F421022

General Info

Members Datasets Scaffolds Average Seq Length
357 224 347 121

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2721755702|2723640236
Length 129
Sequence AGGPFALSIDPAASAPPYEQLRRQVVEAVTAGSLAPGTRMPTVRALATELDLAVNTVAKAYKSLEADGVIEGRGRAGTFVSATGDPSTQQAQLAAIAYADRVHHLGLDDDAALALVASALRARAAPPVE

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
3 2808606372 Agromyces sp. 23-23 Isolate Unclassified
4 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
5 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
6 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
7 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
8 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
9 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
10 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
81 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
127 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
128 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
129 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
132 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
215 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
216 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
217 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
218 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
219 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
220 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
221 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
222 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.2
Metatranscriptomes 0
Isolates 2.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.37
Nodule 0.28
Rhizoplane 14.01
Rhizosphere 55.18
Stem 0
Stem Tuber 0
Unclassified 13.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10008305 3300003320 Bacteria 1793
2 Ga0055540_1008124 3300003792 Bacteria 3825
3 Ga0070682_100072990 3300005337 Bacteria 2200
4 Ga0070682_101195157 3300005337 Bacteria 641
5 Ga0070661_100092532 3300005344 Bacteria 2240
6 Ga0070668_100001588 3300005347 Bacteria 16446
7 Ga0070668_101057420 3300005347 Bacteria 731
8 Ga0070669_100000269 3300005353 Bacteria 42657
9 Ga0070675_101245027 3300005354 Bacteria 685
10 Ga0070671_101748037 3300005355 Bacteria 552
11 Ga0070674_100135817 3300005356 Bacteria 1839
12 Ga0070674_101122136 3300005356 Bacteria 695
13 Ga0070673_100316736 3300005364 Bacteria 1377
14 Ga0070667_100000109 3300005367 Bacteria 105260
15 Ga0070667_100391207 3300005367 Bacteria 1264
16 Ga0070709_10968129 3300005434 Bacteria 676
17 Ga0070714_100010405 3300005435 Bacteria 7352
18 Ga0070714_101144369 3300005435 Bacteria 759
19 Ga0070713_100131496 3300005436 Bacteria 2208
20 Ga0070711_100199257 3300005439 Bacteria 1544
21 Ga0070663_100275404 3300005455 Bacteria 1339
22 Ga0070678_100505260 3300005456 Bacteria 1067
23 Ga0070679_100559478 3300005530 Bacteria 1087
24 Ga0070684_100390247 3300005535 Bacteria 1283
25 Ga0068853_100118208 3300005539 Bacteria 2362
26 Ga0070693_100587416 3300005547 Bacteria 802
27 Ga0070665_100004708 3300005548 Bacteria 14221
28 Ga0070665_100742260 3300005548 Bacteria 995
29 Ga0070665_100985499 3300005548 Bacteria 855
30 Ga0068855_100262107 3300005563 Bacteria 1925
31 Ga0070664_100166365 3300005564 Bacteria 1954
32 Ga0068854_100193147 3300005578 Bacteria 1596
33 Ga0070702_100241547 3300005615 Bacteria 1219
34 Ga0068852_100645813 3300005616 Bacteria 1065
35 Ga0068859_100001848 3300005617 Bacteria 21522
36 Ga0068859_100549083 3300005617 Bacteria 1250
37 Ga0068864_100403139 3300005618 Bacteria 1300
38 Ga0068870_10118475 3300005840 Bacteria 1522
39 Ga0068863_100000123 3300005841 Bacteria 80999
40 Ga0068858_100065006 3300005842 Bacteria 3376
41 Ga0068860_100000175 3300005843 Bacteria 105260
42 Ga0068862_100000091 3300005844 Bacteria 107015
43 Ga0068862_101244134 3300005844 Bacteria 744
44 Ga0081455_10149488 3300005937 Bacteria 1802
45 Ga0075365_10002159 3300006038 Bacteria 9458
46 Ga0075365_10020298 3300006038 Bacteria 4117
47 Ga0075368_10011590 3300006042 Bacteria 3209
48 Ga0075363_100002100 3300006048 Bacteria 7989
49 Ga0075363_100004912 3300006048 Bacteria 5911
50 Ga0075363_100053003 3300006048 Bacteria 2166
51 Ga0075363_100300265 3300006048 Bacteria 932
52 Ga0075363_100564900 3300006048 Bacteria 680
53 Ga0075364_10013248 3300006051 Bacteria 5062
54 Ga0075364_10124916 3300006051 Bacteria 1724
55 Ga0075364_10846855 3300006051 Bacteria 623
56 Ga0075364_10979725 3300006051 Bacteria 575
57 Ga0075362_10616545 3300006177 Bacteria 562
58 Ga0075367_10014274 3300006178 Bacteria 4296
59 Ga0075369_10004539 3300006186 Bacteria 5139
60 Ga0075369_10005867 3300006186 Bacteria 4614
61 Ga0075369_10006538 3300006186 Bacteria 4408
62 Ga0075369_10031457 3300006186 Bacteria 2241
63 Ga0075369_10037903 3300006186 Bacteria 2055
64 Ga0075369_10109278 3300006186 Bacteria 1245
65 Ga0075366_10158237 3300006195 Bacteria 1372
66 Ga0075370_10002454 3300006353 Bacteria 8600
67 Ga0068871_100437488 3300006358 Bacteria 1170
68 Ga0068865_100630286 3300006881 Bacteria 909
69 Ga0097620_100001848 3300006931 Bacteria 21522
70 Ga0097620_100549087 3300006931 Bacteria 1250
71 Ga0075435_100732918 3300007076 Bacteria 859
72 Ga0105240_12257326 3300009093 Bacteria 564
73 Ga0111539_11650153 3300009094 Bacteria 743
74 Ga0105245_12445248 3300009098 Bacteria 576
