F421077

General Info

Members Datasets Scaffolds Average Seq Length
358 134 358 231

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100011784|Ga0070671_1000117842
Length 256
Sequence LSSSGYDKSHIVVGHIERNIRCVITPDDSQIYRDLMRLRPEGLSPNAWAVKAGVSRTVWTDMRKHGNPSRRTLEKLLSAAGSSLLEFEALRVGPAQSADANPAGRLGDHRAIWNPRTLAPLPLIASSLGGEWGDPGSKVELTEIRRGELLDRVHRPPSLAGDAEAFAMTIVGRGMWPRFRTGARIAVSPRSPVGIGDDVLVRLRSPANAAGERTLIMQLVNRTATTFELRQFSPDKTIEVATANIESISKIVGELI

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
107 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
108 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
109 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
110 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
122 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
123 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
124 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.23
Rhizosphere 96.93
Stem 0
Stem Tuber 0
Unclassified 0.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002932 3300001904 Bacteria 2989
2 JGI24741J21665_1002204 3300001915 Bacteria 5172
3 JGI24740J21852_10001036 3300001979 Bacteria 12464
4 JGI24740J21852_10012070 3300001979 Bacteria 3265
5 JGI24739J22299_10000368 3300001989 Bacteria 15458
6 JGI24739J22299_10003704 3300001989 Bacteria 5831
7 JGI24737J22298_10017597 3300001990 Bacteria 2300
8 JGI24737J22298_10038005 3300001990 Bacteria 1482
9 JGI24743J22301_10002727 3300001991 Bacteria 2705
10 JGI24735J21928_10005613 3300002067 Bacteria 4153
11 JGI24735J21928_10028757 3300002067 Bacteria 1658
12 JGI24738J21930_10003346 3300002075 Bacteria 4063
13 rootH2_10280869 3300003320 Bacteria 1164
14 rootL2_10379766 3300003322 Bacteria 1558
15 rootH1_10121128 3300003323 Bacteria 1162
16 Ga0070658_10007983 3300005327 Bacteria 8514
17 Ga0070658_10010920 3300005327 Bacteria 7280
18 Ga0070658_10074527 3300005327 Bacteria 2783
19 Ga0070658_10141022 3300005327 Bacteria 2013
20 Ga0070658_10147003 3300005327 Bacteria 1971
21 Ga0070658_10186014 3300005327 Bacteria 1749
22 Ga0070658_10193369 3300005327 Bacteria 1715
23 Ga0070658_10577597 3300005327 Bacteria 973
24 Ga0070676_10028885 3300005328 Bacteria 3151
25 Ga0070683_100048629 3300005329 Bacteria 3921
26 Ga0070683_100137574 3300005329 Bacteria 2314
27 Ga0070683_100291620 3300005329 Bacteria 1552
28 Ga0070683_100378575 3300005329 Bacteria 1349
29 Ga0070690_100251291 3300005330 Bacteria 1251
30 Ga0070670_100010837 3300005331 Bacteria 7787
31 Ga0070670_100019299 3300005331 Bacteria 5850
32 Ga0070677_10105115 3300005333 Bacteria 1252
33 Ga0070666_10060295 3300005335 Bacteria 2567
34 Ga0070680_100003447 3300005336 Bacteria 11800
35 Ga0070680_100036245 3300005336 Bacteria 3984
36 Ga0070680_100137195 3300005336 Bacteria 2050
37 Ga0070682_100019770 3300005337 Bacteria 3954
38 Ga0070682_100040383 3300005337 Bacteria 2871
39 Ga0070660_100001729 3300005339 Bacteria 14976
40 Ga0070660_100028527 3300005339 Bacteria 4177
41 Ga0070660_100049799 3300005339 Bacteria 3222
42 Ga0070660_100263284 3300005339 Bacteria 1408
43 Ga0070660_100492242 3300005339 Bacteria 1020
44 Ga0070661_100013271 3300005344 Bacteria 5783
45 Ga0070661_100052940 3300005344 Bacteria 2970
46 Ga0070692_10017675 3300005345 Bacteria 3415
47 Ga0070692_10029957 3300005345 Bacteria 2717
48 Ga0070692_10030164 3300005345 Bacteria 2710
49 Ga0070692_10070800 3300005345 Bacteria 1857
50 Ga0070692_10182297 3300005345 Bacteria 1218
51 Ga0070668_100065784 3300005347 Bacteria 2812
52 Ga0070668_100284274 3300005347 Bacteria 1383
53 Ga0070669_100036619 3300005353 Bacteria 3556
54 Ga0070669_100521704 3300005353 Bacteria 988
55 Ga0070671_100011784 3300005355 Bacteria 7033
56 Ga0070671_100027792 3300005355 Bacteria 4657
57 Ga0070671_100379150 3300005355 Bacteria 1208
58 Ga0070673_100006565 3300005364 Bacteria 7569
59 Ga0070673_100636027 3300005364 Bacteria 975
60 Ga0070659_100003637 3300005366 Bacteria 10982
61 Ga0070659_100020465 3300005366 Bacteria 5026
62 Ga0070659_100049820 3300005366 Bacteria 3294
63 Ga0070659_100076989 3300005366 Bacteria 2660
64 Ga0070659_100295244 3300005366 Unclassified 1350
65 Ga0070667_100007592 3300005367 Bacteria 8992
66 Ga0070667_100039158 3300005367 Bacteria 3973
67 Ga0070667_100262522 3300005367 Bacteria 1547
68 Ga0070714_100059351 3300005435 Bacteria 3280
69 Ga0070714_100202413 3300005435 Bacteria 1817
70 Ga0070714_100371403 3300005435 Bacteria 1347
71 Ga0070694_100157230 3300005444 Bacteria 1665
72 Ga0070663_100005658 3300005455 Bacteria 7444
73 Ga0070663_100063451 3300005455 Bacteria 2668
74 Ga0070663_100145922 3300005455 Bacteria 1810
75 Ga0070663_100597249 3300005455 Unclassified 928
76 Ga0070663_100682681 3300005455 Bacteria 871
77 Ga0070662_100001998 3300005457 Bacteria 12506
78 Ga0070662_100006784 3300005457 Bacteria 7403
79 Ga0070662_100031798 3300005457 Bacteria 3706
80 Ga0070706_100104241 3300005467 Bacteria 2638
81 Ga0070679_100237864 3300005530 Bacteria 1779
82 Ga0070684_100011954 3300005535 Bacteria 6935
83 Ga0070684_100023155 3300005535 Bacteria 5189
84 Ga0070684_100037590 3300005535 Bacteria 4154
85 Ga0070684_100662859 3300005535 Bacteria 972
86 Ga0068853_100033603 3300005539 Bacteria 4352
