F420997

General Info

Members Datasets Scaffolds Average Seq Length
357 232 714 311

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0093690|Ga0501083_0093690_470_1366
Length 298
Sequence MIIANQEDVTQAVLEAFEKTPDPRLREILISMVRHLHDFARDVRLTEEEFQQACNYVRRLGEHSSPSHNEAVLMAGSVGLSALVCLLNNGNNGQTETAANMLGPFWRLNSPRTENGGTIVRSPTPGPILFFGGRVTDIAGQPIADAEIDVWHSSPEGFYENQQEEQADMNLRGKFMTDTDGRFWFRSVKPAGYPIPVDGPVGELVRAAHRPHNMRPAHLHFLMFKPGFKTLISQIYSSDDPHLETDVQFGVTRALIGNYVRNDAGTPPAPDVSPPWYTLEYNFSMERGEARLPRAPIE

Samples

Sample ID Description Type Environment
1 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
133 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
151 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.56
Nodule 0
Rhizoplane 6.44
Rhizosphere 82.91
Stem 0
Stem Tuber 0
Unclassified 3.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501083_0093690 3300049744 Bacteria 1983
2 JGI25153J46596_10001600 3300003215 Bacteria 13420
3 JGI25153J46596_10003919 3300003215 Bacteria 8164
4 Ga0070670_100000540 3300005331 Bacteria 30079
5 Ga0070670_100229823 3300005331 Unclassified 1614
6 Ga0068869_100004793 3300005334 Bacteria 8445
7 Ga0070680_100001601 3300005336 Bacteria 16529
8 Ga0070680_100155586 3300005336 Bacteria 1920
9 Ga0070680_100310212 3300005336 Bacteria 1338
10 Ga0070660_100055913 3300005339 Bacteria 3052
11 Ga0070689_100037414 3300005340 Bacteria 3710
12 Ga0070687_100006472 3300005343 Bacteria 4803
13 Ga0070687_100149178 3300005343 Bacteria 1371
14 Ga0070668_100017277 3300005347 Bacteria 5401
15 Ga0070668_100106465 3300005347 Bacteria 2228
16 Ga0070669_100038189 3300005353 Bacteria 3486
17 Ga0070669_100052415 3300005353 Bacteria 2985
18 Ga0070675_100016718 3300005354 Bacteria 5824
19 Ga0070675_100036686 3300005354 Unclassified 3991
20 Ga0070675_100166519 3300005354 Bacteria 1898
21 Ga0070673_100008006 3300005364 Bacteria 7002
22 Ga0070673_100014811 3300005364 Bacteria 5451
23 Ga0070673_100103964 3300005364 Unclassified 2344
24 Ga0070688_100031851 3300005365 Bacteria 3175
25 Ga0070667_100005867 3300005367 Bacteria 10238
26 Ga0070667_100280274 3300005367 Bacteria 1497
27 Ga0070709_10062207 3300005434 Bacteria 2379
28 Ga0070714_100022293 3300005435 Bacteria 5192
29 Ga0070710_10090326 3300005437 Bacteria 1805
30 Ga0070701_10177632 3300005438 Bacteria 1244
31 Ga0070694_100147267 3300005444 Bacteria 1716
32 Ga0070678_100146333 3300005456 Bacteria 1897
33 Ga0070662_100232689 3300005457 Bacteria 1474
34 Ga0070681_10010586 3300005458 Bacteria 9111
35 Ga0068867_100048445 3300005459 Bacteria 3126
36 Ga0070685_10119051 3300005466 Unclassified 1638
37 Ga0070679_100003445 3300005530 Bacteria 14489
38 Ga0070679_100163327 3300005530 Bacteria 2201
39 Ga0070684_100076935 3300005535 Bacteria 2946
40 Ga0070686_100291806 3300005544 Bacteria 1207
41 Ga0070696_100325460 3300005546 Bacteria 1184
42 Ga0068855_100108815 3300005563 Bacteria 3183
43 Ga0068857_100068429 3300005577 Bacteria 3160
44 Ga0068859_100026283 3300005617 Bacteria 5836
45 Ga0068864_100006870 3300005618 Bacteria 9323
46 Ga0068864_100241384 3300005618 Bacteria 1674
47 Ga0068861_100005808 3300005719 Bacteria 8376
48 Ga0068870_10005864 3300005840 Bacteria 5393
49 Ga0068863_100002393 3300005841 Bacteria 18652
50 Ga0068863_100031755 3300005841 Bacteria 5039
51 Ga0068858_100023919 3300005842 Bacteria 5692
52 Ga0068858_100217583 3300005842 Unclassified 1808
53 Ga0068860_100008174 3300005843 Bacteria 10415
54 Ga0068862_100007616 3300005844 Bacteria 8970
55 Ga0081540_1062032 3300005983 Bacteria 1778
56 Ga0075365_10018542 3300006038 Bacteria 4280
57 Ga0075365_10142632 3300006038 Bacteria 1663
58 Ga0075368_10016955 3300006042 Bacteria 2720
59 Ga0075363_100023423 3300006048 Bacteria 3129
60 Ga0075364_10351689 3300006051 Bacteria 1004
