacteria 2650
359 Ga0070710_10052563
360 Ga0065704_10513325
361 Ga0070658_10101305
362 Ga0068869_101775385
363 Ga0070680_100019986
364 Ga0068868_100008890
365 Ga0068868_100859473
366 Ga0070660_100041988
367 Ga0070660_100339940
368 Ga0070689_100409342
369 Ga0070689_100694597
370 Ga0070691_10836507
371 Ga0070687_100154003
372 Ga0070692_10436918
373 Ga0070668_100609739
374 Ga0070671_100737313
375 Ga0070659_100008456
376 Ga0070659_100039397
377 Ga0070659_100926239
378 Ga0070703_10111344
379 Ga0070709_11092591
380 Ga0070714_100139769
381 Ga0070714_100297752
382 Ga0070713_100751314
383 Ga0070710_10620755
384 Ga0070694_100059647
385 Ga0070678_100302511
386 Ga0070662_100163863
387 Ga0070681_10000019
388 Ga0070685_10121096
389 Ga0070699_100000003
390 Ga0070679_100002044
391 Ga0070684_100355974
392 Ga0070684_100376476
393 Ga0070697_100605420
394 Ga0068853_101362602
395 Ga0070672_100203991
396 Ga0070686_100096144
397 Ga0070695_101429608
398 Ga0070695_101461256
399 Ga0070696_100747293
400 Ga0070664_101761738
401 Ga0070702_100022415
402 Ga0068859_101002323
403 Ga0068864_102153757
404 Ga0068861_100028955
405 Ga0068870_10757875
406 Ga0068860_100094283
407 Ga0070717_10255497
408 Ga0075365_10031622
409 Ga0075365_10051901
410 Ga0075368_10077589
411 Ga0075368_10376002
412 Ga0070712_100424188
413 Ga0070712_101249025
414 Ga0075366_10375296
415 Ga0075428_100105789
416 Ga0075428_100726721
417 Ga0075428_101848197
418 Ga0075430_100163774
419 Ga0075431_100536928
420 Ga0075434_100016948
421 Ga0075434_101534287
422 Ga0075436_100129932
423 Ga0097620_101002619
424 Ga0075435_100318188
425 Ga0111539_10047954
426 Ga0111539_10082291
427 Ga0111539_11378319
428 Ga0111539_11613952
429 Ga0114129_10591611
430 Ga0114129_10888310
431 Ga0114129_12257167
432 Ga0114129_12576316
433 Ga0114129_12861780
434 Ga0105243_11505326
435 Ga0105249_10004101
436 Ga0105249_10027097
437 Ga0105249_12690700
438 Ga0099796_10307197
439 Ga0157338_1083851
440 Ga0157371_10084515
441 Ga0157369_12393519
442 Ga0157378_10335303
443 Ga0163162_10082139
444 Ga0163162_10883687
445 Ga0157372_12053070
446 Ga0157372_12210107
447 Ga0157375_10526446
448 Ga0157375_11129077
449 Ga0163163_10798383
450 Ga0157380_11781514
451 Ga0157379_12406095
452 Ga0157376_10097513
453 Ga0157376_11736544
454 Ga0163161_10534837
455 Ga0213874_10032157
456 Ga0207682_10257058
457 Ga0207692_10294082
458 Ga0207642_10412020
459 Ga0207699_10730655
460 Ga0207645_10060140
461 Ga0207643_10580223
462 Ga0207705_10214305
463 Ga0207684_10085655
464 Ga0207707_10000046
465 Ga0207693_10253313
466 Ga0207693_10570646
467 Ga0207660_10002144
468 Ga0207657_10031917
469 Ga0207657_10489810
470 Ga0207652_10001128
471 Ga0207687_10183245
472 Ga0207700_10824579
473 Ga0207664_10172764
474 Ga0207664_10363319
475 Ga0207690_10005392
476 Ga0207690_10041908
477 Ga0207706_10005235
478 Ga0207686_10316532
479 Ga0207686_10603475
480 Ga0207691_10218467
481 Ga0207679_11166479
482 Ga0207677_10003086
483 Ga0207708_10665683
484 Ga0207675_100039332
485 Ga0207698_10887784
486 Ga0209813_10152344
487 Ga0207428_10096645
488 Ga0268264_10079146
489 Ga0268264_12467403
490 Ga0307408_101199517
491 Ga0307405_10115731