87 Ga0068853_100113665 3300005539 Bacteria 2407
88 Ga0068853_100307242 3300005539 Bacteria 1467
89 Ga0068853_100446083 3300005539 Bacteria 1217
90 Ga0070672_100020387 3300005543 Bacteria 4834
91 Ga0070695_100026761 3300005545 Bacteria 3570
92 Ga0070696_100125142 3300005546 Bacteria 1864
93 Ga0070696_100660248 3300005546 Bacteria 849
94 Ga0070693_100198072 3300005547 Bacteria 1303
95 Ga0070665_100014696 3300005548 Bacteria 7854
96 Ga0070665_100198360 3300005548 Bacteria 2008
97 Ga0068855_100044337 3300005563 Bacteria 5263
98 Ga0068855_100149942 3300005563 Bacteria 2652
99 Ga0068855_100244666 3300005563 Bacteria 2003
100 Ga0068855_100630398 3300005563 Bacteria 1153
101 Ga0068855_100740713 3300005563 Bacteria 1049
102 Ga0068855_100993802 3300005563 Bacteria 882
103 Ga0070664_100008490 3300005564 Bacteria 8306
104 Ga0070664_100014169 3300005564 Bacteria 6503
105 Ga0070664_100018805 3300005564 Bacteria 5681
106 Ga0070664_100025682 3300005564 Bacteria 4885
107 Ga0070664_100131968 3300005564 Bacteria 2195
108 Ga0068857_100010191 3300005577 Bacteria 8170
109 Ga0068857_100035200 3300005577 Bacteria 4433
110 Ga0068857_100099212 3300005577 Bacteria 2612
111 Ga0068857_100145608 3300005577 Bacteria 2144
112 Ga0068854_100004380 3300005578 Bacteria 8905
113 Ga0068854_100045610 3300005578 Bacteria 3118
114 Ga0068854_100198783 3300005578 Bacteria 1575
115 Ga0068856_100441075 3300005614 Bacteria 1323
116 Ga0068856_100592661 3300005614 Bacteria 1130
117 Ga0068852_100025308 3300005616 Bacteria 4807
118 Ga0068852_100075906 3300005616 Bacteria 2966
119 Ga0068852_100207854 3300005616 Bacteria 1855
120 Ga0068852_100311468 3300005616 Bacteria 1526
121 Ga0068864_100058843 3300005618 Bacteria 3323
122 Ga0068864_100087632 3300005618 Bacteria 2741
123 Ga0068864_100294082 3300005618 Bacteria 1519
124 Ga0068851_10001992 3300005834 Bacteria 8993
125 Ga0068851_10195812 3300005834 Unclassified 1126
126 Ga0068860_100071146 3300005843 Bacteria 3306
127 Ga0068862_100038877 3300005844 Bacteria 4038
128 Ga0068862_100146546 3300005844 Bacteria 2098
129 Ga0068862_100449496 3300005844 Bacteria 1215
130 Ga0068862_100632366 3300005844 Bacteria 1031
131 Ga0075428_100509988 3300006844 Bacteria 1287
132 Ga0105240_10078816 3300009093 Bacteria 4055
133 Ga0111539_10112916 3300009094 Bacteria 3187
134 Ga0111539_10573890 3300009094 Bacteria 1314
135 Ga0105243_10858408 3300009148 Bacteria 899
136 Ga0105241_10531106 3300009174 Unclassified 1053
137 Ga0105248_11275087 3300009177 Bacteria 831
138 Ga0105238_10090939 3300009551 Bacteria 3040
139 Ga0105249_10031098 3300009553 Bacteria 4826
140 Ga0105239_10885053 3300010375 Unclassified 1025
141 Ga0105239_10976249 3300010375 Bacteria 974
142 Ga0157373_10096944 3300013100 Bacteria 2076
143 Ga0157373_10345102 3300013100 Bacteria 1061
144 Ga0157371_10008051 3300013102 Bacteria 8433
145 Ga0157371_10012357 3300013102 Bacteria 6531
146 Ga0157371_10022902 3300013102 Bacteria 4569
147 Ga0157371_10133907 3300013102 Bacteria 1764
148 Ga0157370_10084841 3300013104 Bacteria 2976
149 Ga0157370_10093513 3300013104 Bacteria 2821
150 Ga0157370_10263886 3300013104 Bacteria 1591
151 Ga0157370_10573325 3300013104 Bacteria 1034
152 Ga0157370_10816182 3300013104 Bacteria 848
153 Ga0157369_10018697 3300013105 Bacteria 7769
154 Ga0157369_10112317 3300013105 Bacteria 2895
155 Ga0157369_10136897 3300013105 Bacteria 2592
156 Ga0157369_10258268 3300013105 Bacteria 1817
157 Ga0157369_10365229 3300013105 Bacteria 1498
158 Ga0157374_10477512 3300013296 Bacteria 1250
159 Ga0157372_10026204 3300013307 Bacteria 6344
160 Ga0157372_10053729 3300013307 Bacteria 4491
161 Ga0157372_10071538 3300013307 Bacteria 3906
162 Ga0157372_10143244 3300013307 Bacteria 2756
163 Ga0157372_10282038 3300013307 Bacteria 1931
164 Ga0206354_10215577 3300020081 Bacteria 2645
165 Ga0206353_11342449 3300020082 Bacteria 2500
166 Ga0207697_10002366 3300025315 Bacteria 9823
167 Ga0207647_10008838 3300025904 Bacteria 7188
168 Ga0207647_10057040 3300025904 Bacteria 2395
169 Ga0207705_10000003 3300025909 Bacteria 709270
170 Ga0207705_10000704 3300025909 Bacteria 27609
171 Ga0207705_10011762 3300025909 Bacteria 6323
172 Ga0207705_10026662 3300025909 Bacteria 4119
173 Ga0207705_10033959 3300025909 Bacteria 3646
174 Ga0207705_10043291 3300025909 Bacteria 3234
175 Ga0207705_10082989 3300025909 Bacteria 2338
176 Ga0207705_10135390 3300025909 Bacteria 1836
177 Ga0207705_10534155 3300025909 Bacteria 911
178 Ga0207707_10115349 3300025912 Bacteria 2347
179 Ga0207695_10004524 3300025913 Bacteria 18922
180 Ga0207660_10006750 3300025917 Bacteria 7432
181 Ga0207660_10146487 3300025917 Bacteria 1810
182 Ga0207657_10001743 3300025919 Bacteria 23446
183 Ga0207657_10003125 3300025919 Bacteria 17705
184 Ga0207657_10010886 3300025919 Bacteria 9051
185 Ga0207657_10021222 3300025919 Bacteria 6118
186 Ga0207657_10043585 3300025919 Bacteria 3950
187 Ga0207657_10069784 3300025919 Bacteria 2980
188 Ga0207657_10204050 3300025919 Bacteria 1589
189 Ga0207649_10001179 3300025920 Bacteria 15748
190 Ga0207649_10066856 3300025920 Bacteria 2280
191 Ga0207649_10138633 3300025920 Bacteria 1661
192 Ga0207649_10192567 3300025920 Bacteria 1435
193 Ga0207649_10379889 3300025920 Unclassified 1053