61 Ga0075432_10001662 3300006058 Bacteria 7318
62 Ga0070716_100113736 3300006173 Bacteria 1682
63 Ga0070712_100057869 3300006175 Bacteria 2725
64 Ga0075362_10044807 3300006177 Bacteria 1963
65 Ga0075367_10001694 3300006178 Bacteria 9639
66 Ga0075367_10110363 3300006178 Bacteria 1688
67 Ga0075367_10160518 3300006178 Bacteria 1398
68 Ga0075369_10015294 3300006186 Bacteria 3078
69 Ga0075427_10004931 3300006194 Bacteria 1889
70 Ga0075366_10017536 3300006195 Bacteria 4121
71 Ga0075366_10088320 3300006195 Bacteria 1856
72 Ga0097621_100405933 3300006237 Bacteria 1220
73 Ga0068871_100075676 3300006358 Bacteria 2779
74 Ga0075428_100005389 3300006844 Bacteria 14223
75 Ga0075430_100000426 3300006846 Bacteria 31396
76 Ga0075430_100233706 3300006846 Bacteria 1524
77 Ga0075431_100005525 3300006847 Bacteria 12476
78 Ga0075431_100283098 3300006847 Bacteria 1678
79 Ga0075431_100444885 3300006847 Bacteria 1292
80 Ga0075433_10000029 3300006852 Bacteria 55893
81 Ga0075434_100000208 3300006871 Bacteria 39868
82 Ga0075434_100145541 3300006871 Bacteria 2390
83 Ga0075434_100551250 3300006871 Bacteria 1172
84 Ga0075429_100000734 3300006880 Bacteria 25672
85 Ga0075436_100155597 3300006914 Unclassified 1610
86 Ga0097620_100026283 3300006931 Bacteria 5836
87 Ga0075435_100001396 3300007076 Bacteria 15545
88 Ga0111539_10024789 3300009094 Bacteria 7357
89 Ga0111539_10041707 3300009094 Bacteria 5516
90 Ga0111539_10135445 3300009094 Bacteria 2884
91 Ga0105245_10009182 3300009098 Bacteria 8619
92 Ga0105245_10027296 3300009098 Bacteria 5031
93 Ga0105245_10480295 3300009098 Bacteria 1256
94 Ga0105247_10021978 3300009101 Bacteria 3839
95 Ga0114129_10026249 3300009147 Bacteria 8250
96 Ga0105243_10285205 3300009148 Bacteria 1489
97 Ga0105241_10067669 3300009174 Bacteria 2765
98 Ga0105241_10477851 3300009174 Bacteria 1107
99 Ga0105242_10137252 3300009176 Bacteria 2118
100 Ga0105242_10272304 3300009176 Bacteria 1534
101 Ga0105248_10013485 3300009177 Bacteria 8998
102 Ga0105248_10024707 3300009177 Bacteria 6682
103 Ga0105248_10030403 3300009177 Bacteria 6029
104 Ga0105248_10058682 3300009177 Bacteria 4322
105 Ga0105238_10025592 3300009551 Bacteria 6016
106 Ga0105238_10306706 3300009551 Bacteria 1572
107 Ga0105249_10698139 3300009553 Bacteria 1075
108 Ga0099796_10059953 3300010159 Bacteria 1346
109 Ga0157371_10315062 3300013102 Bacteria 1134
110 Ga0163162_10003700 3300013306 Bacteria 14652
111 Ga0157375_10036814 3300013308 Bacteria 4685
112 Ga0157375_10559546 3300013308 Bacteria 1305
113 Ga0163163_10002854 3300014325 Bacteria 14602
114 Ga0163163_10017727 3300014325 Bacteria 6647
115 Ga0157379_10000497 3300014968 Bacteria 31919
116 Ga0157379_10004869 3300014968 Bacteria 11535
117 Ga0213876_10152721 3300021384 Bacteria 1228
118 Ga0213875_10000046 3300021388 Bacteria 149850
119 Ga0209233_1015279 3300025261 Bacteria 2143
120 Ga0209758_1005734 3300025297 Bacteria 9358
121 Ga0207426_1034764 3300025302 Bacteria 1615
122 Ga0207710_10018199 3300025900 Bacteria 2987
123 Ga0207645_10031160 3300025907 Bacteria 3433
124 Ga0207645_10038921 3300025907 Bacteria 3048
125 Ga0207643_10042310 3300025908 Bacteria 2568
126 Ga0207707_10021068 3300025912 Bacteria 5696
127 Ga0207695_10113772 3300025913 Bacteria 2682
128 Ga0207693_10003273 3300025915 Bacteria 13868
129 Ga0207693_10005987 3300025915 Bacteria 10083
130 Ga0207693_10174965 3300025915 Bacteria 1689
131 Ga0207663_10119286 3300025916 Bacteria 1803
132 Ga0207662_10021699 3300025918 Bacteria 3674
133 Ga0207652_10076990 3300025921 Bacteria 2910
134 Ga0207681_10020177 3300025923 Bacteria 4220
135 Ga0207681_10084115 3300025923 Bacteria 2254
136 Ga0207650_10005387 3300025925 Bacteria 8727
137 Ga0207650_10127246 3300025925 Unclassified 1990
138 Ga0207659_10003162 3300025926 Bacteria 9845