75 Ga0105247_10000070 3300009101 Bacteria 115098
76 Ga0105243_10445114 3300009148 Bacteria 1214
77 Ga0105243_10445355 3300009148 Bacteria 1214
78 Ga0105242_11304131 3300009176 Bacteria 750
79 Ga0105248_10000458 3300009177 Bacteria 46439
80 Ga0105248_10162654 3300009177 Bacteria 2517
81 Ga0105248_11887480 3300009177 Bacteria 678
82 Ga0105237_10004358 3300009545 Bacteria 16404
83 Ga0105237_11998643 3300009545 Bacteria 588
84 Ga0105249_10000020 3300009553 Bacteria 260634
85 Ga0105239_10004760 3300010375 Bacteria 16109
86 Ga0157346_1018531 3300012480 Bacteria 587
87 Ga0157369_10797970 3300013105 Bacteria 970
88 Ga0163162_10066906 3300013306 Bacteria 3643
89 Ga0163162_11617093 3300013306 Bacteria 739
90 Ga0163162_11804108 3300013306 Bacteria 699
91 Ga0157372_10615696 3300013307 Bacteria 1265
92 Ga0157372_12184964 3300013307 Bacteria 636
93 Ga0157375_10282860 3300013308 Bacteria 1822
94 Ga0157375_10410456 3300013308 Bacteria 1520
95 Ga0163163_10015155 3300014325 Bacteria 7117
96 Ga0182008_10821971 3300014497 Bacteria 541
97 Ga0157379_10057893 3300014968 Bacteria 3464
98 Ga0157379_11999390 3300014968 Bacteria 573
99 Ga0163161_10197681 3300017792 Bacteria 1548
100 Ga0213876_10000247 3300021384 Bacteria 51664
101 Ga0213876_10025624 3300021384 Bacteria 3111
102 Ga0213875_10017316 3300021388 Bacteria 3482
103 Ga0213875_10017398 3300021388 Bacteria 3472
104 Ga0213871_10188411 3300021441 Bacteria 640
105 Ga0207672_1004973 3300025223 Bacteria 754
106 Ga0209673_1009120 3300025273 Bacteria 4332
107 Ga0209051_1000516 3300025303 Bacteria 48783
108 Ga0209051_1000521 3300025303 Bacteria 48210
109 Ga0209051_1004787 3300025303 Bacteria 8167
110 Ga0207710_10000010 3300025900 Bacteria 482087
111 Ga0207688_10512942 3300025901 Bacteria 751
112 Ga0207643_10165395 3300025908 Bacteria 1332
113 Ga0207671_10019710 3300025914 Bacteria 5151
114 Ga0207663_10284488 3300025916 Bacteria 1229
115 Ga0207681_10000979 3300025923 Bacteria 18652
116 Ga0207694_11554693 3300025924 Bacteria 558
117 Ga0207659_11094385 3300025926 Bacteria 686
118 Ga0207700_10564435 3300025928 Bacteria 1011
119 Ga0207664_10935550 3300025929 Bacteria 778
120 Ga0207644_10737662 3300025931 Bacteria 822
121 Ga0207709_10423197 3300025935 Bacteria 1023
122 Ga0207711_10000422 3300025941 Bacteria 44472
123 Ga0207711_10661135 3300025941 Bacteria 975
124 Ga0207667_10363435 3300025949 Bacteria 1476
125 Ga0207712_10000010 3300025961 Bacteria 455972
126 Ga0207668_10000336 3300025972 Bacteria 30375
127 Ga0207640_10207248 3300025981 Bacteria 1490
128 Ga0207658_10000257 3300025986 Bacteria 55345
129 Ga0207658_10999088 3300025986 Bacteria 763
130 Ga0207703_10207039 3300026035 Bacteria 1746
131 Ga0207639_10169849 3300026041 Bacteria 1846
132 Ga0207678_10156359 3300026067 Bacteria 1947
133 Ga0207678_10249028 3300026067 Bacteria 1522
134 Ga0207678_10271890 3300026067 Bacteria 1453
135 Ga0207708_10058233 3300026075 Bacteria 2948
136 Ga0207641_10002535 3300026088 Bacteria 16809
137 Ga0207676_10199966 3300026095 Bacteria 1765
138 Ga0207683_10230166 3300026121 Bacteria 1690
139 Ga0268266_10031661 3300028379 Bacteria 4492
140 Ga0268266_10573173 3300028379 Bacteria 1083
141 Ga0268266_10972776 3300028379 Bacteria 821
142 Ga0268266_11261552 3300028379 Bacteria 714
143 Ga0268265_10000105 3300028380 Bacteria 105463
144 Ga0268264_10000237 3300028381 Bacteria 105274
145 Ga0307410_10036313 3300031852 Bacteria 3208
146 Ga0307410_10407313 3300031852 Bacteria 1100
147 Ga0307406_10478678 3300031901 Bacteria 1005
148 Ga0307412_11371217 3300031911 Bacteria 639
149 Ga0307409_100419744 3300031995 Bacteria 1283
150 Ga0307409_101059830 3300031995 Bacteria 831
151 Ga0307415_100680452 3300032126 Bacteria 926
152 Ga0307415_102454429 3300032126 Bacteria 513
153 Ga0373944_0070611 3300035089 Bacteria 1137
154 Ga0373946_0574324 3300035171 Bacteria 583
155 Ga0373947_0200287 3300035725 Bacteria 1306
156 Ga0395900_0731934 3300037418 Bacteria 921
157 Ga0436364_0708750 3300037853 Bacteria 22585
158 Ga0436364_1476739 3300037853 Bacteria 3259
159 Ga0436365_0256887 3300039437 Bacteria 751
160 Ga0436365_0379597 3300039437 Bacteria 623
161 Ga0436365_1063416 3300039437 Bacteria 3467
162 Ga0436365_1665709 3300039437 Bacteria 1409
163 Ga0436365_1677737 3300039437 Bacteria 13493
164 Ga0436365_1681922 3300039437 Bacteria 3343
165 Ga0436360_0316309 3300039438 Bacteria 1095
166 Ga0436361_1209801 3300039447 Bacteria 1421
167 Ga0436363_0269943 3300039450 Bacteria 2148
168 Ga0439465_0165450 3300041413 Bacteria 795
169 Ga0451789_1193316 3300041443 Bacteria 917
170 Ga0451793_0338240 3300041452 Bacteria 1571
171 Ga0451793_0556900 3300041452 Bacteria 1983
172 Ga0451795_1673907 3300041456 Bacteria 1196
173 Ga0451807_1700016 3300041486 Bacteria 993
174 Ga0451841_1034574 3300041498 Bacteria 996
175 Ga0451851_0167029 3300041507 Bacteria 701
176 Ga0451853_1021090 3300041512 Bacteria 690
177 Ga0451853_3884224 3300041512 Bacteria 512
178 Ga0439459_0033576 3300042438 Bacteria 1057
179 Ga0466972_0005182 3300044658 Bacteria 6526
180 Ga0466972_0012198 3300044658 Bacteria 4318
181 Ga0466965_0000450 3300044683 Bacteria 14434
182 Ga0466965_0002264 3300044683 Bacteria 8109
183 Ga0466965_0040892 3300044683 Bacteria 2283
184 Ga0466965_0155744 3300044683 Bacteria 1196
185 Ga0466965_0478084 3300044683 Bacteria 696
186 Ga0466961_0039717 3300044693 Bacteria 3016
