F420853

General Info

Members Datasets Scaffolds Average Seq Length
357 159 714 283

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10205096|Ga0207646_102050963
Length 309
Sequence LFLSTKRSTVRSAKARRESIPAGFLPESAGIGPKSRFPLDLSDGLALRPRRVRAAWISDVHLGTRGSNAGALLDFLRENEFETLYIVGDLIDIWQLRRGIYWPQQHNDVIQKILRKSRKGTRIVYIPGNHDEMVAGFHGVYGNISIQNHAIHRTAAGQRVLVIHGHELDTVVQNVKWLAFAGDVGYQLLLSLNPLINFVRRRFGLGYWSLSAYAKKRVKDAVSFIGRFEEEMVRYAQTFCVDAVLCGHIHSACVRQIGRLTYYNCGDWVETCSALVEHENGKIDIVNYGPLRFPNQPLKPTRSLEAAAI

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 5.88
Rhizosphere 91.88
Stem 0
Stem Tuber 0
Unclassified 14.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10205096 3300025922 Bacteria 1781
2 MBSR1b_contig_2883371 2162886012 Bacteria 1474
3 rootL2_10211206 3300003322 Bacteria 5410
4 JGI25405J52794_10001788 3300003911 Bacteria 3596
5 JGI25405J52794_10014010 3300003911 Bacteria 1562
6 JGI25405J52794_10018357 3300003911 Bacteria 1396
7 Ga0065703_1019812 3300005272 Bacteria 2369
8 Ga0065704_10160398 3300005289 Bacteria 1354
9 Ga0065712_10086425 3300005290 Bacteria 2637
10 Ga0065712_10124294 3300005290 Bacteria 1628
11 Ga0065712_10151742 3300005290 Bacteria 1364
12 Ga0065715_10042948 3300005293 Bacteria 1173
13 Ga0065715_10232504 3300005293 Unclassified 1228
14 Ga0065707_10007115 3300005295 Bacteria 2417
15 Ga0070658_10092156 3300005327 Bacteria 2498
16 Ga0070676_10002148 3300005328 Bacteria 10039
17 Ga0070676_10027022 3300005328 Bacteria 3252
18 Ga0070676_10207022 3300005328 Bacteria 1289
19 Ga0070683_100233172 3300005329 Bacteria 1750
20 Ga0070690_100075625 3300005330 Unclassified 2195
21 Ga0070670_100006737 3300005331 Bacteria 9740
22 Ga0070670_100015825 3300005331 Bacteria 6473
23 Ga0070670_100112249 3300005331 Bacteria 2349
24 Ga0070670_100209596 3300005331 Bacteria 1694
25 Ga0070666_10012303 3300005335 Bacteria 5393
26 Ga0070666_10077863 3300005335 Bacteria 2263
27 Ga0068868_100003409 3300005338 Bacteria 11058
28 Ga0068868_100012508 3300005338 Bacteria 6206
29 Ga0068868_100101563 3300005338 Bacteria 2328
30 Ga0068868_100144559 3300005338 Bacteria 1955
31 Ga0068868_100480174 3300005338 Bacteria 1085
32 Ga0070689_100015604 3300005340 Bacteria 5543
33 Ga0070689_100077177 3300005340 Bacteria 2611
34 Ga0070689_100442376 3300005340 Unclassified 1105
35 Ga0070661_100068523 3300005344 Bacteria 2608
36 Ga0070668_100002975 3300005347 Bacteria 12528
37 Ga0070668_100105260 3300005347 Bacteria 2240
38 Ga0070668_100225004 3300005347 Bacteria 1549
39 Ga0070668_100322205 3300005347 Bacteria 1301
40 Ga0070669_100003155 3300005353 Bacteria 11852
41 Ga0070669_100019608 3300005353 Bacteria 4830
42 Ga0070669_100204724 3300005353 Bacteria 1554
43 Ga0070669_100328957 3300005353 Bacteria 1236
44 Ga0070675_100010168 3300005354 Bacteria 7339
45 Ga0070675_100023298 3300005354 Bacteria 4949
46 Ga0070675_100102025 3300005354 Bacteria 2417