139 Ga0207659_10004197 3300025926 Bacteria 8705
140 Ga0207687_10120118 3300025927 Bacteria 1964
141 Ga0207664_10263153 3300025929 Bacteria 1509
142 Ga0207664_10312304 3300025929 Bacteria 1385
143 Ga0207664_10356549 3300025929 Bacteria 1295
144 Ga0207706_10127813 3300025933 Bacteria 2235
145 Ga0207686_10097621 3300025934 Bacteria 1955
146 Ga0207670_10001103 3300025936 Bacteria 14203
147 Ga0207704_10128465 3300025938 Bacteria 1750
148 Ga0207665_10262163 3300025939 Bacteria 1281
149 Ga0207665_10262444 3300025939 Bacteria 1280
150 Ga0207711_10034011 3300025941 Bacteria 4315
151 Ga0207711_10071720 3300025941 Bacteria 3006
152 Ga0207711_10125497 3300025941 Bacteria 2295
153 Ga0207711_10242089 3300025941 Bacteria 1654
154 Ga0207689_10000556 3300025942 Bacteria 35605
155 Ga0207667_10108748 3300025949 Bacteria 2860
156 Ga0207651_10046401 3300025960 Bacteria 2921
157 Ga0207651_10070543 3300025960 Unclassified 2472
158 Ga0207651_10233702 3300025960 Unclassified 1494
159 Ga0207668_10145078 3300025972 Bacteria 1830
160 Ga0207640_10059588 3300025981 Bacteria 2520
161 Ga0207658_10022716 3300025986 Bacteria 4369
162 Ga0207658_10098577 3300025986 Bacteria 2284
163 Ga0207658_10354417 3300025986 Bacteria 1278
164 Ga0207677_10054923 3300026023 Bacteria 2721
165 Ga0207703_10009598 3300026035 Bacteria 7599
166 Ga0207639_10128552 3300026041 Bacteria 2094
167 Ga0207708_10209638 3300026075 Bacteria 1557
168 Ga0207641_10001278 3300026088 Bacteria 25052
169 Ga0207641_10007062 3300026088 Bacteria 9380
170 Ga0207648_10019467 3300026089 Bacteria 6127
171 Ga0207648_10041396 3300026089 Bacteria 4045
172 Ga0207676_10007295 3300026095 Bacteria 7837
173 Ga0207674_10033635 3300026116 Bacteria 5366
174 Ga0207675_100000530 3300026118 Bacteria 37109
175 Ga0207683_10017868 3300026121 Bacteria 6048
176 Ga0209588_1029921 3300027671 Bacteria 1738
177 Ga0207428_10000360 3300027907 Bacteria 58478
178 Ga0268265_10135860 3300028380 Bacteria 2051
179 Ga0268264_10001980 3300028381 Bacteria 18431
180 Ga0265338_10005297 3300028800 Bacteria 16886
181 Ga0265338_10063295 3300028800 Bacteria 3226
182 Ga0265325_10000300 3300031241 Bacteria 34777
183 Ga0265325_10007726 3300031241 Bacteria 6407
184 Ga0265325_10060807 3300031241 Bacteria 1917
185 Ga0265340_10013459 3300031247 Bacteria 4295
186 Ga0265340_10020807 3300031247 Bacteria 3366
187 Ga0265339_10000024 3300031249 Bacteria 169774
188 Ga0265339_10002222 3300031249 Bacteria 14074
189 Ga0265339_10054189 3300031249 Bacteria 2179
190 Ga0265316_10024190 3300031344 Bacteria 5096
191 Ga0265316_10194613 3300031344 Bacteria 1505
192 Ga0265313_10000006 3300031595 Bacteria 183184
193 Ga0265313_10002651 3300031595 Bacteria 15215
194 Ga0265313_10016592 3300031595 Bacteria 4227
195 Ga0316575_10012444 3300031665 Bacteria 3166
196 Ga0265342_10000011 3300031712 Bacteria 208435
197 Ga0265342_10022097 3300031712 Bacteria 4051
198 Ga0316583_10007818 3300032133 Bacteria 3855
199 Ga0373958_0003514 3300034819 Bacteria 2264
200 Ga0373936_0048317 3300035113 Bacteria 1718
201 Ga0373939_0042587 3300035114 Bacteria 1374
202 Ga0373945_0045489 3300035116 Bacteria 1599
203 Ga0373945_0088585 3300035116 Bacteria 1196
204 Ga0373954_0027512 3300035118 Bacteria 2611
205 Ga0373957_0008622 3300035120 Bacteria 3312
206 Ga0373943_0024601 3300035170 Bacteria 2809
207 Ga0373946_0037161 3300035171 Bacteria 1978
208 Ga0373931_0005266 3300035691 Bacteria 5965
209 Ga0373931_0028508 3300035691 Bacteria 2859
210 Ga0373935_0107247 3300035692 Bacteria 1849
211 Ga0373947_0004876 3300035725 Bacteria 7847
212 Ga0373947_0050384 3300035725 Bacteria 2504
213 Ga0316582_0279042 3300036647 Bacteria 1147
214 Ga0395900_0173465 3300037418 Bacteria 2194
215 Ga0436364_0382187 3300037853 Bacteria 2183
216 Ga0436364_0990934 3300037853 Bacteria 27491