492 Ga0307412_12221966
493 Ga0307409_100032560
494 Ga0307409_100117921
495 Ga0307416_100126541
496 Ga0307416_100190383
497 Ga0307415_100077960
498 Ga0373938_0046738
499 Ga0373945_0177094
500 Ga0373946_0303902
501 Ga0373927_0305930
502 Ga0373947_0154158
503 Ga0373937_0359367
504 Ga0373937_1023258
505 Ga0373937_1872761
506 Ga0373925_0525074
507 Ga0373925_0935163
508 Ga0395898_0017038
509 Ga0395898_0465153
510 Ga0395905_0164070
511 Ga0395901_0021062
512 Ga0436365_0899590
513 Ga0436363_0905731
514 Ga0451800_1472712
515 Ga0466969_0452194
516 Ga0466965_0451317
517 Ga0466961_0117245
518 Ga0466964_0303235
519 Ga0466968_0051876
520 Ga0466970_0298625
521 Ga0466960_0066245
522 Ga0466960_1047973
523 Ga0466967_0093814
524 Ga0466967_0206519
525 Ga0495603_0055150
526 Ga0495603_0164188
527 Ga0495603_0166846
528 Ga0495651_0270153
529 Ga0495653_0124665
530 Ga0495653_0413998
531 Ga0495582_0047556
532 Ga0495582_0238540
533 Ga0495582_0460074
534 Ga0495664_0626665
535 Ga0495584_0023754
536 Ga0495584_0079544
537 Ga0495594_0025587
538 Ga0495608_0477477
539 Ga0495618_0071250
540 Ga0495618_0247571
541 Ga0495630_0283119
542 Ga0495630_0305408
543 Ga0495630_0367425
544 Ga0495587_0334732
545 Ga0495587_0403361
546 Ga0495645_0216927
547 Ga0495667_0280133
548 Ga0495635_0091762
549 Ga0495635_0156349
550 Ga0495635_0306782
551 Ga0495635_0934235
552 Ga0495659_0027014
553 Ga0495659_0400287
554 Ga0495657_0215187
555 Ga0495646_0571089
556 Ga0495658_0021837
557 Ga0495658_0307730
558 Ga0495600_0375475
559 Ga0495600_0451439
560 Ga0495660_0228677
561 Ga0495581_0368420
562 Ga0495604_0044272
563 Ga0495674_0587545
564 Ga0495674_0875224
565 Ga0495674_1354906
566 Ga0495676_0114421
567 Ga0495676_0183299
568 Ga0495680_0058332
569 Ga0495680_0136525
570 Ga0495593_0457705
571 Ga0495602_0785191
572 Ga0495614_0516348
573 Ga0496101_0052268
574 Ga0496105_0266914
575 Ga0496105_0336801
576 Ga0496105_0894051
577 Ga0496106_0053905
578 Ga0496106_0191216
579 Ga0496106_0246818
580 Ga0496107_0060313
581 Ga0496107_0443834
582 Ga0496108_0042439
583 Ga0496109_0070941
584 Ga0496109_0111937
585 Ga0496109_0699623
586 Ga0496109_0740294
587 Ga0496109_0832326
588 Ga0496109_0907854
589 Ga0496110_0144406
590 Ga0496110_0258128
591 Ga0496110_0547348
592 Ga0496111_0568977
593 Ga0496111_0763065
594 Ga0496112_0011041
595 Ga0496112_0714490
596 Ga0496112_0872537
597 Ga0496113_0172406
598 Ga0496114_0832329
599 Ga0496115_0265533
600 Ga0501031_0003728
601 Ga0501031_0007828
602 Ga0501032_0005989
603 Ga0501032_0046543
604 Ga0501032_0144215
605 Ga0501033_0023025
606 Ga0501033_0033589
607 Ga0501034_0009517
608 Ga0501036_0017794
609 Ga0501036_0018582
610 Ga0501036_0056372
611 Ga0501037_0059286
612 Ga0501037_0072583
613 Ga0501038_0018998
614 Ga0501038_0022410
615 Ga0501038_0130704
616 Ga0501039_0003035
617 Ga0501039_0017558
618 Ga0501039_0032235
619 Ga0501040_0002236
620 Ga0501040_0037235
621 Ga0501040_0232652
622 Ga0501041_0001742
623 Ga0501041_0003157
624 Ga0501041_0023835
625 Ga0501042_0000951
626 Ga0501042_0001351
627 Ga0501042_0022396
628 Ga0501043_0021182
629 Ga0501043_0149807
630 Ga0501043_0237956
631 Ga0501046_0003275
632 Ga0501046_0051083
633 Ga0501046_0113961