47 Ga0070675_100340329 3300005354 Bacteria 1329
48 Ga0070671_100005121 3300005355 Bacteria 10439
49 Ga0070671_100039820 3300005355 Bacteria 3901
50 Ga0070671_100170533 3300005355 Bacteria 1840
51 Ga0070674_100022896 3300005356 Bacteria 4033
52 Ga0070674_100053487 3300005356 Bacteria 2788
53 Ga0070673_100007787 3300005364 Bacteria 7090
54 Ga0070673_100104003 3300005364 Unclassified 2344
55 Ga0070673_100465132 3300005364 Bacteria 1139
56 Ga0070688_100005373 3300005365 Bacteria 6739
57 Ga0070659_100245999 3300005366 Bacteria 1481
58 Ga0070667_100023707 3300005367 Bacteria 5094
59 Ga0070667_100039689 3300005367 Bacteria 3946
60 Ga0070667_100071176 3300005367 Bacteria 2961
61 Ga0070667_100544480 3300005367 Bacteria 1066
62 Ga0070709_10381567 3300005434 Bacteria 1048
63 Ga0070714_100042541 3300005435 Bacteria 3839
64 Ga0070714_100099938 3300005435 Bacteria 2554
65 Ga0070714_100476786 3300005435 Bacteria 1188
66 Ga0070711_100313260 3300005439 Bacteria 1251
67 Ga0070708_100018385 3300005445 Bacteria 5851
68 Ga0070708_100078645 3300005445 Bacteria 2982
69 Ga0070708_100169827 3300005445 Bacteria 2036
70 Ga0070708_100217187 3300005445 Bacteria 1792
71 Ga0070708_100351390 3300005445 Bacteria 1389
72 Ga0070708_100458559 3300005445 Bacteria 1202
73 Ga0070663_100107988 3300005455 Bacteria 2087
74 Ga0070678_100135215 3300005456 Bacteria 1965
75 Ga0070662_100243937 3300005457 Bacteria 1442
76 Ga0068867_100356594 3300005459 Bacteria 1222
77 Ga0070706_100000286 3300005467 Bacteria 61351
78 Ga0070706_100020243 3300005467 Bacteria 6132
79 Ga0070706_100023572 3300005467 Bacteria 5666
80 Ga0070706_100046759 3300005467 Unclassified 3995
81 Ga0070706_100057064 3300005467 Bacteria 3602
82 Ga0070706_100059108 3300005467 Unclassified 3538
83 Ga0070706_100162043 3300005467 Unclassified 2089
84 Ga0070706_100357698 3300005467 Bacteria 1361
85 Ga0070707_100000049 3300005468 Bacteria 102972
86 Ga0070707_100007862 3300005468 Bacteria 9901
87 Ga0070707_100028100 3300005468 Bacteria 5351
88 Ga0070707_100056677 3300005468 Bacteria 3759
89 Ga0070707_100167526 3300005468 Bacteria 2141
90 Ga0070707_100196849 3300005468 Bacteria 1964
91 Ga0070707_100226825 3300005468 Unclassified 1819
92 Ga0070707_100300628 3300005468 Bacteria 1559
93 Ga0070698_100003008 3300005471 Bacteria 18566
94 Ga0070698_100006750 3300005471 Bacteria 12441
95 Ga0070698_100085095 3300005471 Bacteria 3150
96 Ga0070698_100218724 3300005471 Unclassified 1839
97 Ga0070699_100040579 3300005518 Bacteria 4030
98 Ga0070699_100323372 3300005518 Unclassified 1387
99 Ga0070697_100015024 3300005536 Bacteria 6077
100 Ga0070697_100018778 3300005536 Bacteria 5455
101 Ga0070697_100052099 3300005536 Bacteria 3326
102 Ga0070697_100054816 3300005536 Bacteria 3241
103 Ga0070697_100058782 3300005536 Unclassified 3129
104 Ga0070697_100292646 3300005536 Bacteria 1399
105 Ga0070697_100348475 3300005536 Unclassified 1279