217 Ga0436364_1397229 3300037853 Bacteria 1955
218 Ga0436365_0015204 3300039437 Bacteria 1784
219 Ga0436365_0190718 3300039437 Bacteria 1892
220 Ga0436365_1592753 3300039437 Bacteria 1002
221 Ga0436360_0449203 3300039438 Bacteria 1016
222 Ga0436363_1536086 3300039450 Bacteria 1721
223 Ga0436362_1176514 3300039453 Bacteria 1249
224 Ga0450890_004061 3300042127 Bacteria 1921
225 Ga0453684_0084394 3300044712 Bacteria 3950
226 Ga0495629_0023839 3300046459 Bacteria 4358
227 Ga0495580_0170902 3300046472 Bacteria 1503
228 Ga0495628_0009994 3300046516 Bacteria 8074
229 Ga0495630_0020646 3300046517 Unclassified 4858
230 Ga0495630_0030934 3300046517 Unclassified 3985
231 Ga0495630_0061448 3300046517 Bacteria 2821
232 Ga0495640_0096280 3300046533 Bacteria 1947
233 Ga0495667_0004369 3300046559 Bacteria 9545
234 Ga0495656_0097899 3300046615 Bacteria 1352
235 Ga0495634_0005919 3300046642 Bacteria 9342
236 Ga0495634_0084077 3300046642 Bacteria 2076
237 Ga0495659_0072406 3300046664 Bacteria 1293
238 Ga0495657_0008985 3300046675 Bacteria 7603
239 Ga0495623_0244193 3300046679 Bacteria 1013
240 Ga0495613_0011532 3300046689 Bacteria 6572
241 Ga0495613_0134955 3300046689 Unclassified 1766
242 Ga0495604_0023959 3300047317 Bacteria 4872
243 Ga0495604_0068302 3300047317 Bacteria 2698
244 Ga0495674_0111204 3300047319 Bacteria 2322
245 Ga0495674_0163152 3300047319 Bacteria 1863
246 Ga0495675_0050802 3300047444 Bacteria 2635
247 Ga0495684_0000152 3300047471 Bacteria 51013
248 Ga0496100_0042248 3300048903 Bacteria 2911
249 Ga0496101_0047499 3300048904 Bacteria 3082
250 Ga0496102_0136669 3300048905 Bacteria 2297
251 Ga0496103_0134997 3300048906 Bacteria 1577
252 Ga0496103_0146215 3300048906 Bacteria 1513
253 Ga0496104_0004132 3300048907 Bacteria 12602
254 Ga0496104_0024135 3300048907 Bacteria 5595
255 Ga0496104_0161628 3300048907 Bacteria 2148
256 Ga0496105_0008370 3300048908 Bacteria 8036
257 Ga0496105_0062738 3300048908 Bacteria 3067
258 Ga0496105_0101024 3300048908 Bacteria 2382
259 Ga0496107_0131574 3300048910 Bacteria 1847
260 Ga0496107_0168961 3300048910 Bacteria 1622
261 Ga0496108_0039962 3300048911 Bacteria 3909
262 Ga0496109_0061682 3300048912 Bacteria 3428
263 Ga0496109_0077486 3300048912 Bacteria 3059
264 Ga0496111_0126765 3300048914 Bacteria 1887
265 Ga0496111_0155620 3300048914 Bacteria 1696
266 Ga0496112_0033592 3300048915 Bacteria 4988
267 Ga0496113_0249618 3300048916 Bacteria 1416
268 Ga0496114_0250471 3300048917 Bacteria 1558
269 Ga0496115_0118172 3300048918 Bacteria 2181
270 Ga0496115_0185185 3300048918 Bacteria 1720
271 Ga0496125_0000746 3300048928 Bacteria 53671
272 Ga0496126_0094494 3300048929 Bacteria 2623
273 Ga0501031_0007734 3300049568 Bacteria 6997
274 Ga0501031_0067411 3300049568 Bacteria 2332
275 Ga0501033_0012886 3300049570 Bacteria 6377
276 Ga0501033_0173195 3300049570 Bacteria 1549
277 Ga0501034_0018046 3300049571 Bacteria 7239
278 Ga0501036_0004687 3300049572 Bacteria 11040
279 Ga0501036_0025745 3300049572 Bacteria 4965
280 Ga0501036_0054226 3300049572 Bacteria 3395
281 Ga0501037_0005982 3300049573 Bacteria 8887
282 Ga0501038_0030646 3300049574 Bacteria 4756
283 Ga0501038_0042612 3300049574 Bacteria 3953
284 Ga0501038_0186535 3300049574 Bacteria 1671
285 Ga0501038_0282133 3300049574 Bacteria 1307
286 Ga0501039_0001438 3300049575 Bacteria 17522
287 Ga0501039_0005426 3300049575 Bacteria 9640
288 Ga0501040_0041222 3300049576 Bacteria 3144
289 Ga0501046_0010334 3300049580 Bacteria 8025
290 Ga0501046_0103730 3300049580 Bacteria 2179
291 Ga0501047_0031535 3300049581 Bacteria 5111
292 Ga0501047_0159243 3300049581 Bacteria 2130
293 Ga0501048_0004490 3300049582 Bacteria 10621
294 Ga0501067_0046151 3300049583 Bacteria 2418
295 Ga0501068_0011406 3300049584 Bacteria 5019
296 Ga0501069_0006487 3300049585 Bacteria 6116