187 Ga0466961_0737018 3300044693 Bacteria 589
188 Ga0466963_0082714 3300044694 Bacteria 2177
189 Ga0466963_0259582 3300044694 Bacteria 1220
190 Ga0466963_0892795 3300044694 Bacteria 626
191 Ga0466971_0107610 3300044719 Bacteria 1285
192 Ga0466968_0002855 3300044735 Bacteria 6389
193 Ga0466968_0319653 3300044735 Bacteria 749
194 Ga0466970_0107581 3300044765 Bacteria 1521
195 Ga0466970_0222048 3300044765 Bacteria 1055
196 Ga0466970_0237761 3300044765 Bacteria 1019
197 Ga0466957_0012856 3300044842 Bacteria 4851
198 Ga0466957_0064328 3300044842 Bacteria 2257
199 Ga0466960_0002405 3300044901 Bacteria 7053
200 Ga0466960_0006287 3300044901 Bacteria 4757
201 Ga0466959_0041114 3300045049 Bacteria 3413
202 Ga0466959_0166372 3300045049 Bacteria 1548
203 Ga0466958_0005094 3300045836 Bacteria 7021
204 Ga0466958_0029316 3300045836 Bacteria 3266
205 Ga0466958_0188051 3300045836 Bacteria 1312
206 Ga0466967_0370275 3300045976 Bacteria 1389
207 Ga0495603_0018759 3300046455 Bacteria 4187
208 Ga0495629_0017753 3300046459 Bacteria 5100
209 Ga0495638_0006390 3300046460 Bacteria 8581
210 Ga0495639_0073673 3300046475 Bacteria 1581
211 Ga0495606_0048443 3300046507 Bacteria 2795
212 Ga0495608_0574564 3300046511 Bacteria 678
213 Ga0495648_0018036 3300046524 Bacteria 5018
214 Ga0495666_0080439 3300046526 Bacteria 1542
215 Ga0495665_0054360 3300046531 Bacteria 2116
216 Ga0495640_0041814 3300046533 Bacteria 3201
217 Ga0495668_0013301 3300046616 Bacteria 4860
218 Ga0495634_0144852 3300046642 Bacteria 1506
219 Ga0495588_0271400 3300046674 Bacteria 894
220 Ga0495646_0613389 3300046680 Bacteria 552
221 Ga0495658_0253822 3300046683 Bacteria 1106
222 Ga0495624_0038043 3300046690 Bacteria 3093
223 Ga0495671_0108158 3300046692 Bacteria 1358
224 Ga0495649_0540588 3300046694 Bacteria 577
225 Ga0495581_0042384 3300047315 Bacteria 2634
226 Ga0495674_0383224 3300047319 Bacteria 1137
227 Ga0495672_0012966 3300047320 Bacteria 5775
228 Ga0495672_0071103 3300047320 Bacteria 1970
229 Ga0495676_0090968 3300047321 Bacteria 2282
230 Ga0495673_0029801 3300047469 Bacteria 2571
231 Ga0495686_0012245 3300047472 Bacteria 6007
232 Ga0495686_0242931 3300047472 Bacteria 1015
233 Ga0495593_0020379 3300047673 Bacteria 3714
234 Ga0495626_0249684 3300048091 Bacteria 712
235 Ga0496100_0001679 3300048903 Bacteria 10991
236 Ga0496100_0006246 3300048903 Bacteria 6486
237 Ga0496100_0028627 3300048903 Bacteria 3438
238 Ga0496100_1088020 3300048903 Bacteria 630
239 Ga0496101_0000126 3300048904 Bacteria 74316
240 Ga0496101_0000416 3300048904 Bacteria 27478
241 Ga0496101_0002102 3300048904 Bacteria 12141
242 Ga0496101_0017017 3300048904 Bacteria 4923
243 Ga0496101_0109478 3300048904 Bacteria 2078
244 Ga0496101_0355120 3300048904 Bacteria 1152
245 Ga0496102_0000526 3300048905 Bacteria 41473
246 Ga0496102_0021852 3300048905 Bacteria 5664
247 Ga0496102_0133190 3300048905 Bacteria 2328
248 Ga0496102_0584877 3300048905 Bacteria 1039
249 Ga0496102_0725285 3300048905 Bacteria 917
250 Ga0496103_0000356 3300048906 Bacteria 41484
251 Ga0496103_0500004 3300048906 Bacteria 778
252 Ga0496104_0002551 3300048907 Bacteria 15695
253 Ga0496104_0388961 3300048907 Bacteria 1307
254 Ga0496105_0031114 3300048908 Bacteria 4375
255 Ga0496106_0003146 3300048909 Bacteria 12318
256 Ga0496106_0014412 3300048909 Bacteria 5841
257 Ga0496106_0034005 3300048909 Bacteria 3806
258 Ga0496106_0270372 3300048909 Bacteria 1361
259 Ga0496106_0889475 3300048909 Bacteria 704
260 Ga0496107_0002665 3300048910 Bacteria 11688
261 Ga0496107_0010487 3300048910 Bacteria 6440
262 Ga0496107_0203798 3300048910 Bacteria 1470
263 Ga0496108_0036172 3300048911 Bacteria 4107
264 Ga0496108_0118975 3300048911 Bacteria 2265
265 Ga0496108_0705240 3300048911 Bacteria 875
266 Ga0496109_0013709 3300048912 Bacteria 7041
267 Ga0496109_0185141 3300048912 Bacteria 1957
268 Ga0496109_1222899 3300048912 Bacteria 688
269 Ga0496110_0129410 3300048913 Bacteria 2279
270 Ga0496111_0097008 3300048914 Bacteria 2164
271 Ga0496112_0019023 3300048915 Bacteria 6474
272 Ga0496112_0019077 3300048915 Bacteria 6464
273 Ga0496113_0006604 3300048916 Bacteria 7375
274 Ga0496114_0000713 3300048917 Bacteria 24718
275 Ga0496114_0057228 3300048917 Bacteria 3255
276 Ga0496114_0553733 3300048917 Bacteria 1016
277 Ga0496114_0856293 3300048917 Bacteria 789
278 Ga0496115_0002508 3300048918 Bacteria 13180
279 Ga0496115_1085648 3300048918 Bacteria 607
280 Ga0496116_0008070 3300048919 Bacteria 9209
281 Ga0496117_0000614 3300048920 Bacteria 57852
282 Ga0496117_0243305 3300048920 Bacteria 986
283 Ga0496117_0317924 3300048920 Bacteria 817
284 Ga0496118_0000558 3300048921 Bacteria 61328
285 Ga0496118_0001025 3300048921 Bacteria 43475
286 Ga0496119_0000041 3300048922 Bacteria 203687
287 Ga0496119_0006840 3300048922 Bacteria 10443
288 Ga0496119_0072301 3300048922 Bacteria 2016
289 Ga0496120_0000027 3300048923 Bacteria 231507
290 Ga0496120_0008662 3300048923 Bacteria 7340
291 Ga0496120_0015462 3300048923 Bacteria 5031
292 Ga0496120_0199447 3300048923 Bacteria 970
293 Ga0496121_0000171 3300048924 Bacteria 144073
294 Ga0496121_0013589 3300048924 Bacteria 8730
295 Ga0496122_0112396 3300048925 Bacteria 1783
296 Ga0496123_0045938 3300048926 Bacteria 2967
297 Ga0496124_0133628 3300048927 Bacteria 1967
298 Ga0496125_0125644 3300048928 Bacteria 1818
299 Ga0496125_0178171 3300048928 Bacteria 1420