194 Ga0207652_10087331 3300025921 Bacteria 2735
195 Ga0207652_10153965 3300025921 Bacteria 2059
196 Ga0207681_10020849 3300025923 Bacteria 4159
197 Ga0207694_10040138 3300025924 Bacteria 3603
198 Ga0207650_10007222 3300025925 Bacteria 7570
199 Ga0207650_10052393 3300025925 Bacteria 3023
200 Ga0207644_10008908 3300025931 Bacteria 6573
201 Ga0207690_10002388 3300025932 Bacteria 11368
202 Ga0207690_10008020 3300025932 Bacteria 6269
203 Ga0207690_10019578 3300025932 Bacteria 4171
204 Ga0207690_10027189 3300025932 Bacteria 3613
205 Ga0207690_10037939 3300025932 Bacteria 3132
206 Ga0207690_10053893 3300025932 Bacteria 2701
207 Ga0207690_10242855 3300025932 Bacteria 1388
208 Ga0207690_10299270 3300025932 Bacteria 1258
209 Ga0207690_10566753 3300025932 Bacteria 924
210 Ga0207690_10571213 3300025932 Bacteria 921
211 Ga0207706_10001681 3300025933 Bacteria 21822
212 Ga0207706_10002348 3300025933 Bacteria 18484
213 Ga0207706_10012370 3300025933 Bacteria 7774
214 Ga0207706_10013574 3300025933 Bacteria 7401
215 Ga0207706_10315101 3300025933 Bacteria 1362
216 Ga0207706_10390020 3300025933 Bacteria 1208
217 Ga0207691_10010358 3300025940 Bacteria 8942
218 Ga0207711_10012998 3300025941 Bacteria 6915
219 Ga0207711_10236746 3300025941 Bacteria 1673
220 Ga0207661_10005358 3300025944 Bacteria 9034
221 Ga0207661_10047304 3300025944 Bacteria 3414
222 Ga0207661_10047578 3300025944 Bacteria 3406
223 Ga0207661_10344307 3300025944 Bacteria 1344
224 Ga0207661_10698031 3300025944 Bacteria 933
225 Ga0207679_10073068 3300025945 Bacteria 2593
226 Ga0207679_10090620 3300025945 Bacteria 2364
227 Ga0207679_10111522 3300025945 Bacteria 2160
228 Ga0207679_10121009 3300025945 Bacteria 2084
229 Ga0207679_10155215 3300025945 Bacteria 1868
230 Ga0207667_10098759 3300025949 Bacteria 3012
231 Ga0207667_10374333 3300025949 Bacteria 1451
232 Ga0207667_10508869 3300025949 Bacteria 1221
233 Ga0207651_10008872 3300025960 Bacteria 5460
234 Ga0207651_10116686 3300025960 Bacteria 2015
235 Ga0207651_10398955 3300025960 Bacteria 1169
236 Ga0207658_10034829 3300025986 Bacteria 3601
237 Ga0207639_10089835 3300026041 Bacteria 2456
238 Ga0207639_10160594 3300026041 Bacteria 1893
239 Ga0207678_10002012 3300026067 Bacteria 18467
240 Ga0207678_10006050 3300026067 Bacteria 10763
241 Ga0207678_10086776 3300026067 Bacteria 2674
242 Ga0207702_10033024 3300026078 Bacteria 4320
243 Ga0207674_10005155 3300026116 Bacteria 15575
244 Ga0207674_10008541 3300026116 Bacteria 11814
245 Ga0207674_10010102 3300026116 Bacteria 10731
246 Ga0207674_10577055 3300026116 Bacteria 1086
247 Ga0207683_10501043 3300026121 Bacteria 1122
248 Ga0207698_10001376 3300026142 Bacteria 14155
249 Ga0207698_10039063 3300026142 Bacteria 3513
250 Ga0268266_10258065 3300028379 Bacteria 1614
251 Ga0268265_10044816 3300028380 Bacteria 3296
252 Ga0268265_10071645 3300028380 Bacteria 2700
253 Ga0307416_100644138 3300032002 Bacteria 1144
254 Ga0395899_0000258 3300037312 Bacteria 69644
255 Ga0395899_0006620 3300037312 Bacteria 8979
256 Ga0395899_0008496 3300037312 Bacteria 7909
257 Ga0395899_0014585 3300037312 Bacteria 5999
258 Ga0395899_0082869 3300037312 Bacteria 2332
259 Ga0395899_0108229 3300037312 Bacteria 2000
260 Ga0395899_0177610 3300037312 Bacteria 1496
261 Ga0395899_0185054 3300037312 Bacteria 1460
262 Ga0395899_0204114 3300037312 Bacteria 1376
263 Ga0395899_0248445 3300037312 Bacteria 1221
264 Ga0395899_0301725 3300037312 Bacteria 1083
265 Ga0395900_0000254 3300037418 Bacteria 83296
266 Ga0395900_0004026 3300037418 Bacteria 15685
267 Ga0395900_0013902 3300037418 Bacteria 8213
268 Ga0395900_0022984 3300037418 Bacteria 6380
269 Ga0395900_0051497 3300037418 Bacteria 4240
270 Ga0395900_0078174 3300037418 Bacteria 3399
271 Ga0395900_0168170 3300037418 Bacteria 2233
272 Ga0395900_0227686 3300037418 Bacteria 1876
273 Ga0395900_0282431 3300037418 Bacteria 1651
274 Ga0395900_0348599 3300037418 Bacteria 1454
275 Ga0395900_0358769 3300037418 Bacteria 1429
276 Ga0395900_0482213 3300037418 Bacteria 1192
277 Ga0395900_0615254 3300037418 Bacteria 1025
278 Ga0395898_0021797 3300037466 Bacteria 6492
279 Ga0395898_0033107 3300037466 Bacteria 5159
280 Ga0395898_0038749 3300037466 Bacteria 4721
281 Ga0395898_0051043 3300037466 Bacteria 4045
282 Ga0395898_0052406 3300037466 Bacteria 3986
283 Ga0395898_0053067 3300037466 Bacteria 3959
284 Ga0395898_0068085 3300037466 Bacteria 3445
285 Ga0395898_0173876 3300037466 Bacteria 2058
286 Ga0395898_0219809 3300037466 Bacteria 1812
287 Ga0395898_0244969 3300037466 Bacteria 1709
288 Ga0395898_0304417 3300037466 Bacteria 1520
289 Ga0395898_0559916 3300037466 Unclassified 1085
290 Ga0395898_0704625 3300037466 Bacteria 951
291 Ga0395905_0023371 3300037471 Bacteria 5842
292 Ga0395905_0042983 3300037471 Bacteria 4239
293 Ga0395905_0068580 3300037471 Bacteria 3321
294 Ga0395905_0106220 3300037471 Bacteria 2636
295 Ga0395905_0112743 3300037471 Bacteria 2554
296 Ga0395905_0119267 3300037471 Bacteria 2479
297 Ga0395905_0131409 3300037471 Bacteria 2354
298 Ga0395905_0278208 3300037471 Bacteria 1559
299 Ga0395905_0317799 3300037471 Bacteria 1446
300 Ga0395905_0331691 3300037471 Bacteria 1412
301 Ga0395905_0401776 3300037471 Bacteria 1265
302 Ga0395905_0450107 3300037471 Bacteria 1185