297 Ga0501070_0007744 3300049586 Bacteria 9104
298 Ga0501070_0017946 3300049586 Bacteria 5941
299 Ga0501070_0025502 3300049586 Bacteria 4958
300 Ga0501071_0001616 3300049587 Bacteria 13231
301 Ga0501071_0023104 3300049587 Bacteria 4340
302 Ga0501072_0005298 3300049588 Bacteria 9819
303 Ga0501074_0012936 3300049590 Bacteria 6067
304 Ga0501074_0096691 3300049590 Bacteria 2114
305 Ga0501075_0000678 3300049591 Bacteria 21036
306 Ga0501076_0000568 3300049592 Bacteria 23594
307 Ga0501076_0023726 3300049592 Bacteria 4731
308 Ga0501076_0387558 3300049592 Bacteria 1149
309 Ga0501077_0093327 3300049593 Bacteria 1908
310 Ga0501079_0000363 3300049741 Bacteria 29190
311 Ga0501080_0028534 3300049742 Bacteria 5193
312 Ga0501080_0212336 3300049742 Bacteria 1773
313 Ga0501080_0270731 3300049742 Bacteria 1546
314 Ga0501081_0000739 3300049743 Bacteria 19079
315 Ga0501081_0097402 3300049743 Bacteria 2076
316 Ga0501083_0015045 3300049744 Bacteria 5415
317 Ga0501035_0000655 3300049822 Bacteria 38162
318 Ga0501035_0014526 3300049822 Bacteria 7268
319 Ga0501035_0080442 3300049822 Bacteria 2877
320 Ga0501044_0000193 3300049823 Bacteria 76794
321 Ga0501044_0026928 3300049823 Bacteria 6083
322 Ga0501044_0208689 3300049823 Bacteria 1908
323 Ga0501044_0250659 3300049823 Bacteria 1712
324 Ga0501045_0000776 3300049824 Bacteria 20531
325 Ga0501045_0024198 3300049824 Bacteria 4358
326 nmdc:mga03683_43804_c1 3300050489 Bacteria 1848
327 nmdc:mga00v17_134047_c1 3300050491 Bacteria 1585
328 nmdc:mga00v17_69904_c1 3300050491 Bacteria 2174
329 nmdc:mga0k408_1374_c1 3300050493 Bacteria 4153
330 nmdc:mga06z11_17689_c1 3300050494 Bacteria 3241
331 nmdc:mga06z11_60094_c1 3300050494 Bacteria 1977
332 nmdc:mga06z11_71805_c1 3300050494 Bacteria 1834
333 nmdc:mga04h51_16837_c1 3300050495 Bacteria 2128
334 nmdc:mga05p37_26189_c1 3300050507 Bacteria 7091
335 nmdc:mga09592_524_c1 3300050508 Bacteria 28956
336 nmdc:mga0qj67_234092_c1 3300050509 Bacteria 1490
337 nmdc:mga06r32_110582_c1 3300050510 Bacteria 2703
338 nmdc:mga06r32_121_c1 3300050510 Bacteria 55968
339 nmdc:mga06r32_317807_c1 3300050510 Bacteria 1542
340 nmdc:mga08y16_147883_c1 3300050511 Bacteria 2442
341 nmdc:mga08y16_5496_c1 3300050511 Bacteria 13251
342 nmdc:mga0n895_10337_c1 3300050512 Bacteria 8235
343 nmdc:mga0n895_65963_c1 3300050512 Bacteria 3584
344 nmdc:mga0rr50_4404_c1 3300050513 Bacteria 8277
345 nmdc:mga08x19_148150_c1 3300050514 Bacteria 1588
346 nmdc:mga08x19_206814_c1 3300050514 Bacteria 1346
347 nmdc:mga0a205_549_c1 3300050515 Bacteria 29737
348 nmdc:mga0sz30_8006_c1 3300050516 Bacteria 3979
349 Ga0495601_0000788 3300053077 Bacteria 17125
350 Ga0495619_0195492 3300053085 Bacteria 1400
351 Ga0500634_0006979 3300053161 Bacteria 5522
352 Ga0501084_0005189 3300054114 Bacteria 10657
353 Ga0501084_0019048 3300054114 Bacteria 5716
354 Ga0501084_0369647 3300054114 Bacteria 1212
355 Ga0501082_0000476 3300060353 Bacteria 35465
356 Ga0501082_0006937 3300060353 Bacteria 9790
357 Ga0530510_0000124 3300061734 Bacteria 44414
358 Ga0501083_0093690
359 JGI25153J46596_10001600
360 JGI25153J46596_10003919
361 Ga0070670_100000540
362 Ga0070670_100229823
363 Ga0068869_100004793
364 Ga0070680_100001601
365 Ga0070680_100155586
366 Ga0070680_100310212
367 Ga0070660_100055913
368 Ga0070689_100037414
369 Ga0070687_100006472
370 Ga0070687_100149178
371 Ga0070668_100017277
372 Ga0070668_100106465
373 Ga0070669_100038189
374 Ga0070669_100052415
375 Ga0070675_100016718
376 Ga0070675_100036686
377 Ga0070675_100166519
378 Ga0070673_100008006
379 Ga0070673_100014811
380 Ga0070673_100103964
381 Ga0070688_100031851
382 Ga0070667_100005867
383 Ga0070667_100280274
384 Ga0070709_10062207
385 Ga0070714_100022293
386 Ga0070710_10090326
387 Ga0070701_10177632
388 Ga0070694_100147267