300 Ga0496125_0733931 3300048928 Bacteria 520
301 Ga0496126_0001352 3300048929 Bacteria 38905
302 Ga0496126_0019190 3300048929 Bacteria 6739
303 Ga0496126_0042793 3300048929 Bacteria 4181
304 Ga0501033_0125892 3300049570 Bacteria 1858
305 Ga0501034_0960637 3300049571 Bacteria 740
306 Ga0501034_1151568 3300049571 Bacteria 655
307 Ga0501070_1126707 3300049586 Bacteria 604
308 Ga0501070_1503127 3300049586 Bacteria 510
309 Ga0501035_0381804 3300049822 Bacteria 1175
310 nmdc:mga03683_228314_c1 3300050489 Bacteria 860
311 nmdc:mga03n38_151056_c1 3300050490 Bacteria 1169
312 nmdc:mga03n38_1586_c1 3300050490 Bacteria 6622
313 nmdc:mga03n38_963_c1 3300050490 Bacteria 7816
314 nmdc:mga00v17_107642_c1 3300050491 Bacteria 1766
315 nmdc:mga00v17_151482_c1 3300050491 Bacteria 1490
316 nmdc:mga00v17_360355_c1 3300050491 Bacteria 945
317 nmdc:mga00v17_39138_c1 3300050491 Bacteria 2838
318 nmdc:mga00v17_849703_c1 3300050491 Bacteria 580
319 nmdc:mga00v17_991640_c1 3300050491 Bacteria 529
320 nmdc:mga0yw44_12173_c1 3300050492 Bacteria 4473
321 nmdc:mga0yw44_229349_c1 3300050492 Bacteria 1232
322 nmdc:mga0k408_71919_c1 3300050493 Bacteria 2019
323 nmdc:mga06z11_294152_c1 3300050494 Bacteria 964
324 nmdc:mga06z11_415937_c1 3300050494 Bacteria 810
325 nmdc:mga04h51_2337_c1 3300050495 Bacteria 4488
326 nmdc:mga07m45_37062_c1 3300050496 Bacteria 2719
327 nmdc:mga0rr50_480481_c1 3300050513 Bacteria 1055
328 nmdc:mga0sz30_121764_c1 3300050516 Bacteria 1147
329 nmdc:mga0sz30_122322_c1 3300050516 Bacteria 1144
330 nmdc:mga0sz30_13521_c1 3300050516 Bacteria 3198
331 nmdc:mga0sz30_19022_c1 3300050516 Bacteria 2754
332 nmdc:mga0sz30_237090_c1 3300050516 Bacteria 812
333 nmdc:mga0sz30_44857_c1 3300050516 Bacteria 1501
334 nmdc:mga0sz30_5995_c1 3300050516 Bacteria 1042
335 Ga0500610_0001300 3300053079 Bacteria 8382
336 Ga0500635_0001120 3300053080 Bacteria 6410
337 Ga0495655_0021551 3300053083 Bacteria 1460
338 Ga0500643_002892 3300053087 Bacteria 8538
339 Ga0500642_0111597 3300053130 Bacteria 1277
340 Ga0500652_000152 3300053131 Bacteria 26371
341 Ga0500559_0069804 3300053136 Bacteria 1580
342 Ga0500561_0124932 3300053137 Bacteria 788
343 Ga0500588_0211286 3300053146 Bacteria 721
344 Ga0500616_0020256 3300053153 Bacteria 3738
345 Ga0500616_0051534 3300053153 Bacteria 2168
346 Ga0500616_0274970 3300053153 Bacteria 709
347 Ga0466962_0018578 3300061719 Bacteria 3344

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005356 Ga0070674_100135817 Ga0070674_1001358172 105
2 3300005455 Ga0070663_100275404 Ga0070663_1002754042 108
3 3300005617 Ga0068859_100549083 Ga0068859_1005490831 108
4 3300006931 Ga0097620_100549087 Ga0097620_1005490871 108
5 3300013307 Ga0157372_12184964 Ga0157372_121849642 108
6 3300025908 Ga0207643_10165395 Ga0207643_101653952 108
7 3300026067 Ga0207678_10271890 Ga0207678_102718902 108
8 3300026121 Ga0207683_10230166 Ga0207683_102301662 108
9 3300048904 Ga0496101_0109478 Ga0496101_0109478_333_704 108
10 3300048905 Ga0496102_0133190 Ga0496102_0133190_944_1315 108
11 3300048909 Ga0496106_0034005 Ga0496106_0034005_626_997 108
12 3300048912 Ga0496109_1222899 Ga0496109_1222899_217_588 108
13 3300048917 Ga0496114_0057228 Ga0496114_0057228_287_658 108
14 3300021384 Ga0213876_10000247 Ga0213876_1000024745 111
15 3300021388 Ga0213875_10017398 Ga0213875_100173984 111
16 3300005353 Ga0070669_100000269 Ga0070669_10000026921 112
17 3300005367 Ga0070667_100000109 Ga0070667_10000010942 112
18 3300005548 Ga0070665_100004708 Ga0070665_10000470811 112
19 3300005617 Ga0068859_100001848 Ga0068859_10000184812 112
20 3300005841 Ga0068863_100000123 Ga0068863_10000012381 112
21 3300005842 Ga0068858_100065006 Ga0068858_1000650065 112
22 3300005843 Ga0068860_100000175 Ga0068860_10000017579 112
23 3300005844 Ga0068862_100000091 Ga0068862_10000009143 112
24 3300006931 Ga0097620_100001848 Ga0097620_10000184812 112
25 3300025900 Ga0207710_10000010 Ga0207710_10000010319 112
26 3300025923 Ga0207681_10000979 Ga0207681_1000097918 112
27 3300025941 Ga0207711_10000422 Ga0207711_1000042237 112
28 3300025961 Ga0207712_10000010 Ga0207712_1000001075 112
29 3300025986 Ga0207658_10000257 Ga0207658_1000025759 112
30 3300026035 Ga0207703_10207039 Ga0207703_102070392 112
31 3300026088 Ga0207641_10002535 Ga0207641_100025356 112
32 3300028379 Ga0268266_10031661 Ga0268266_100316614 112
33 3300028380 Ga0268265_10000105 Ga0268265_1000010574 112
34 3300028381 Ga0268264_10000237 Ga0268264_1000023743 112
35 3300039450 Ga0436363_0269943 Ga0436363_0269943_673_1011 112
36 3300050491 nmdc:mga00v17_360355_c1 nmdc:mga00v17_360355_c1_369_707 112
37 3300041507 Ga0451851_0167029 Ga0451851_0167029_31_396 113
38 iso_pu_bacteria 2808606372 2808899655 113
39 3300005347 Ga0070668_100001588 Ga0070668_10000158813 114
40 3300005367 Ga0070667_100391207 Ga0070667_1003912072 114
41 3300005548 Ga0070665_100985499 Ga0070665_1009854991 114
42 3300005615 Ga0070702_100241547 Ga0070702_1002415472 114
43 3300005844 Ga0068862_101244134 Ga0068862_1012441342 114
44 3300006048 Ga0075363_100564900 Ga0075363_1005649002 114
45 3300006358 Ga0068871_100437488 Ga0068871_1004374882 114
46 3300006881 Ga0068865_100630286 Ga0068865_1006302862 114
47 3300009094 Ga0111539_11650153 Ga0111539_116501531 114
48 3300017792 Ga0163161_10197681 Ga0163161_101976813 114
49 3300025986 Ga0207658_10999088 Ga0207658_109990881 114