106 Ga0070697_100572478 3300005536 Unclassified 991
107 Ga0070672_100004471 3300005543 Bacteria 9158
108 Ga0070695_100257829 3300005545 Unclassified 1272
109 Ga0070665_100072432 3300005548 Bacteria 3453
110 Ga0070665_100345161 3300005548 Bacteria 1494
111 Ga0070664_100022085 3300005564 Bacteria 5248
112 Ga0068866_10105716 3300005718 Bacteria 1561
113 Ga0068863_100081564 3300005841 Bacteria 3064
114 Ga0068863_100083662 3300005841 Bacteria 3024
115 Ga0068858_100176233 3300005842 Bacteria 2018
116 Ga0068858_100209159 3300005842 Bacteria 1846
117 Ga0068858_100471572 3300005842 Bacteria 1211
118 Ga0068860_100000575 3300005843 Bacteria 44198
119 Ga0068862_100351126 3300005844 Bacteria 1368
120 Ga0081455_10001685 3300005937 Bacteria 26794
121 Ga0081455_10004706 3300005937 Bacteria 15174
122 Ga0081455_10010335 3300005937 Bacteria 9484
123 Ga0081455_10308255 3300005937 Bacteria 1133
124 Ga0081540_1000020 3300005983 Bacteria 163043
125 Ga0081540_1018307 3300005983 Bacteria 4302
126 Ga0081539_10001203 3300005985 Bacteria 46667
127 Ga0081539_10007297 3300005985 Bacteria 10147
128 Ga0081539_10042306 3300005985 Bacteria 2655
129 Ga0081539_10083872 3300005985 Bacteria 1667
130 Ga0070717_10009885 3300006028 Bacteria 7185
131 Ga0070717_10034604 3300006028 Bacteria 4085
132 Ga0070717_10608536 3300006028 Bacteria 991
133 Ga0070715_10106990 3300006163 Bacteria 1313
134 Ga0070716_100067347 3300006173 Unclassified 2092
135 Ga0070712_100012785 3300006175 Bacteria 5342
136 Ga0070712_100240673 3300006175 Bacteria 1441
137 Ga0097621_100056498 3300006237 Bacteria 3207
138 Ga0097621_100165693 3300006237 Bacteria 1903
139 Ga0097621_100330771 3300006237 Bacteria 1351
140 Ga0068871_100068587 3300006358 Bacteria 2912
141 Ga0068871_100077596 3300006358 Unclassified 2746
142 Ga0068871_100094861 3300006358 Bacteria 2491
143 Ga0068871_100364736 3300006358 Bacteria 1280
144 Ga0075428_100354267 3300006844 Bacteria 1575
145 Ga0068865_100012642 3300006881 Bacteria 5319
146 Ga0105240_10000018 3300009093 Bacteria 434461
147 Ga0105240_10115641 3300009093 Bacteria 3238
148 Ga0105240_11001011 3300009093 Bacteria 894
149 Ga0105245_10021894 3300009098 Bacteria 5609
150 Ga0105245_10078710 3300009098 Bacteria 3009
151 Ga0114129_10028457 3300009147 Bacteria 7919
152 Ga0114129_10503995 3300009147 Bacteria 1581
153 Ga0105243_10181572 3300009148 Bacteria 1830
154 Ga0105242_10005489 3300009176 Bacteria 9790
155 Ga0105242_10045861 3300009176 Unclassified 3544
156 Ga0105237_10013346 3300009545 Bacteria 8618
157 Ga0105237_10090805 3300009545 Bacteria 3043
158 Ga0105237_10097635 3300009545 Bacteria 2928
159 Ga0105237_10684870 3300009545 Unclassified 1032
160 Ga0105249_10051374 3300009553 Bacteria 3760
161 Ga0105239_10035084 3300010375 Bacteria 5509
162 Ga0105239_10042630 3300010375 Bacteria 4972
163 Ga0105239_10333064 3300010375 Unclassified 1712
164 Ga0105239_10914058 3300010375 Bacteria 1007