389 Ga0070678_100146333
390 Ga0070662_100232689
391 Ga0070681_10010586
392 Ga0068867_100048445
393 Ga0070685_10119051
394 Ga0070679_100003445
395 Ga0070679_100163327
396 Ga0070684_100076935
397 Ga0070686_100291806
398 Ga0070696_100325460
399 Ga0068855_100108815
400 Ga0068857_100068429
401 Ga0068859_100026283
402 Ga0068864_100006870
403 Ga0068864_100241384
404 Ga0068861_100005808
405 Ga0068870_10005864
406 Ga0068863_100002393
407 Ga0068863_100031755
408 Ga0068858_100023919
409 Ga0068858_100217583
410 Ga0068860_100008174
411 Ga0068862_100007616
412 Ga0081540_1062032
413 Ga0075365_10018542
414 Ga0075365_10142632
415 Ga0075368_10016955
416 Ga0075363_100023423
417 Ga0075364_10351689
418 Ga0075432_10001662
419 Ga0070716_100113736
420 Ga0070712_100057869
421 Ga0075362_10044807
422 Ga0075367_10001694
423 Ga0075367_10110363
424 Ga0075367_10160518
425 Ga0075369_10015294
426 Ga0075427_10004931
427 Ga0075366_10017536
428 Ga0075366_10088320
429 Ga0097621_100405933
430 Ga0068871_100075676
431 Ga0075428_100005389
432 Ga0075430_100000426
433 Ga0075430_100233706
434 Ga0075431_100005525
435 Ga0075431_100283098
436 Ga0075431_100444885
437 Ga0075433_10000029
438 Ga0075434_100000208
439 Ga0075434_100145541
440 Ga0075434_100551250
441 Ga0075429_100000734
442 Ga0075436_100155597
443 Ga0097620_100026283
444 Ga0075435_100001396
445 Ga0111539_10024789
446 Ga0111539_10041707
447 Ga0111539_10135445
448 Ga0105245_10009182
449 Ga0105245_10027296
450 Ga0105245_10480295
451 Ga0105247_10021978
452 Ga0114129_10026249
453 Ga0105243_10285205
454 Ga0105241_10067669
455 Ga0105241_10477851
456 Ga0105242_10137252
457 Ga0105242_10272304
458 Ga0105248_10013485
459 Ga0105248_10024707
460 Ga0105248_10030403
461 Ga0105248_10058682
462 Ga0105238_10025592
463 Ga0105238_10306706
464 Ga0105249_10698139
465 Ga0099796_10059953
466 Ga0157371_10315062
467 Ga0163162_10003700
468 Ga0157375_10036814
469 Ga0157375_10559546
470 Ga0163163_10002854
471 Ga0163163_10017727
472 Ga0157379_10000497
473 Ga0157379_10004869
474 Ga0213876_10152721
475 Ga0213875_10000046
476 Ga0209233_1015279
477 Ga0209758_1005734
478 Ga0207426_1034764
479 Ga0207710_10018199
480 Ga0207645_10031160
481 Ga0207645_10038921
482 Ga0207643_10042310
483 Ga0207707_10021068
484 Ga0207695_10113772
485 Ga0207693_10003273
486 Ga0207693_10005987
487 Ga0207693_10174965
488 Ga0207663_10119286
489 Ga0207662_10021699
490 Ga0207652_10076990
491 Ga0207681_10020177
492 Ga0207681_10084115
493 Ga0207650_10005387
494 Ga0207650_10127246
495 Ga0207659_10003162
496 Ga0207659_10004197
497 Ga0207687_10120118
498 Ga0207664_10263153
499 Ga0207664_10312304
500 Ga0207664_10356549
501 Ga0207706_10127813
502 Ga0207686_10097621
503 Ga0207670_10001103
504 Ga0207704_10128465
505 Ga0207665_10262163
506 Ga0207665_10262444
507 Ga0207711_10034011
508 Ga0207711_10071720
509 Ga0207711_10125497
510 Ga0207711_10242089
511 Ga0207689_10000556
512 Ga0207667_10108748
513 Ga0207651_10046401
514 Ga0207651_10070543
515 Ga0207651_10233702
516 Ga0207668_10145078
517 Ga0207640_10059588
518 Ga0207658_10022716
519 Ga0207658_10098577
520 Ga0207658_10354417
521 Ga0207677_10054923
522 Ga0207703_10009598
523 Ga0207639_10128552
524 Ga0207708_10209638
525 Ga0207641_10001278
526 Ga0207641_10007062
527 Ga0207648_10019467
528 Ga0207648_10041396
529 Ga0207676_10007295
530 Ga0207674_10033635
531 Ga0207675_100000530
532 Ga0207683_10017868
533 Ga0209588_1029921
534 Ga0207428_10000360
535 Ga0268265_10135860
536 Ga0268264_10001980
537 Ga0265338_10005297
538 Ga0265338_10063295
539 Ga0265325_10000300
540 Ga0265325_10007726
541 Ga0265325_10060807
542 Ga0265340_10013459
543 Ga0265340_10020807
544 Ga0265339_10000024
545 Ga0265339_10002222
546 Ga0265339_10054189
547 Ga0265316_10024190
548 Ga0265316_10194613
549 Ga0265313_10000006