634 Ga0501047_0153572
635 Ga0501048_0003674
636 Ga0501048_0005330
637 Ga0501048_0058100
638 Ga0501067_0028718
639 Ga0501067_0245220
640 Ga0501068_0028104
641 Ga0501068_0178019
642 Ga0501068_0683606
643 Ga0501069_0001284
644 Ga0501070_0027878
645 Ga0501070_0502769
646 Ga0501071_0010639
647 Ga0501071_0015958
648 Ga0501071_0051024
649 Ga0501072_0002116
650 Ga0501072_0017642
651 Ga0501072_0017836
652 Ga0501072_0314858
653 Ga0501073_0040196
654 Ga0501074_0019949
655 Ga0501074_0041401
656 Ga0501074_0059747
657 Ga0501075_0011372
658 Ga0501075_0015387
659 Ga0501075_0016716
660 Ga0501075_0363393
661 Ga0501076_0002607
662 Ga0501076_0004344
663 Ga0501076_0025932
664 Ga0501077_0011625
665 Ga0501077_0012460
666 Ga0501079_0004557
667 Ga0501079_0101812
668 Ga0501079_0160607
669 Ga0501080_0033276
670 Ga0501080_0103743
671 Ga0501080_0533435
672 Ga0501081_0002582
673 Ga0501081_0067651
674 Ga0501083_0034646
675 Ga0501083_0110841
676 Ga0501083_0204589
677 Ga0501035_0069810
678 Ga0501035_0099029
679 Ga0501044_0012156
680 Ga0501044_0905039
681 Ga0501045_0004007
682 Ga0501045_0009171
683 Ga0501045_0046958
684 nmdc:mga0yw44_361258_c1
685 nmdc:mga0yw44_65373_c1
686 nmdc:mga04h51_177338_c1
687 nmdc:mga05p37_53561_c1
688 nmdc:mga09592_446931_c1
689 nmdc:mga0qj67_372800_c1
690 nmdc:mga06r32_1705048_c1
691 nmdc:mga06r32_826802_c1
692 nmdc:mga08y16_1452524_c1
693 nmdc:mga08y16_597140_c1
694 nmdc:mga08y16_90257_c1
695 nmdc:mga08y16_996486_c1
696 nmdc:mga0n895_39024_c1
697 nmdc:mga0rr50_1405151_c1
698 nmdc:mga0rr50_207143_c1
699 nmdc:mga08x19_46104_c1
700 nmdc:mga08x19_677122_c1
701 Ga0495601_0058938
702 Ga0495601_0199482
703 Ga0495595_0047819
704 Ga0495595_0070465
705 Ga0495595_0305028
706 Ga0495619_0014773
707 Ga0495619_0133275
708 Ga0501084_0011533
709 Ga0501084_0019424
710 Ga0501082_0006606
711 Ga0501082_0021021
712 Ga0501082_0034753
713 Ga0501082_0522407
714 Ga0530510_0006534
715 Ga0530510_0016608
716 Ga0530510_0064609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7966 4 93
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.792 4 99
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.7726 4 96
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.7685 4 99
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.7645 4 96
ID Description Score Start End Superfamily
af_Q5A784_25_117_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7642 1 92 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7539 4 96 3.30.70.1060
af_Q5A784_25_117_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7499 1 92 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7324 4 96 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7307 5 99 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A538H914-F1-model_v4 YCII-related domain-containing protein 0.9681 2 72
AF-A0A853DAX6-F1-model_v4 Uncharacterized protein YciI 0.9552 1 96
AF-A0A2V7A2E9-F1-model_v4 YCII-related domain-containing protein 0.9547 1 96
AF-A0A1M3I7Z0-F1-model_v4 ABM domain-containing protein 0.9503 1 96
AF-A0A3A0DMF1-F1-model_v4 Tail specific protease domain-containing protein 0.9492 2 92 GO:0004175
GO:0006508
GO:0007165
GO:0008236
GO:0030288

Map