303 Ga0395905_0987580 3300037471 Unclassified 745
304 Ga0395901_0000030 3300038443 Bacteria 241916
305 Ga0395901_0034590 3300038443 Bacteria 5218
306 Ga0395901_0050504 3300038443 Bacteria 4320
307 Ga0395901_0052975 3300038443 Bacteria 4216
308 Ga0395901_0067767 3300038443 Bacteria 3717
309 Ga0395901_0074921 3300038443 Bacteria 3530
310 Ga0395901_0108126 3300038443 Bacteria 2919
311 Ga0395901_0111825 3300038443 Bacteria 2868
312 Ga0395901_0126948 3300038443 Bacteria 2680
313 Ga0395901_0323059 3300038443 Bacteria 1596
314 Ga0395901_0503276 3300038443 Bacteria 1233
315 Ga0395901_0664565 3300038443 Bacteria 1043
316 Ga0450917_002033 3300042120 Bacteria 1439
317 Ga0450903_015508 3300042138 Bacteria 1200
318 Ga0450905_000759 3300042142 Bacteria 3961
319 Ga0439458_0042920 3300042157 Bacteria 1102
320 Ga0439464_0115350 3300042439 Unclassified 824
321 Ga0466969_0048030 3300044656 Bacteria 2111
322 Ga0466966_0018426 3300044684 Bacteria 4605
323 Ga0466961_0010293 3300044693 Bacteria 5960
324 Ga0466961_0215147 3300044693 Bacteria 1185
325 Ga0466963_0005775 3300044694 Bacteria 7279
326 Ga0466971_0019790 3300044719 Bacteria 2990
327 Ga0466971_0058513 3300044719 Bacteria 1739
328 Ga0466970_0006042 3300044765 Bacteria 6037
329 Ga0466957_0001548 3300044842 Bacteria 12099
330 Ga0466957_0003546 3300044842 Bacteria 8595
331 Ga0466957_0172071 3300044842 Bacteria 1411
332 Ga0466959_0172752 3300045049 Bacteria 1515
333 Ga0466958_0000867 3300045836 Bacteria 13493
334 Ga0466958_0023590 3300045836 Bacteria 3613
335 Ga0466967_0033365 3300045976 Bacteria 4357
336 Ga0466967_0035347 3300045976 Bacteria 4252
337 Ga0466967_0039121 3300045976 Bacteria 4074
338 Ga0466967_0043147 3300045976 Bacteria 3903
339 Ga0466967_0351006 3300045976 Bacteria 1428
340 Ga0466967_0366192 3300045976 Bacteria 1397
341 Ga0466967_0374411 3300045976 Bacteria 1382
342 Ga0495642_0043786 3300046528 Bacteria 1826
343 Ga0495621_0001731 3300046539 Bacteria 5720
344 Ga0495621_0005252 3300046539 Bacteria 3709
345 Ga0495670_0008427 3300046691 Bacteria 5069
346 Ga0495670_0025132 3300046691 Bacteria 2946
347 Ga0495677_0011591 3300047445 Bacteria 3223
348 Ga0496100_0726350 3300048903 Bacteria 776
349 Ga0496101_0979339 3300048904 Unclassified 665
350 Ga0496107_0121307 3300048910 Bacteria 1926
351 Ga0496108_0032424 3300048911 Bacteria 4339
352 Ga0496110_0242083 3300048913 Bacteria 1641
353 Ga0496111_0088135 3300048914 Bacteria 2272
354 Ga0496112_0104434 3300048915 Bacteria 2803
355 Ga0496113_0465765 3300048916 Bacteria 1015
356 nmdc:mga09592_78727_c1 3300050508 Bacteria 2805
357 Ga0466962_0003328 3300061719 Bacteria 7636
358 Ga0466962_0074695 3300061719 Bacteria 1620

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0301725 Ga0395899_0301725_16_567 181
2 3300037418 Ga0395900_0348599 Ga0395900_0348599_16_567 181
3 3300038443 Ga0395901_0111825 Ga0395901_0111825_16_567 181
4 3300037418 Ga0395900_0615254 Ga0395900_0615254_399_977 192
5 3300038443 Ga0395901_0664565 Ga0395901_0664565_417_995 192
6 3300048914 Ga0496111_0088135 Ga0496111_0088135_1670_2260 195
7 3300025933 Ga0207706_10390020 Ga0207706_103900201 200
8 3300037471 Ga0395905_0987580 Ga0395905_0987580_46_714 205
9 3300005327 Ga0070658_10577597 Ga0070658_105775971 206
10 3300005435 Ga0070714_100059351 Ga0070714_1000593513 206
11 3300009093 Ga0105240_10078816 Ga0105240_100788165 206
12 3300042439 Ga0439464_0115350 Ga0439464_0115350_41_664 207
13 3300048903 Ga0496100_0726350 Ga0496100_0726350_118_741 207
14 3300048904 Ga0496101_0979339 Ga0496101_0979339_19_642 207
15 3300045976 Ga0466967_0366192 Ga0466967_0366192_474_1175 213
16 3300003322 rootL2_10379766 rootL2_103797661 214
17 3300005333 Ga0070677_10105115 Ga0070677_101051152 214
18 3300005844 Ga0068862_100632366 Ga0068862_1006323662 214
19 3300037312 Ga0395899_0006620 Ga0395899_0006620_362_1015 215
20 3300037466 Ga0395898_0052406 Ga0395898_0052406_2502_3155 215
21 3300037466 Ga0395898_0068085 Ga0395898_0068085_870_1523 215
22 3300038443 Ga0395901_0108126 Ga0395901_0108126_1650_2303 215
23 3300038443 Ga0395901_0126948 Ga0395901_0126948_1700_2353 215
24 3300025919 Ga0207657_10204050 Ga0207657_102040502 217
25 3300025932 Ga0207690_10571213 Ga0207690_105712132 217
26 3300005336 Ga0070680_100003447 Ga0070680_1000034477 218
27 3300013100 Ga0157373_10345102 Ga0157373_103451023 218
28 3300013104 Ga0157370_10263886 Ga0157370_102638862 218
29 3300025917 Ga0207660_10006750 Ga0207660_100067502 218
30 3300005344 Ga0070661_100013271 Ga0070661_1000132713 219
31 3300005616 Ga0068852_100075906 Ga0068852_1000759062 219
32 3300009551 Ga0105238_10090939 Ga0105238_100909392 219
33 3300013102 Ga0157371_10133907 Ga0157371_101339073 219
34 3300013104 Ga0157370_10816182 Ga0157370_108161821 219
35 3300025909 Ga0207705_10000003 Ga0207705_10000003500 219
36 3300025909 Ga0207705_10000704 Ga0207705_1000070421 219
37 3300025913 Ga0207695_10004524 Ga0207695_100045242 219
38 3300025920 Ga0207649_10001179 Ga0207649_1000117912 219
39 3300025924 Ga0207694_10040138 Ga0207694_100401384 219
40 3300025949 Ga0207667_10098759 Ga0207667_100987592 219
41 3300037312 Ga0395899_0014585 Ga0395899_0014585_3959_4666 219
42 3300037418 Ga0395900_0227686 Ga0395900_0227686_218_925 219