50 3300028379 Ga0268266_11261552 Ga0268266_112615521 114
51 3300049571 Ga0501034_0960637 Ga0501034_0960637_57_401 114
52 3300050516 nmdc:mga0sz30_13521_c1 nmdc:mga0sz30_13521_c1_1532_1876 114
53 3300006048 Ga0075363_100300265 Ga0075363_1003002652 115
54 3300005435 Ga0070714_101144369 Ga0070714_1011443692 116
55 3300005937 Ga0081455_10149488 Ga0081455_101494883 116
56 3300025924 Ga0207694_11554693 Ga0207694_115546931 117
57 3300031852 Ga0307410_10407313 Ga0307410_104073132 117
58 3300031901 Ga0307406_10478678 Ga0307406_104786782 117
59 3300031995 Ga0307409_100419744 Ga0307409_1004197442 117
60 3300032126 Ga0307415_102454429 Ga0307415_1024544292 117
61 3300041413 Ga0439465_0165450 Ga0439465_0165450_393_755 117
62 iso_pu_bacteria 2643221687 2644490939 117
63 iso_pu_bacteria 2842134933 2842139457 117
64 iso_pu_bacteria 2902799365 2902803322 117
65 iso_pu_bacteria 2902810491 2902816913 117
66 iso_pu_bacteria 2902837492 2902843913 117
67 iso_pu_bacteria 2939582691 2939584384 117
68 3300006038 Ga0075365_10002159 Ga0075365_100021597 118
69 3300006051 Ga0075364_10846855 Ga0075364_108468551 118
70 3300009148 Ga0105243_10445114 Ga0105243_104451142 118
71 3300025935 Ga0207709_10423197 Ga0207709_104231972 118
72 3300026041 Ga0207639_10169849 Ga0207639_101698493 118
73 3300031911 Ga0307412_11371217 Ga0307412_113712171 118
74 3300041498 Ga0451841_1034574 Ga0451841_1034574_51_407 118
75 3300046507 Ga0495606_0048443 Ga0495606_0048443_2035_2391 118
76 3300046524 Ga0495648_0018036 Ga0495648_0018036_3658_4014 118
77 3300046616 Ga0495668_0013301 Ga0495668_0013301_2970_3326 118
78 3300046692 Ga0495671_0108158 Ga0495671_0108158_318_674 118
79 3300047320 Ga0495672_0012966 Ga0495672_0012966_4806_5162 118
80 3300047469 Ga0495673_0029801 Ga0495673_0029801_961_1317 118
81 3300047472 Ga0495686_0242931 Ga0495686_0242931_464_820 118
82 3300048903 Ga0496100_0001679 Ga0496100_0001679_710_1066 118
83 3300048904 Ga0496101_0000126 Ga0496101_0000126_5446_5802 118
84 3300048907 Ga0496104_0388961 Ga0496104_0388961_76_432 118
85 3300048909 Ga0496106_0014412 Ga0496106_0014412_3748_4104 118
86 3300048909 Ga0496106_0270372 Ga0496106_0270372_684_1061 118
87 3300048910 Ga0496107_0203798 Ga0496107_0203798_435_791 118
88 3300048922 Ga0496119_0000041 Ga0496119_0000041_37968_38324 118
89 3300048922 Ga0496119_0072301 Ga0496119_0072301_1114_1470 118
90 3300048923 Ga0496120_0000027 Ga0496120_0000027_162681_163037 118
91 3300048924 Ga0496121_0000171 Ga0496121_0000171_11847_12203 118
92 3300048929 Ga0496126_0001352 Ga0496126_0001352_31994_32350 118
93 3300050491 nmdc:mga00v17_991640_c1 nmdc:mga00v17_991640_c1_64_420 118
94 3300050496 nmdc:mga07m45_37062_c1 nmdc:mga07m45_37062_c1_524_880 118
95 3300050516 nmdc:mga0sz30_5995_c1 nmdc:mga0sz30_5995_c1_115_471 118
96 3300053087 Ga0500643_002892 Ga0500643_002892_803_1159 118
97 3300053131 Ga0500652_000152 Ga0500652_000152_21908_22264 118
98 3300025223 Ga0207672_1004973 Ga0207672_10049732 119
99 3300026075 Ga0207708_10058233 Ga0207708_100582334 119
100 3300003792 Ga0055540_1008124 Ga0055540_10081244 120
101 3300005337 Ga0070682_100072990 Ga0070682_1000729903 120
102 3300005337 Ga0070682_101195157 Ga0070682_1011951571 120
103 3300005344 Ga0070661_100092532 Ga0070661_1000925324 120
104 3300005347 Ga0070668_101057420 Ga0070668_1010574202 120
105 3300005354 Ga0070675_101245027 Ga0070675_1012450272 120
106 3300005355 Ga0070671_101748037 Ga0070671_1017480372 120
107 3300005356 Ga0070674_101122136 Ga0070674_1011221362 120
108 3300005364 Ga0070673_100316736 Ga0070673_1003167362 120
109 3300005456 Ga0070678_100505260 Ga0070678_1005052602 120
110 3300005530 Ga0070679_100559478 Ga0070679_1005594782 120
111 3300005535 Ga0070684_100390247 Ga0070684_1003902472 120
112 3300005539 Ga0068853_100118208 Ga0068853_1001182084 120
113 3300005547 Ga0070693_100587416 Ga0070693_1005874162 120
114 3300005548 Ga0070665_100742260 Ga0070665_1007422602 120
115 3300005563 Ga0068855_100262107 Ga0068855_1002621073 120
116 3300005564 Ga0070664_100166365 Ga0070664_1001663653 120
117 3300005578 Ga0068854_100193147 Ga0068854_1001931472 120
118 3300005616 Ga0068852_100645813 Ga0068852_1006458132 120
119 3300005618 Ga0068864_100403139 Ga0068864_1004031391 120
120 3300005840 Ga0068870_10118475 Ga0068870_101184751 120
121 3300006038 Ga0075365_10020298 Ga0075365_100202983 120
122 3300006042 Ga0075368_10011590 Ga0075368_100115903 120
123 3300006048 Ga0075363_100002100 Ga0075363_1000021008 120
124 3300006048 Ga0075363_100004912 Ga0075363_1000049124 120
125 3300006048 Ga0075363_100053003 Ga0075363_1000530033 120
126 3300006051 Ga0075364_10013248 Ga0075364_100132483 120
127 3300006051 Ga0075364_10124916 Ga0075364_101249163 120
128 3300006051 Ga0075364_10979725 Ga0075364_109797252 120
129 3300006177 Ga0075362_10616545 Ga0075362_106165451 120
130 3300006178 Ga0075367_10014274 Ga0075367_100142742 120
131 3300006186 Ga0075369_10004539 Ga0075369_100045393 120
132 3300006186 Ga0075369_10005867 Ga0075369_100058672 120
133 3300006186 Ga0075369_10006538 Ga0075369_100065383 120
134 3300006186 Ga0075369_10031457 Ga0075369_100314573 120
135 3300006186 Ga0075369_10037903 Ga0075369_100379035 120
136 3300006186 Ga0075369_10109278 Ga0075369_101092782 120
137 3300006195 Ga0075366_10158237 Ga0075366_101582372 120
138 3300006353 Ga0075370_10002454 Ga0075370_1000245410 120