165 Ga0157373_10146099 3300013100 Bacteria 1663
166 Ga0157374_10000059 3300013296 Bacteria 116409
167 Ga0157374_10010780 3300013296 Bacteria 7879
168 Ga0157374_10051161 3300013296 Bacteria 3843
169 Ga0157374_10067419 3300013296 Bacteria 3364
170 Ga0157374_10126218 3300013296 Bacteria 2473
171 Ga0157374_10338975 3300013296 Bacteria 1492
172 Ga0157378_10014852 3300013297 Bacteria 6815
173 Ga0157378_10061242 3300013297 Bacteria 3358
174 Ga0157378_10416080 3300013297 Bacteria 1328
175 Ga0157378_10444175 3300013297 Unclassified 1286
176 Ga0163162_10021631 3300013306 Bacteria 6336
177 Ga0163162_10028921 3300013306 Bacteria 5485
178 Ga0163162_10033256 3300013306 Bacteria 5123
179 Ga0163162_10165272 3300013306 Bacteria 2336
180 Ga0163162_10620937 3300013306 Unclassified 1206
181 Ga0157372_10095360 3300013307 Bacteria 3390
182 Ga0157372_10100352 3300013307 Bacteria 3303
183 Ga0157372_10224202 3300013307 Bacteria 2179
184 Ga0157375_10001276 3300013308 Bacteria 21782
185 Ga0157375_10008032 3300013308 Bacteria 9238
186 Ga0157375_10321529 3300013308 Bacteria 1712
187 Ga0157375_10407987 3300013308 Bacteria 1525
188 Ga0163163_10196795 3300014325 Bacteria 2064
189 Ga0157376_10000391 3300014969 Bacteria 28424
190 Ga0157376_10481532 3300014969 Unclassified 1216
191 Ga0157376_10514522 3300014969 Bacteria 1179
192 Ga0213876_10014278 3300021384 Bacteria 4210
193 Ga0213876_10135564 3300021384 Bacteria 1309
194 Ga0209050_1000908 3300025298 Bacteria 39172
195 Ga0207697_10000481 3300025315 Bacteria 22553
196 Ga0207697_10002304 3300025315 Bacteria 9965
197 Ga0207697_10006073 3300025315 Bacteria 5520
198 Ga0207697_10008502 3300025315 Bacteria 4486
199 Ga0207697_10012749 3300025315 Bacteria 3518
200 Ga0207642_10010973 3300025899 Bacteria 3216
201 Ga0207642_10104183 3300025899 Bacteria 1431
202 Ga0207688_10008548 3300025901 Bacteria 5573
203 Ga0207688_10015082 3300025901 Bacteria 4192
204 Ga0207680_10049078 3300025903 Bacteria 2510
205 Ga0207680_10111020 3300025903 Bacteria 1778
206 Ga0207680_10112870 3300025903 Bacteria 1766
207 Ga0207685_10078122 3300025905 Bacteria 1362
208 Ga0207699_10430518 3300025906 Bacteria 944
209 Ga0207645_10008160 3300025907 Bacteria 7334
210 Ga0207645_10008668 3300025907 Bacteria 7085
211 Ga0207645_10011693 3300025907 Bacteria 5984
212 Ga0207645_10013449 3300025907 Bacteria 5513
213 Ga0207645_10101249 3300025907 Unclassified 1859
214 Ga0207705_10037936 3300025909 Bacteria 3448
215 Ga0207684_10000361 3300025910 Bacteria 61371
216 Ga0207684_10003031 3300025910 Bacteria 16647
217 Ga0207684_10016918 3300025910 Bacteria 6264
218 Ga0207684_10022205 3300025910 Bacteria 5420
219 Ga0207684_10047005 3300025910 Bacteria 3661
220 Ga0207684_10068213 3300025910 Unclassified 3022
221 Ga0207684_10256733 3300025910 Bacteria 1508
222 Ga0207684_10389225 3300025910 Unclassified 1199
223 Ga0207695_10000141 3300025913 Bacteria 215831