550 Ga0265313_10002651
551 Ga0265313_10016592
552 Ga0316575_10012444
553 Ga0265342_10000011
554 Ga0265342_10022097
555 Ga0316583_10007818
556 Ga0373958_0003514
557 Ga0373936_0048317
558 Ga0373939_0042587
559 Ga0373945_0045489
560 Ga0373945_0088585
561 Ga0373954_0027512
562 Ga0373957_0008622
563 Ga0373943_0024601
564 Ga0373946_0037161
565 Ga0373931_0005266
566 Ga0373931_0028508
567 Ga0373935_0107247
568 Ga0373947_0004876
569 Ga0373947_0050384
570 Ga0316582_0279042
571 Ga0395900_0173465
572 Ga0436364_0382187
573 Ga0436364_0990934
574 Ga0436364_1397229
575 Ga0436365_0015204
576 Ga0436365_0190718
577 Ga0436365_1592753
578 Ga0436360_0449203
579 Ga0436363_1536086
580 Ga0436362_1176514
581 Ga0450890_004061
582 Ga0453684_0084394
583 Ga0495629_0023839
584 Ga0495580_0170902
585 Ga0495628_0009994
586 Ga0495630_0020646
587 Ga0495630_0030934
588 Ga0495630_0061448
589 Ga0495640_0096280
590 Ga0495667_0004369
591 Ga0495656_0097899
592 Ga0495634_0005919
593 Ga0495634_0084077
594 Ga0495659_0072406
595 Ga0495657_0008985
596 Ga0495623_0244193
597 Ga0495613_0011532
598 Ga0495613_0134955
599 Ga0495604_0023959
600 Ga0495604_0068302
601 Ga0495674_0111204
602 Ga0495674_0163152
603 Ga0495675_0050802
604 Ga0495684_0000152
605 Ga0496100_0042248
606 Ga0496101_0047499
607 Ga0496102_0136669
608 Ga0496103_0134997
609 Ga0496103_0146215
610 Ga0496104_0004132
611 Ga0496104_0024135
612 Ga0496104_0161628
613 Ga0496105_0008370
614 Ga0496105_0062738
615 Ga0496105_0101024
616 Ga0496107_0131574
617 Ga0496107_0168961
618 Ga0496108_0039962
619 Ga0496109_0061682
620 Ga0496109_0077486
621 Ga0496111_0126765
622 Ga0496111_0155620
623 Ga0496112_0033592
624 Ga0496113_0249618
625 Ga0496114_0250471
626 Ga0496115_0118172
627 Ga0496115_0185185
628 Ga0496125_0000746
629 Ga0496126_0094494
630 Ga0501031_0007734
631 Ga0501031_0067411
632 Ga0501033_0012886
633 Ga0501033_0173195
634 Ga0501034_0018046
635 Ga0501036_0004687
636 Ga0501036_0025745
637 Ga0501036_0054226
638 Ga0501037_0005982
639 Ga0501038_0030646
640 Ga0501038_0042612
641 Ga0501038_0186535
642 Ga0501038_0282133
643 Ga0501039_0001438
644 Ga0501039_0005426
645 Ga0501040_0041222
646 Ga0501046_0010334
647 Ga0501046_0103730
648 Ga0501047_0031535
649 Ga0501047_0159243
650 Ga0501048_0004490
651 Ga0501067_0046151
652 Ga0501068_0011406
653 Ga0501069_0006487
654 Ga0501070_0007744
655 Ga0501070_0017946
656 Ga0501070_0025502
657 Ga0501071_0001616
658 Ga0501071_0023104
659 Ga0501072_0005298
660 Ga0501074_0012936
661 Ga0501074_0096691
662 Ga0501075_0000678
663 Ga0501076_0000568
664 Ga0501076_0023726
665 Ga0501076_0387558
666 Ga0501077_0093327
667 Ga0501079_0000363
668 Ga0501080_0028534
669 Ga0501080_0212336
670 Ga0501080_0270731
671 Ga0501081_0000739
672 Ga0501081_0097402
673 Ga0501083_0015045
674 Ga0501035_0000655
675 Ga0501035_0014526
676 Ga0501035_0080442
677 Ga0501044_0000193
678 Ga0501044_0026928
679 Ga0501044_0208689
680 Ga0501044_0250659
681 Ga0501045_0000776
682 Ga0501045_0024198
683 nmdc:mga03683_43804_c1
684 nmdc:mga00v17_134047_c1
685 nmdc:mga00v17_69904_c1
686 nmdc:mga0k408_1374_c1
687 nmdc:mga06z11_17689_c1
688 nmdc:mga06z11_60094_c1
689 nmdc:mga06z11_71805_c1
690 nmdc:mga04h51_16837_c1
691 nmdc:mga05p37_26189_c1
692 nmdc:mga09592_524_c1
693 nmdc:mga0qj67_234092_c1
694 nmdc:mga06r32_110582_c1
695 nmdc:mga06r32_121_c1
696 nmdc:mga06r32_317807_c1
697 nmdc:mga08y16_147883_c1
698 nmdc:mga08y16_5496_c1
699 nmdc:mga0n895_10337_c1
700 nmdc:mga0n895_65963_c1
701 nmdc:mga0rr50_4404_c1
702 nmdc:mga08x19_148150_c1
703 nmdc:mga08x19_206814_c1
704 nmdc:mga0a205_549_c1
705 nmdc:mga0sz30_8006_c1
706 Ga0495601_0000788
707 Ga0495619_0195492
708 Ga0500634_0006979
709 Ga0501084_0005189
710 Ga0501084_0019048
711 Ga0501084_0369647
712 Ga0501082_0000476
713 Ga0501082_0006937
714 Ga0530510_0000124