139 3300007076 Ga0075435_100732918 Ga0075435_1007329182 120
140 3300009093 Ga0105240_12257326 Ga0105240_122573262 120
141 3300009098 Ga0105245_12445248 Ga0105245_124452481 120
142 3300009101 Ga0105247_10000070 Ga0105247_1000007073 120
143 3300009148 Ga0105243_10445355 Ga0105243_104453552 120
144 3300009176 Ga0105242_11304131 Ga0105242_113041311 120
145 3300009177 Ga0105248_10000458 Ga0105248_1000045837 120
146 3300009177 Ga0105248_10162654 Ga0105248_101626542 120
147 3300009177 Ga0105248_11887480 Ga0105248_118874801 120
148 3300009545 Ga0105237_10004358 Ga0105237_100043588 120
149 3300009545 Ga0105237_11998643 Ga0105237_119986432 120
150 3300009553 Ga0105249_10000020 Ga0105249_10000020189 120
151 3300010375 Ga0105239_10004760 Ga0105239_1000476012 120
152 3300012480 Ga0157346_1018531 Ga0157346_10185312 120
153 3300013105 Ga0157369_10797970 Ga0157369_107979702 120
154 3300013306 Ga0163162_10066906 Ga0163162_100669063 120
155 3300013306 Ga0163162_11617093 Ga0163162_116170932 120
156 3300013306 Ga0163162_11804108 Ga0163162_118041082 120
157 3300013307 Ga0157372_10615696 Ga0157372_106156962 120
158 3300013308 Ga0157375_10282860 Ga0157375_102828602 120
159 3300013308 Ga0157375_10410456 Ga0157375_104104563 120
160 3300014325 Ga0163163_10015155 Ga0163163_100151555 120
161 3300014497 Ga0182008_10821971 Ga0182008_108219712 120
162 3300014968 Ga0157379_10057893 Ga0157379_100578932 120
163 3300014968 Ga0157379_11999390 Ga0157379_119993901 120
164 3300021384 Ga0213876_10025624 Ga0213876_100256242 120
165 3300021388 Ga0213875_10017316 Ga0213875_100173163 120
166 3300025273 Ga0209673_1009120 Ga0209673_10091205 120
167 3300025303 Ga0209051_1000516 Ga0209051_100051618 120
168 3300025303 Ga0209051_1000521 Ga0209051_100052141 120
169 3300025303 Ga0209051_1004787 Ga0209051_10047872 120
170 3300025901 Ga0207688_10512942 Ga0207688_105129422 120
171 3300025914 Ga0207671_10019710 Ga0207671_100197105 120
172 3300025926 Ga0207659_11094385 Ga0207659_110943852 120
173 3300025931 Ga0207644_10737662 Ga0207644_107376622 120
174 3300025941 Ga0207711_10661135 Ga0207711_106611352 120
175 3300025949 Ga0207667_10363435 Ga0207667_103634352 120
176 3300025972 Ga0207668_10000336 Ga0207668_1000033630 120
177 3300025981 Ga0207640_10207248 Ga0207640_102072483 120
178 3300026067 Ga0207678_10156359 Ga0207678_101563591 120
179 3300026067 Ga0207678_10249028 Ga0207678_102490282 120
180 3300026095 Ga0207676_10199966 Ga0207676_101999662 120
181 3300028379 Ga0268266_10573173 Ga0268266_105731732 120
182 3300028379 Ga0268266_10972776 Ga0268266_109727761 120
183 3300031852 Ga0307410_10036313 Ga0307410_100363135 120
184 3300031995 Ga0307409_101059830 Ga0307409_1010598302 120
185 3300032126 Ga0307415_100680452 Ga0307415_1006804522 120
186 3300035089 Ga0373944_0070611 Ga0373944_0070611_246_611 120
187 3300035171 Ga0373946_0574324 Ga0373946_0574324_152_517 120
188 3300035725 Ga0373947_0200287 Ga0373947_0200287_454_819 120
189 3300037418 Ga0395900_0731934 Ga0395900_0731934_463_828 120
190 3300037853 Ga0436364_0708750 Ga0436364_0708750_20561_20926 120
191 3300037853 Ga0436364_1476739 Ga0436364_1476739_1825_2187 120
192 3300039437 Ga0436365_0256887 Ga0436365_0256887_297_659 120
193 3300039437 Ga0436365_1665709 Ga0436365_1665709_196_558 120
194 3300039437 Ga0436365_1681922 Ga0436365_1681922_2608_2973 120
195 3300041443 Ga0451789_1193316 Ga0451789_1193316_447_812 120
196 3300041452 Ga0451793_0338240 Ga0451793_0338240_77_442 120
197 3300041452 Ga0451793_0556900 Ga0451793_0556900_1026_1409 120
198 3300041456 Ga0451795_1673907 Ga0451795_1673907_571_936 120
199 3300041486 Ga0451807_1700016 Ga0451807_1700016_235_600 120
200 3300041512 Ga0451853_1021090 Ga0451853_1021090_272_655 120
201 3300041512 Ga0451853_3884224 Ga0451853_3884224_62_463 120
202 3300042438 Ga0439459_0033576 Ga0439459_0033576_628_993 120
203 3300044658 Ga0466972_0005182 Ga0466972_0005182_2712_3077 120
204 3300044658 Ga0466972_0012198 Ga0466972_0012198_1191_1556 120
205 3300044683 Ga0466965_0000450 Ga0466965_0000450_5599_5964 120
206 3300044683 Ga0466965_0002264 Ga0466965_0002264_802_1167 120
207 3300044683 Ga0466965_0155744 Ga0466965_0155744_732_1097 120
208 3300044693 Ga0466961_0737018 Ga0466961_0737018_16_381 120
209 3300044735 Ga0466968_0002855 Ga0466968_0002855_2601_2966 120
210 3300044765 Ga0466970_0107581 Ga0466970_0107581_718_1083 120
211 3300044765 Ga0466970_0237761 Ga0466970_0237761_25_390 120
212 3300044842 Ga0466957_0012856 Ga0466957_0012856_2107_2472 120
213 3300044901 Ga0466960_0002405 Ga0466960_0002405_3389_3754 120
214 3300044901 Ga0466960_0006287 Ga0466960_0006287_3423_3788 120
215 3300045049 Ga0466959_0166372 Ga0466959_0166372_593_958 120
216 3300045836 Ga0466958_0029316 Ga0466958_0029316_2463_2828 120
217 3300045976 Ga0466967_0370275 Ga0466967_0370275_720_1085 120
218 3300046455 Ga0495603_0018759 Ga0495603_0018759_2792_3157 120
219 3300046459 Ga0495629_0017753 Ga0495629_0017753_2472_2837 120
220 3300046460 Ga0495638_0006390 Ga0495638_0006390_4920_5285 120
221 3300046475 Ga0495639_0073673 Ga0495639_0073673_332_697 120
222 3300046511 Ga0495608_0574564 Ga0495608_0574564_85_450 120
223 3300046526 Ga0495666_0080439 Ga0495666_0080439_105_470 120
224 3300046531 Ga0495665_0054360 Ga0495665_0054360_1222_1587 120
225 3300046533 Ga0495640_0041814 Ga0495640_0041814_1261_1626 120