43 3300037466 Ga0395898_0051043 Ga0395898_0051043_26_733 219
44 3300038443 Ga0395901_0050504 Ga0395901_0050504_1802_2509 219
45 3300045976 Ga0466967_0374411 Ga0466967_0374411_272_979 219
46 3300005336 Ga0070680_100137195 Ga0070680_1001371954 220
47 3300005444 Ga0070694_100157230 Ga0070694_1001572302 220
48 3300005467 Ga0070706_100104241 Ga0070706_1001042412 220
49 3300005539 Ga0068853_100446083 Ga0068853_1004460831 220
50 3300005545 Ga0070695_100026761 Ga0070695_1000267614 220
51 3300005546 Ga0070696_100125142 Ga0070696_1001251421 220
52 3300005563 Ga0068855_100244666 Ga0068855_1002446663 220
53 3300009094 Ga0111539_10573890 Ga0111539_105738901 220
54 3300009148 Ga0105243_10858408 Ga0105243_108584081 220
55 3300042120 Ga0450917_002033 Ga0450917_002033_652_1338 220
56 3300042138 Ga0450903_015508 Ga0450903_015508_19_684 220
57 3300042142 Ga0450905_000759 Ga0450905_000759_946_1611 220
58 3300042157 Ga0439458_0042920 Ga0439458_0042920_119_784 220
59 3300050508 nmdc:mga09592_78727_c1 nmdc:mga09592_78727_c1_622_1290 220
60 3300005327 Ga0070658_10074527 Ga0070658_100745274 221
61 3300005337 Ga0070682_100040383 Ga0070682_1000403834 221
62 3300005455 Ga0070663_100597249 Ga0070663_1005972491 221
63 3300005535 Ga0070684_100037590 Ga0070684_1000375902 221
64 3300005539 Ga0068853_100113665 Ga0068853_1001136652 221
65 3300005563 Ga0068855_100630398 Ga0068855_1006303982 221
66 3300005564 Ga0070664_100018805 Ga0070664_1000188052 221
67 3300005577 Ga0068857_100035200 Ga0068857_1000352002 221
68 3300005578 Ga0068854_100045610 Ga0068854_1000456104 221
69 3300005616 Ga0068852_100207854 Ga0068852_1002078542 221
70 3300005834 Ga0068851_10195812 Ga0068851_101958122 221
71 3300025904 Ga0207647_10057040 Ga0207647_100570404 221
72 3300025919 Ga0207657_10021222 Ga0207657_100212227 221
73 3300025920 Ga0207649_10066856 Ga0207649_100668564 221
74 3300025932 Ga0207690_10027189 Ga0207690_100271892 221
75 3300025933 Ga0207706_10013574 Ga0207706_100135748 221
76 3300025944 Ga0207661_10005358 Ga0207661_100053587 221
77 3300025945 Ga0207679_10090620 Ga0207679_100906204 221
78 3300026078 Ga0207702_10033024 Ga0207702_100330245 221
79 3300026116 Ga0207674_10010102 Ga0207674_100101026 221
80 3300026142 Ga0207698_10039063 Ga0207698_100390635 221
81 3300037312 Ga0395899_0108229 Ga0395899_0108229_1136_1810 221
82 3300037418 Ga0395900_0168170 Ga0395900_0168170_422_1096 221
83 3300037466 Ga0395898_0244969 Ga0395898_0244969_729_1400 221
84 3300037471 Ga0395905_0131409 Ga0395905_0131409_1410_2081 221
85 3300037471 Ga0395905_0331691 Ga0395905_0331691_402_1079 222
86 3300037471 Ga0395905_0401776 Ga0395905_0401776_360_1079 223
87 3300032002 Ga0307416_100644138 Ga0307416_1006441382 225
88 3300002067 JGI24735J21928_10028757 JGI24735J21928_100287572 226
89 3300005347 Ga0070668_100284274 Ga0070668_1002842742 226
90 3300005328 Ga0070676_10028885 Ga0070676_100288855 227
91 3300005330 Ga0070690_100251291 Ga0070690_1002512912 227
92 3300005331 Ga0070670_100010837 Ga0070670_1000108374 227
93 3300005347 Ga0070668_100065784 Ga0070668_1000657842 227
94 3300005353 Ga0070669_100036619 Ga0070669_1000366195 227
95 3300005355 Ga0070671_100027792 Ga0070671_1000277926 227
96 3300005367 Ga0070667_100039158 Ga0070667_1000391587 227
97 3300005457 Ga0070662_100006784 Ga0070662_10000678411 227
98 3300005543 Ga0070672_100020387 Ga0070672_1000203875 227
99 3300005564 Ga0070664_100025682 Ga0070664_1000256822 227
100 3300005577 Ga0068857_100145608 Ga0068857_1001456084 227
101 3300005578 Ga0068854_100198783 Ga0068854_1001987834 227
102 3300005618 Ga0068864_100087632 Ga0068864_1000876325 227
103 3300005844 Ga0068862_100038877 Ga0068862_1000388778 227
104 3300005844 Ga0068862_100449496 Ga0068862_1004494962 227
105 3300009094 Ga0111539_10112916 Ga0111539_101129162 227
106 3300009177 Ga0105248_11275087 Ga0105248_112750871 227
107 3300009553 Ga0105249_10031098 Ga0105249_100310984 227
108 3300025315 Ga0207697_10002366 Ga0207697_1000236613 227
109 3300025923 Ga0207681_10020849 Ga0207681_100208496 227
110 3300025925 Ga0207650_10007222 Ga0207650_100072226 227
111 3300025933 Ga0207706_10002348 Ga0207706_100023485 227
112 3300025940 Ga0207691_10010358 Ga0207691_100103589 227
113 3300025945 Ga0207679_10121009 Ga0207679_101210092 227
114 3300025960 Ga0207651_10008872 Ga0207651_100088722 227
115 3300026116 Ga0207674_10577055 Ga0207674_105770553 227
116 3300026121 Ga0207683_10501043 Ga0207683_105010432 227
117 3300028380 Ga0268265_10071645 Ga0268265_100716454 227
118 3300046528 Ga0495642_0043786 Ga0495642_0043786_464_1147 227
119 3300046539 Ga0495621_0001731 Ga0495621_0001731_4360_5043 227
120 3300046539 Ga0495621_0005252 Ga0495621_0005252_1377_2060 227
121 3300046691 Ga0495670_0008427 Ga0495670_0008427_2534_3217 227
122 3300046691 Ga0495670_0025132 Ga0495670_0025132_1568_2251 227
123 3300047445 Ga0495677_0011591 Ga0495677_0011591_824_1507 227
124 3300001979 JGI24740J21852_10012070 JGI24740J21852_100120704 228
125 3300001989 JGI24739J22299_10000368 JGI24739J22299_100003683 228
126 3300001990 JGI24737J22298_10038005 JGI24737J22298_100380052 228
127 3300001991 JGI24743J22301_10002727 JGI24743J22301_100027272 228