224 Ga0207695_10089538 3300025913 Bacteria 3094
225 Ga0207671_10027081 3300025914 Bacteria 4288
226 Ga0207671_10421944 3300025914 Unclassified 1061
227 Ga0207693_10009490 3300025915 Bacteria 7924
228 Ga0207693_10027791 3300025915 Unclassified 4471
229 Ga0207663_10162613 3300025916 Bacteria 1578
230 Ga0207663_10272489 3300025916 Bacteria 1254
231 Ga0207662_10000246 3300025918 Bacteria 25081
232 Ga0207657_10220497 3300025919 Bacteria 1520
233 Ga0207657_10235583 3300025919 Bacteria 1463
234 Ga0207646_10000761 3300025922 Bacteria 41842
235 Ga0207646_10002931 3300025922 Bacteria 19783
236 Ga0207646_10022025 3300025922 Bacteria 5880
237 Ga0207646_10068875 3300025922 Bacteria 3160
238 Ga0207646_10259066 3300025922 Bacteria 1572
239 Ga0207681_10006708 3300025923 Bacteria 7064
240 Ga0207681_10013001 3300025923 Bacteria 5146
241 Ga0207681_10310237 3300025923 Bacteria 1251
242 Ga0207650_10188613 3300025925 Bacteria 1646
243 Ga0207650_10304086 3300025925 Bacteria 1303
244 Ga0207659_10032627 3300025926 Bacteria 3576
245 Ga0207659_10041932 3300025926 Bacteria 3207
246 Ga0207659_10104140 3300025926 Bacteria 2146
247 Ga0207659_10234988 3300025926 Bacteria 1480
248 Ga0207659_10256007 3300025926 Bacteria 1422
249 Ga0207700_10072398 3300025928 Unclassified 2657
250 Ga0207700_10224308 3300025928 Unclassified 1595
251 Ga0207664_10271891 3300025929 Bacteria 1485
252 Ga0207644_10095205 3300025931 Bacteria 2226
253 Ga0207644_10097838 3300025931 Bacteria 2198
254 Ga0207706_10001969 3300025933 Bacteria 20134
255 Ga0207686_10057449 3300025934 Bacteria 2450
256 Ga0207670_10121468 3300025936 Bacteria 1899
257 Ga0207669_10007767 3300025937 Bacteria 4989
258 Ga0207665_10028866 3300025939 Unclassified 3667
259 Ga0207665_10045264 3300025939 Bacteria 2947
260 Ga0207665_10086607 3300025939 Bacteria 2164
261 Ga0207665_10367181 3300025939 Bacteria 1089
262 Ga0207691_10000149 3300025940 Bacteria 64627
263 Ga0207691_10012613 3300025940 Bacteria 8100
264 Ga0207691_10188938 3300025940 Bacteria 1797
265 Ga0207689_10049961 3300025942 Bacteria 3450
266 Ga0207679_10126963 3300025945 Bacteria 2040
267 Ga0207667_10004042 3300025949 Bacteria 18023
268 Ga0207651_10075418 3300025960 Unclassified 2406
269 Ga0207668_10015872 3300025972 Bacteria 4689
270 Ga0207668_10016490 3300025972 Bacteria 4612
271 Ga0207658_10018453 3300025986 Bacteria 4818
272 Ga0207658_10019081 3300025986 Bacteria 4742
273 Ga0207658_10032527 3300025986 Unclassified 3712
274 Ga0207658_10050463 3300025986 Bacteria 3062
275 Ga0207658_10060234 3300025986 Bacteria 2831
276 Ga0207677_10055998 3300026023 Bacteria 2699
277 Ga0207677_10064898 3300026023 Bacteria 2545
278 Ga0207677_10315308 3300026023 Bacteria 1297
279 Ga0207677_10321233 3300026023 Bacteria 1286
280 Ga0207703_10017898 3300026035 Bacteria 5534
281 Ga0207703_10095372 3300026035 Bacteria 2509
282 Ga0207703_10297441 3300026035 Bacteria 1471