226 3300046642 Ga0495634_0144852 Ga0495634_0144852_355_720 120
227 3300046674 Ga0495588_0271400 Ga0495588_0271400_509_874 120
228 3300046680 Ga0495646_0613389 Ga0495646_0613389_73_438 120
229 3300046683 Ga0495658_0253822 Ga0495658_0253822_297_662 120
230 3300046690 Ga0495624_0038043 Ga0495624_0038043_2389_2754 120
231 3300046694 Ga0495649_0540588 Ga0495649_0540588_148_513 120
232 3300047315 Ga0495581_0042384 Ga0495581_0042384_2134_2499 120
233 3300047319 Ga0495674_0383224 Ga0495674_0383224_701_1066 120
234 3300047320 Ga0495672_0071103 Ga0495672_0071103_1044_1409 120
235 3300047321 Ga0495676_0090968 Ga0495676_0090968_323_688 120
236 3300047472 Ga0495686_0012245 Ga0495686_0012245_402_767 120
237 3300047673 Ga0495593_0020379 Ga0495593_0020379_1120_1485 120
238 3300048091 Ga0495626_0249684 Ga0495626_0249684_122_487 120
239 3300048903 Ga0496100_0006246 Ga0496100_0006246_2029_2394 120
240 3300048903 Ga0496100_0028627 Ga0496100_0028627_20_385 120
241 3300048903 Ga0496100_1088020 Ga0496100_1088020_115_498 120
242 3300048904 Ga0496101_0000416 Ga0496101_0000416_19571_19936 120
243 3300048904 Ga0496101_0002102 Ga0496101_0002102_2685_3050 120
244 3300048904 Ga0496101_0017017 Ga0496101_0017017_4195_4560 120
245 3300048904 Ga0496101_0355120 Ga0496101_0355120_468_833 120
246 3300048905 Ga0496102_0000526 Ga0496102_0000526_18644_19009 120
247 3300048905 Ga0496102_0584877 Ga0496102_0584877_260_625 120
248 3300048905 Ga0496102_0725285 Ga0496102_0725285_231_638 120
249 3300048906 Ga0496103_0000356 Ga0496103_0000356_38438_38803 120
250 3300048906 Ga0496103_0500004 Ga0496103_0500004_167_532 120
251 3300048907 Ga0496104_0002551 Ga0496104_0002551_6717_7082 120
252 3300048908 Ga0496105_0031114 Ga0496105_0031114_425_790 120
253 3300048909 Ga0496106_0003146 Ga0496106_0003146_246_611 120
254 3300048909 Ga0496106_0889475 Ga0496106_0889475_208_573 120
255 3300048910 Ga0496107_0002665 Ga0496107_0002665_8463_8828 120
256 3300048910 Ga0496107_0010487 Ga0496107_0010487_2836_3201 120
257 3300048911 Ga0496108_0036172 Ga0496108_0036172_2765_3148 120
258 3300048911 Ga0496108_0118975 Ga0496108_0118975_54_419 120
259 3300048911 Ga0496108_0705240 Ga0496108_0705240_408_815 120
260 3300048912 Ga0496109_0013709 Ga0496109_0013709_3565_3948 120
261 3300048912 Ga0496109_0185141 Ga0496109_0185141_44_427 120
262 3300048913 Ga0496110_0129410 Ga0496110_0129410_117_500 120
263 3300048914 Ga0496111_0097008 Ga0496111_0097008_995_1378 120
264 3300048915 Ga0496112_0019023 Ga0496112_0019023_4904_5287 120
265 3300048915 Ga0496112_0019077 Ga0496112_0019077_1060_1425 120
266 3300048916 Ga0496113_0006604 Ga0496113_0006604_5645_6010 120
267 3300048917 Ga0496114_0000713 Ga0496114_0000713_12686_13051 120
268 3300048917 Ga0496114_0553733 Ga0496114_0553733_62_427 120
269 3300048917 Ga0496114_0856293 Ga0496114_0856293_191_574 120
270 3300048918 Ga0496115_0002508 Ga0496115_0002508_5936_6301 120
271 3300048918 Ga0496115_1085648 Ga0496115_1085648_105_470 120
272 3300048919 Ga0496116_0008070 Ga0496116_0008070_2559_2924 120
273 3300048920 Ga0496117_0000614 Ga0496117_0000614_27480_27845 120
274 3300048920 Ga0496117_0317924 Ga0496117_0317924_120_485 120
275 3300048921 Ga0496118_0000558 Ga0496118_0000558_35517_35882 120
276 3300048922 Ga0496119_0006840 Ga0496119_0006840_2047_2412 120
277 3300048923 Ga0496120_0008662 Ga0496120_0008662_2522_2887 120
278 3300048923 Ga0496120_0015462 Ga0496120_0015462_3174_3539 120
279 3300048923 Ga0496120_0199447 Ga0496120_0199447_112_474 120
280 3300048924 Ga0496121_0013589 Ga0496121_0013589_6916_7281 120
281 3300048925 Ga0496122_0112396 Ga0496122_0112396_477_842 120
282 3300048926 Ga0496123_0045938 Ga0496123_0045938_1041_1406 120
283 3300048927 Ga0496124_0133628 Ga0496124_0133628_970_1335 120
284 3300048928 Ga0496125_0125644 Ga0496125_0125644_369_734 120
285 3300048928 Ga0496125_0178171 Ga0496125_0178171_318_731 120
286 3300048928 Ga0496125_0733931 Ga0496125_0733931_26_391 120
287 3300048929 Ga0496126_0019190 Ga0496126_0019190_4776_5141 120
288 3300048929 Ga0496126_0042793 Ga0496126_0042793_535_900 120
289 3300049571 Ga0501034_1151568 Ga0501034_1151568_110_475 120
290 3300049586 Ga0501070_1126707 Ga0501070_1126707_165_530 120
291 3300050489 nmdc:mga03683_228314_c1 nmdc:mga03683_228314_c1_376_741 120
292 3300050490 nmdc:mga03n38_151056_c1 nmdc:mga03n38_151056_c1_108_473 120
293 3300050490 nmdc:mga03n38_1586_c1 nmdc:mga03n38_1586_c1_1249_1650 120
294 3300050490 nmdc:mga03n38_963_c1 nmdc:mga03n38_963_c1_5619_6002 120
295 3300050491 nmdc:mga00v17_107642_c1 nmdc:mga00v17_107642_c1_1325_1690 120
296 3300050491 nmdc:mga00v17_151482_c1 nmdc:mga00v17_151482_c1_289_690 120
297 3300050491 nmdc:mga00v17_39138_c1 nmdc:mga00v17_39138_c1_1459_1860 120
298 3300050491 nmdc:mga00v17_849703_c1 nmdc:mga00v17_849703_c1_107_514 120
299 3300050492 nmdc:mga0yw44_12173_c1 nmdc:mga0yw44_12173_c1_3002_3403 120
300 3300050492 nmdc:mga0yw44_229349_c1 nmdc:mga0yw44_229349_c1_457_822 120
301 3300050493 nmdc:mga0k408_71919_c1 nmdc:mga0k408_71919_c1_153_554 120
302 3300050494 nmdc:mga06z11_294152_c1 nmdc:mga06z11_294152_c1_395_760 120
303 3300050494 nmdc:mga06z11_415937_c1 nmdc:mga06z11_415937_c1_238_603 120
304 3300050495 nmdc:mga04h51_2337_c1 nmdc:mga04h51_2337_c1_2604_3005 120
305 3300050513 nmdc:mga0rr50_480481_c1 nmdc:mga0rr50_480481_c1_452_859 120