128 3300002075 JGI24738J21930_10003346 JGI24738J21930_100033463 228
129 3300005327 Ga0070658_10141022 Ga0070658_101410223 228
130 3300005329 Ga0070683_100137574 Ga0070683_1001375743 228
131 3300005331 Ga0070670_100019299 Ga0070670_1000192996 228
132 3300005335 Ga0070666_10060295 Ga0070666_100602953 228
133 3300005344 Ga0070661_100052940 Ga0070661_1000529404 228
134 3300005355 Ga0070671_100379150 Ga0070671_1003791503 228
135 3300005364 Ga0070673_100006565 Ga0070673_1000065654 228
136 3300005366 Ga0070659_100003637 Ga0070659_10000363714 228
137 3300005367 Ga0070667_100007592 Ga0070667_10000759212 228
138 3300005455 Ga0070663_100063451 Ga0070663_1000634514 228
139 3300005457 Ga0070662_100001998 Ga0070662_1000019989 228
140 3300005535 Ga0070684_100662859 Ga0070684_1006628591 228
141 3300005539 Ga0068853_100033603 Ga0068853_1000336037 228
142 3300005548 Ga0070665_100014696 Ga0070665_1000146966 228
143 3300005563 Ga0068855_100993802 Ga0068855_1009938022 228
144 3300005564 Ga0070664_100008490 Ga0070664_1000084908 228
145 3300005577 Ga0068857_100010191 Ga0068857_1000101918 228
146 3300005578 Ga0068854_100004380 Ga0068854_10000438011 228
147 3300005616 Ga0068852_100311468 Ga0068852_1003114682 228
148 3300005618 Ga0068864_100294082 Ga0068864_1002940823 228
149 3300010375 Ga0105239_10976249 Ga0105239_109762491 228
150 3300013100 Ga0157373_10096944 Ga0157373_100969442 228
151 3300013102 Ga0157371_10022902 Ga0157371_100229024 228
152 3300013307 Ga0157372_10071538 Ga0157372_100715382 228
153 3300025904 Ga0207647_10008838 Ga0207647_100088388 228
154 3300025909 Ga0207705_10082989 Ga0207705_100829894 228
155 3300025919 Ga0207657_10010886 Ga0207657_100108868 228
156 3300025920 Ga0207649_10192567 Ga0207649_101925673 228
157 3300025925 Ga0207650_10052393 Ga0207650_100523933 228
158 3300025932 Ga0207690_10053893 Ga0207690_100538934 228
159 3300025933 Ga0207706_10001681 Ga0207706_1000168110 228
160 3300025945 Ga0207679_10073068 Ga0207679_100730683 228
161 3300025960 Ga0207651_10398955 Ga0207651_103989553 228
162 3300025986 Ga0207658_10034829 Ga0207658_100348295 228
163 3300026041 Ga0207639_10089835 Ga0207639_100898353 228
164 3300026067 Ga0207678_10002012 Ga0207678_1000201216 228
165 3300026116 Ga0207674_10005155 Ga0207674_100051558 228
166 3300028379 Ga0268266_10258065 Ga0268266_102580652 228
167 3300037418 Ga0395900_0078174 Ga0395900_0078174_1752_2444 229
168 3300037466 Ga0395898_0173876 Ga0395898_0173876_640_1332 229
169 3300037471 Ga0395905_0278208 Ga0395905_0278208_228_920 229
170 3300038443 Ga0395901_0034590 Ga0395901_0034590_640_1332 229
171 3300005563 Ga0068855_100149942 Ga0068855_1001499422 230
172 3300013102 Ga0157371_10012357 Ga0157371_100123573 230
173 3300013105 Ga0157369_10136897 Ga0157369_101368974 230
174 3300013307 Ga0157372_10053729 Ga0157372_100537295 230
175 3300005327 Ga0070658_10147003 Ga0070658_101470032 231
176 3300005327 Ga0070658_10193369 Ga0070658_101933692 231
177 3300005329 Ga0070683_100378575 Ga0070683_1003785752 231
178 3300005336 Ga0070680_100036245 Ga0070680_1000362451 231
179 3300005339 Ga0070660_100049799 Ga0070660_1000497992 231
180 3300005345 Ga0070692_10017675 Ga0070692_100176756 231
181 3300005345 Ga0070692_10070800 Ga0070692_100708002 231
182 3300005366 Ga0070659_100076989 Ga0070659_1000769893 231
183 3300005435 Ga0070714_100202413 Ga0070714_1002024131 231
184 3300005435 Ga0070714_100371403 Ga0070714_1003714032 231
185 3300005614 Ga0068856_100441075 Ga0068856_1004410751 231
186 3300005616 Ga0068852_100025308 Ga0068852_1000253085 231
187 3300013104 Ga0157370_10573325 Ga0157370_105733253 231
188 3300013105 Ga0157369_10112317 Ga0157369_101123172 231
189 3300020081 Ga0206354_10215577 Ga0206354_102155774 231
190 3300020082 Ga0206353_11342449 Ga0206353_113424492 231
191 3300025909 Ga0207705_10043291 Ga0207705_100432914 231
192 3300025909 Ga0207705_10135390 Ga0207705_101353903 231
193 3300025909 Ga0207705_10534155 Ga0207705_105341552 231
194 3300025919 Ga0207657_10069784 Ga0207657_100697843 231
195 3300025921 Ga0207652_10087331 Ga0207652_100873312 231
196 3300025932 Ga0207690_10019578 Ga0207690_100195784 231
197 3300025932 Ga0207690_10242855 Ga0207690_102428552 231
198 3300025944 Ga0207661_10344307 Ga0207661_103443072 231
199 3300026142 Ga0207698_10001376 Ga0207698_1000137614 231
200 3300037312 Ga0395899_0082869 Ga0395899_0082869_1133_1828 231
201 3300037312 Ga0395899_0248445 Ga0395899_0248445_404_1099 231
202 3300037418 Ga0395900_0358769 Ga0395900_0358769_506_1201 231
203 3300037466 Ga0395898_0033107 Ga0395898_0033107_2611_3306 231
204 3300037466 Ga0395898_0219809 Ga0395898_0219809_755_1450 231
205 3300037471 Ga0395905_0106220 Ga0395905_0106220_1831_2526 231
206 3300037471 Ga0395905_0112743 Ga0395905_0112743_1481_2176 231
207 3300001915 JGI24741J21665_1002204 JGI24741J21665_10022046 232
208 3300001979 JGI24740J21852_10001036 JGI24740J21852_100010362 232
209 3300001989 JGI24739J22299_10003704 JGI24739J22299_100037044 232
210 3300001990 JGI24737J22298_10017597 JGI24737J22298_100175973 232
211 3300002067 JGI24735J21928_10005613 JGI24735J21928_100056132 232
212 3300003320 rootH2_10280869 rootH2_102808691 232
213 3300003323 rootH1_10121128 rootH1_101211281 232
214 3300005327 Ga0070658_10186014 Ga0070658_101860143 232