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04444

Dioxygenase_N

Catechol dioxygenase N terminus

22

96

0.96

PF00775

Dioxygenase_C

Dioxygenase

101

287

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tmx-assembly1.cif.gz_A crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e 0.8858 6 287
1tmx-assembly1.cif.gz_B crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e 0.8841 6 287
4ilt-assembly2.cif.gz_B structure of the dioxygenase domain of sacte_2871, a novel dioxygenase carbohydrate-binding protein fusion from the cellulolytic bacterium streptomyces sp. sirexaa-e 0.8697 96 287
4ilt-assembly2.cif.gz_B structure of the dioxygenase domain of sacte_2871, a novel dioxygenase carbohydrate-binding protein fusion from the cellulolytic bacterium streptomyces sp. sirexaa-e 0.8644 96 287
1tmx-assembly1.cif.gz_B crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e 0.8554 6 287
ID Description Score Start End Superfamily
af_P86029_1_299_2.60.130.10 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8883 7 286 2.60.130.10
1tmxA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8858 6 287 2.60.130.10
af_Q59Z18_7_293_2.60.130.10 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8818 1 284 2.60.130.10
3hhyA02 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8773 97 287 2.60.130.10
4iltA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8665 96 287 2.60.130.10
ID Description Score Start End GO Terms
AF-A0A5E8VIE8-F1-model_v4 Catechol 1,2-dioxygenase 0.9608 1 297 GO:0008199
GO:0009712
GO:0018576
AF-A0A3T1DZV3-F1-model_v4 deleted 0.9607 1 89
AF-A0A5E8VIE8-F1-model_v4 Catechol 1,2-dioxygenase 0.9577 1 297 GO:0008199
GO:0009712
GO:0018576
AF-A5VH88-F1-model_v4 deleted 0.9533 2 297
AF-A5VH88-F1-model_v4 deleted 0.9502 2 297

Map