306 3300050516 nmdc:mga0sz30_121764_c1 nmdc:mga0sz30_121764_c1_589_954 120
307 3300050516 nmdc:mga0sz30_122322_c1 nmdc:mga0sz30_122322_c1_287_652 120
308 3300050516 nmdc:mga0sz30_19022_c1 nmdc:mga0sz30_19022_c1_11_376 120
309 3300050516 nmdc:mga0sz30_237090_c1 nmdc:mga0sz30_237090_c1_212_577 120
310 3300050516 nmdc:mga0sz30_44857_c1 nmdc:mga0sz30_44857_c1_630_995 120
311 3300053079 Ga0500610_0001300 Ga0500610_0001300_5727_6092 120
312 3300053080 Ga0500635_0001120 Ga0500635_0001120_3829_4191 120
313 3300053083 Ga0495655_0021551 Ga0495655_0021551_810_1193 120
314 3300053136 Ga0500559_0069804 Ga0500559_0069804_1167_1532 120
315 3300053146 Ga0500588_0211286 Ga0500588_0211286_342_707 120
316 3300053153 Ga0500616_0020256 Ga0500616_0020256_2412_2777 120
317 3300053153 Ga0500616_0051534 Ga0500616_0051534_901_1266 120
318 3300053153 Ga0500616_0274970 Ga0500616_0274970_11_376 120
319 3300003320 rootH2_10008305 rootH2_100083052 121
320 3300005434 Ga0070709_10968129 Ga0070709_109681292 121
321 3300005435 Ga0070714_100010405 Ga0070714_1000104055 121
322 3300005436 Ga0070713_100131496 Ga0070713_1001314963 121
323 3300005439 Ga0070711_100199257 Ga0070711_1001992573 121
324 3300021441 Ga0213871_10188411 Ga0213871_101884112 121
325 3300025916 Ga0207663_10284488 Ga0207663_102844881 121
326 3300025928 Ga0207700_10564435 Ga0207700_105644352 121
327 3300025929 Ga0207664_10935550 Ga0207664_109355501 121
328 3300039437 Ga0436365_0379597 Ga0436365_0379597_119_484 121
329 3300039437 Ga0436365_1063416 Ga0436365_1063416_1741_2112 121
330 3300039437 Ga0436365_1677737 Ga0436365_1677737_1515_1880 121
331 3300039438 Ga0436360_0316309 Ga0436360_0316309_206_571 121
332 3300039447 Ga0436361_1209801 Ga0436361_1209801_1029_1394 121
333 3300044683 Ga0466965_0040892 Ga0466965_0040892_1790_2155 121
334 3300044683 Ga0466965_0478084 Ga0466965_0478084_247_618 121
335 3300044693 Ga0466961_0039717 Ga0466961_0039717_263_628 121
336 3300044694 Ga0466963_0082714 Ga0466963_0082714_1517_1882 121
337 3300044694 Ga0466963_0259582 Ga0466963_0259582_283_648 121
338 3300044694 Ga0466963_0892795 Ga0466963_0892795_20_385 121
339 3300044719 Ga0466971_0107610 Ga0466971_0107610_227_592 121
340 3300044735 Ga0466968_0319653 Ga0466968_0319653_206_571 121
341 3300044765 Ga0466970_0222048 Ga0466970_0222048_301_666 121
342 3300044842 Ga0466957_0064328 Ga0466957_0064328_935_1300 121
343 3300045049 Ga0466959_0041114 Ga0466959_0041114_551_916 121
344 3300045836 Ga0466958_0005094 Ga0466958_0005094_1804_2169 121
345 3300045836 Ga0466958_0188051 Ga0466958_0188051_623_988 121
346 3300048905 Ga0496102_0021852 Ga0496102_0021852_4678_5043 121
347 3300048920 Ga0496117_0243305 Ga0496117_0243305_21_386 121
348 3300048921 Ga0496118_0001025 Ga0496118_0001025_37448_37813 121
349 3300049570 Ga0501033_0125892 Ga0501033_0125892_1420_1785 121
350 3300049586 Ga0501070_1503127 Ga0501070_1503127_109_474 121
351 3300049822 Ga0501035_0381804 Ga0501035_0381804_325_690 121
352 3300053130 Ga0500642_0111597 Ga0500642_0111597_814_1179 121
353 3300053137 Ga0500561_0124932 Ga0500561_0124932_44_409 121
354 3300061719 Ga0466962_0018578 Ga0466962_0018578_2959_3324 121
355 iso_pu_bacteria 2721755702 2723640236 121
356 iso_pu_bacteria 2935409751 2935412688 121
357 iso_pu_bacteria 2995726249 2995728608 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

17

80

0.98

PF14502

HTH_41

Helix-turn-helix domain

35

80

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wv0-assembly5.cif.gz_I crystal structure of the gntr-hutc family member yvoa from bacillus subtilis 0.9705 8 81
4mgr-assembly1.cif.gz_B the crystal structure of bacillus subtilis gabr, an autorepressor and plp- and gaba-dependent transcriptional activator of gabt 0.9587 7 84
4tv7-assembly1.cif.gz_A crystal structure of bacillus subtilis gabr at 2.05 angstroms resolution 0.9561 7 84
2wv0-assembly3.cif.gz_E crystal structure of the gntr-hutc family member yvoa from bacillus subtilis 0.9526 9 81
4n0b-assembly1.cif.gz_B crystal structure of bacillus subtilis gabr, an autorepressor and transcriptional activator of gabt 0.95 7 84
ID Description Score Start End Superfamily
4hamA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9934 8 81 1.10.10.10
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.976 38 80 1.10.10.10
af_P0ACM5_16_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9664 9 83 1.10.10.10
2wv0D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9659 15 83 1.10.10.10
2wv0I01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9659 15 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0Q6BMQ8-F1-model_v4 GntR family transcriptional regulator 0.9977 6 81 GO:0003677
GO:0003700
GO:0009058
GO:0030170
AF-A0A3D5S2I1-F1-model_v4 GntR family transcriptional regulator 0.9962 3 82 GO:0003677
GO:0003700
GO:0005737
GO:0009058
GO:0030170
AF-A0A0P1IKB2-F1-model_v4 HTH-type transcriptional regulatory protein GabR 0.9944 3 81 GO:0003677
GO:0003700
GO:0009058
GO:0030170
AF-L8JH54-F1-model_v4 Aspartate aminotransferase 0.9944 4 81 GO:0003677
GO:0003700
GO:0005737
GO:0008483
GO:0009058
GO:0030170
AF-A0A3B0RCK2-F1-model_v4 Transcriptional regulator, GntR family domain / Aspartate aminotransferase (EC 2.6.1.1) 0.9931 7 85 GO:0003677
GO:0003700
GO:0004069
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
88.74 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map