215 3300005337 Ga0070682_100019770 Ga0070682_1000197701 232
216 3300005339 Ga0070660_100028527 Ga0070660_1000285273 232
217 3300005345 Ga0070692_10030164 Ga0070692_100301642 232
218 3300005367 Ga0070667_100262522 Ga0070667_1002625223 232
219 3300005455 Ga0070663_100005658 Ga0070663_1000056588 232
220 3300005457 Ga0070662_100031798 Ga0070662_1000317985 232
221 3300005530 Ga0070679_100237864 Ga0070679_1002378643 232
222 3300005535 Ga0070684_100011954 Ga0070684_1000119548 232
223 3300005539 Ga0068853_100307242 Ga0068853_1003072423 232
224 3300005546 Ga0070696_100660248 Ga0070696_1006602481 232
225 3300005547 Ga0070693_100198072 Ga0070693_1001980722 232
226 3300005563 Ga0068855_100044337 Ga0068855_1000443375 232
227 3300005564 Ga0070664_100014169 Ga0070664_1000141695 232
228 3300005577 Ga0068857_100099212 Ga0068857_1000992124 232
229 3300005614 Ga0068856_100592661 Ga0068856_1005926613 232
230 3300005843 Ga0068860_100071146 Ga0068860_1000711464 232
231 3300010375 Ga0105239_10885053 Ga0105239_108850531 232
232 3300013307 Ga0157372_10026204 Ga0157372_100262044 232
233 3300025909 Ga0207705_10011762 Ga0207705_100117623 232
234 3300025912 Ga0207707_10115349 Ga0207707_101153492 232
235 3300025917 Ga0207660_10146487 Ga0207660_101464873 232
236 3300025919 Ga0207657_10003125 Ga0207657_1000312517 232
237 3300025920 Ga0207649_10138633 Ga0207649_101386332 232
238 3300025921 Ga0207652_10153965 Ga0207652_101539652 232
239 3300025932 Ga0207690_10002388 Ga0207690_1000238812 232
240 3300025933 Ga0207706_10012370 Ga0207706_100123702 232
241 3300025941 Ga0207711_10236746 Ga0207711_102367463 232
242 3300025944 Ga0207661_10698031 Ga0207661_106980312 232
243 3300025945 Ga0207679_10155215 Ga0207679_101552152 232
244 3300026041 Ga0207639_10160594 Ga0207639_101605943 232
245 3300026067 Ga0207678_10006050 Ga0207678_100060508 232
246 3300026116 Ga0207674_10008541 Ga0207674_100085417 232
247 3300045976 Ga0466967_0035347 Ga0466967_0035347_1795_2493 232
248 3300005327 Ga0070658_10007983 Ga0070658_100079836 233
249 3300005327 Ga0070658_10010920 Ga0070658_100109207 233
250 3300005329 Ga0070683_100048629 Ga0070683_1000486294 233
251 3300005339 Ga0070660_100001729 Ga0070660_10000172917 233
252 3300005345 Ga0070692_10029957 Ga0070692_100299573 233
253 3300005345 Ga0070692_10182297 Ga0070692_101822972 233
254 3300005535 Ga0070684_100023155 Ga0070684_1000231553 233
255 3300005563 Ga0068855_100740713 Ga0068855_1007407132 233
256 3300005564 Ga0070664_100131968 Ga0070664_1001319682 233
257 3300005844 Ga0068862_100146546 Ga0068862_1001465462 233
258 3300013102 Ga0157371_10008051 Ga0157371_100080516 233
259 3300013104 Ga0157370_10093513 Ga0157370_100935134 233
260 3300013105 Ga0157369_10018697 Ga0157369_100186974 233
261 3300025909 Ga0207705_10026662 Ga0207705_100266625 233
262 3300025909 Ga0207705_10033959 Ga0207705_100339592 233
263 3300025919 Ga0207657_10001743 Ga0207657_1000174321 233
264 3300025920 Ga0207649_10379889 Ga0207649_103798891 233
265 3300025932 Ga0207690_10566753 Ga0207690_105667532 233
266 3300025944 Ga0207661_10047304 Ga0207661_100473044 233
267 3300025945 Ga0207679_10111522 Ga0207679_101115223 233
268 3300025949 Ga0207667_10508869 Ga0207667_105088693 233
269 3300028380 Ga0268265_10044816 Ga0268265_100448163 233
270 3300037312 Ga0395899_0000258 Ga0395899_0000258_6653_7354 233
271 3300037312 Ga0395899_0008496 Ga0395899_0008496_6982_7689 233
272 3300037312 Ga0395899_0177610 Ga0395899_0177610_84_830 233
273 3300037418 Ga0395900_0000254 Ga0395900_0000254_59929_60630 233
274 3300037418 Ga0395900_0004026 Ga0395900_0004026_14519_15226 233
275 3300037418 Ga0395900_0282431 Ga0395900_0282431_34_780 233
276 3300037418 Ga0395900_0482213 Ga0395900_0482213_352_1098 233
277 3300037466 Ga0395898_0021797 Ga0395898_0021797_2653_3354 233
278 3300037466 Ga0395898_0053067 Ga0395898_0053067_1894_2601 233
279 3300037471 Ga0395905_0042983 Ga0395905_0042983_3294_4001 233
280 3300037471 Ga0395905_0119267 Ga0395905_0119267_360_1067 233
281 3300037471 Ga0395905_0317799 Ga0395905_0317799_34_780 233
282 3300037471 Ga0395905_0450107 Ga0395905_0450107_221_928 233
283 3300038443 Ga0395901_0000030 Ga0395901_0000030_22667_23368 233
284 3300038443 Ga0395901_0052975 Ga0395901_0052975_14_721 233
285 3300038443 Ga0395901_0503276 Ga0395901_0503276_40_756 233
286 3300061719 Ga0466962_0074695 Ga0466962_0074695_750_1460 233
287 3300005329 Ga0070683_100291620 Ga0070683_1002916202 234
288 3300005339 Ga0070660_100263284 Ga0070660_1002632841 234
289 3300005353 Ga0070669_100521704 Ga0070669_1005217042 234
290 3300005355 Ga0070671_100011784 Ga0070671_1000117842 234
291 3300005364 Ga0070673_100636027 Ga0070673_1006360271 234
292 3300005366 Ga0070659_100049820 Ga0070659_1000498202 234
293 3300005366 Ga0070659_100295244 Ga0070659_1002952441 234
294 3300005548 Ga0070665_100198360 Ga0070665_1001983602 234
295 3300005618 Ga0068864_100058843 Ga0068864_1000588432 234
296 3300005834 Ga0068851_10001992 Ga0068851_1000199212 234
297 3300006844 Ga0075428_100509988 Ga0075428_1005099882 234
298 3300009174 Ga0105241_10531106 Ga0105241_105311062 234
299 3300013104 Ga0157370_10084841 Ga0157370_100848417 234
300 3300013105 Ga0157369_10258268 Ga0157369_102582681 234
301 3300013105 Ga0157369_10365229 Ga0157369_103652293 234
302 3300013296 Ga0157374_10477512 Ga0157374_104775123 234
303 3300013307 Ga0157372_10143244 Ga0157372_101432442 234
304 3300025931 Ga0207644_10008908 Ga0207644_1000890812 234
305 3300025932 Ga0207690_10008020 Ga0207690_100080205 234
306 3300025932 Ga0207690_10299270 Ga0207690_102992702 234
307 3300025933 Ga0207706_10315101 Ga0207706_103151013 234
308 3300025941 Ga0207711_10012998 Ga0207711_100129986 234
309 3300025960 Ga0207651_10116686 Ga0207651_101166863 234
310 3300037312 Ga0395899_0185054 Ga0395899_0185054_482_1210 234
311 3300037418 Ga0395900_0013902 Ga0395900_0013902_7187_7915 234
312 3300037418 Ga0395900_0022984 Ga0395900_0022984_34_783 234
313 3300037418 Ga0395900_0051497 Ga0395900_0051497_2877_3626 234
314 3300037466 Ga0395898_0038749 Ga0395898_0038749_3306_4055 234
315 3300037466 Ga0395898_0304417 Ga0395898_0304417_667_1416 234
316 3300037466 Ga0395898_0704625 Ga0395898_0704625_114_827 234
317 3300037471 Ga0395905_0023371 Ga0395905_0023371_1829_2578 234
318 3300037471 Ga0395905_0068580 Ga0395905_0068580_2539_3288 234
319 3300038443 Ga0395901_0067767 Ga0395901_0067767_2905_3654 234
320 3300038443 Ga0395901_0074921 Ga0395901_0074921_126_875 234
321 3300044693 Ga0466961_0010293 Ga0466961_0010293_1640_2368 234
322 3300044694 Ga0466963_0005775 Ga0466963_0005775_3761_4489 234
323 3300044719 Ga0466971_0019790 Ga0466971_0019790_45_773 234
324 3300044842 Ga0466957_0003546 Ga0466957_0003546_2472_3200 234
325 3300044842 Ga0466957_0172071 Ga0466957_0172071_480_1217 234
326 3300045049 Ga0466959_0172752 Ga0466959_0172752_34_762 234
327 3300045836 Ga0466958_0000867 Ga0466958_0000867_10305_11033 234
328 3300045976 Ga0466967_0033365 Ga0466967_0033365_351_1058 234
329 3300045976 Ga0466967_0039121 Ga0466967_0039121_2549_3262 234
330 3300045976 Ga0466967_0043147 Ga0466967_0043147_2875_3612 234
331 3300045976 Ga0466967_0351006 Ga0466967_0351006_662_1369 234
332 3300048910 Ga0496107_0121307 Ga0496107_0121307_206_976 234
333 3300048911 Ga0496108_0032424 Ga0496108_0032424_2892_3662 234
334 3300048913 Ga0496110_0242083 Ga0496110_0242083_321_1091 234
335 3300048915 Ga0496112_0104434 Ga0496112_0104434_1639_2409 234
336 3300048916 Ga0496113_0465765 Ga0496113_0465765_73_843 234
337 3300061719 Ga0466962_0003328 Ga0466962_0003328_4220_4948 234
338 3300001904 JGI24736J21556_1002932 JGI24736J21556_10029323 235
339 3300005339 Ga0070660_100492242 Ga0070660_1004922422 235
340 3300005366 Ga0070659_100020465 Ga0070659_1000204655 235
341 3300005455 Ga0070663_100145922 Ga0070663_1001459222 235
342 3300005455 Ga0070663_100682681 Ga0070663_1006826811 235
343 3300013307 Ga0157372_10282038 Ga0157372_102820382 235
344 3300025919 Ga0207657_10043585 Ga0207657_100435855 235
345 3300025932 Ga0207690_10037939 Ga0207690_100379393 235
346 3300025944 Ga0207661_10047578 Ga0207661_100475783 235
347 3300025949 Ga0207667_10374333 Ga0207667_103743332 235
348 3300026067 Ga0207678_10086776 Ga0207678_100867763 235
349 3300037312 Ga0395899_0204114 Ga0395899_0204114_279_986 235
350 3300037466 Ga0395898_0559916 Ga0395898_0559916_10_717 235
351 3300038443 Ga0395901_0323059 Ga0395901_0323059_254_961 235
352 3300044656 Ga0466969_0048030 Ga0466969_0048030_1319_2026 235
353 3300044684 Ga0466966_0018426 Ga0466966_0018426_1302_2009 235
354 3300044693 Ga0466961_0215147 Ga0466961_0215147_120_827 235
355 3300044719 Ga0466971_0058513 Ga0466971_0058513_624_1331 235
356 3300044765 Ga0466970_0006042 Ga0466970_0006042_2240_2947 235
357 3300044842 Ga0466957_0001548 Ga0466957_0001548_4318_5025 235
358 3300045836 Ga0466958_0023590 Ga0466958_0023590_293_1000 235

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qsu-assembly1.cif.gz_A structure of staphylococcus aureus hfq in complex with a7 rna 0.9067 175 227
5gl6-assembly2.cif.gz_B msmeg rimp 0.8349 173 231
4nl3-assembly1.cif.gz_D crystal structure of listeria monocytogenes hfq in complex with u6 rna 0.8045 176 235
7zs0-assembly1.cif.gz_A diheme cytochrome c kustd1711 from kuenenia stuttgartiensis 0.7867 171 229
2b5a-assembly1.cif.gz_A c.bcli, control element of the bcli restriction-modification system 0.7849 9 67
ID Description Score Start End Superfamily
af_Q2FYZ1_1_77_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.9123 175 227 2.30.30.100
af_A0A0R0H3V8_1_250_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8909 196 223 3.50.50.60
3qsuF00 Mainly Beta;Roll;SH3 type barrels.; 0.8878 175 227 2.30.30.100
af_A0A1D6LPC7_212_432_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8763 196 220 3.50.50.60
3hsbD00 Mainly Beta;Roll;SH3 type barrels.; 0.8207 176 235 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A2N3KUR3-F1-model_v4 Peptidase S24/S26A/S26B/S26C domain-containing protein 0.936 144 234
AF-A0A1H8XPK6-F1-model_v4 Peptidase S24-like 0.9316 143 234
AF-B9BQI3-F1-model_v4 Putative phage repressor 0.9313 144 235
AF-A0A175Y102-F1-model_v4 Peptidase S24/S26A/S26B/S26C domain-containing protein 0.9299 99 231
AF-A0A178MUC8-F1-model_v4 Peptidase S24/S26A/S26B/S26C domain-containing protein 0.929 99 232

Feature Viewer

pLDDT pTM Quality
87.54 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map