283 Ga0207639_10000127 3300026041 Bacteria 56027
284 Ga0207639_10117376 3300026041 Bacteria 2180
285 Ga0207639_10301080 3300026041 Bacteria 1417
286 Ga0207678_10204692 3300026067 Bacteria 1688
287 Ga0207641_10042842 3300026088 Bacteria 3799
288 Ga0207641_10092353 3300026088 Bacteria 2651
289 Ga0207648_10004203 3300026089 Bacteria 14883
290 Ga0207648_10191314 3300026089 Bacteria 1813
291 Ga0207675_100378229 3300026118 Bacteria 1392
292 Ga0207683_10003001 3300026121 Bacteria 14738
293 Ga0207683_10007229 3300026121 Bacteria 9518
294 Ga0207683_10042463 3300026121 Bacteria 3972
295 Ga0207683_10058685 3300026121 Unclassified 3379
296 Ga0268266_10118286 3300028379 Unclassified 2355
297 Ga0268266_10211022 3300028379 Unclassified 1781
298 Ga0268266_10238366 3300028379 Bacteria 1678
299 Ga0268265_10026207 3300028380 Bacteria 4145
300 Ga0268265_10338489 3300028380 Bacteria 1369
301 Ga0268264_10000163 3300028381 Bacteria 148007
302 Ga0268264_10013120 3300028381 Bacteria 6814
303 Ga0268264_10068213 3300028381 Bacteria 3005
304 Ga0307513_10035296 3300031456 Bacteria 5596
305 Ga0373926_0132875 3300035083 Bacteria 943
306 Ga0373923_0078588 3300035111 Bacteria 1428
307 Ga0373945_0066597 3300035116 Bacteria 1355
308 Ga0373931_0056331 3300035691 Bacteria 2106
309 Ga0373935_0153389 3300035692 Bacteria 1565
310 Ga0373937_0086296 3300036401 Bacteria 2904
311 Ga0373925_0201972 3300037068 Bacteria 1581
312 Ga0395900_0045105 3300037418 Unclassified 4541
313 Ga0395898_0128370 3300037466 Unclassified 2429
314 Ga0395901_0169477 3300038443 Unclassified 2291
315 Ga0395901_0202944 3300038443 Bacteria 2078
316 Ga0436365_0178835 3300039437 Bacteria 16798
317 Ga0436365_0428430 3300039437 Bacteria 9841
318 Ga0436365_0997917 3300039437 Bacteria 1866
319 Ga0451576_0198339 3300045051 Bacteria 2096
320 Ga0451576_0259709 3300045051 Unclassified 1815
321 Ga0495651_0097773 3300046462 Unclassified 2191
322 Ga0495628_0130309 3300046516 Unclassified 1924
323 Ga0495659_0125201 3300046664 Bacteria 1015
324 Ga0495658_0008974 3300046683 Bacteria 4970
325 Ga0495658_0135489 3300046683 Unclassified 1502
326 Ga0495669_0017485 3300046684 Bacteria 3078
327 Ga0495675_0016591 3300047444 Bacteria 4659
328 Ga0495684_0023585 3300047471 Unclassified 4731
329 Ga0496100_0226684 3300048903 Bacteria 1373
330 Ga0496101_0061747 3300048904 Bacteria 2722
331 Ga0496104_0210032 3300048907 Bacteria 1858
332 Ga0496106_0063170 3300048909 Unclassified 2813
333 Ga0496107_0018621 3300048910 Unclassified 4891
334 Ga0496108_0115881 3300048911 Bacteria 2295
335 Ga0496108_0141972 3300048911 Bacteria 2069
336 Ga0496108_0291408 3300048911 Bacteria 1421
337 Ga0496109_0043926 3300048912 Bacteria 4052
338 Ga0496109_0109490 3300048912 Bacteria 2568
339 Ga0496109_0341902 3300048912 Bacteria 1413
340 Ga0496110_0161583 3300048913 Bacteria 2031
341 Ga0496112_0069083 3300048915 Bacteria 3490
342 Ga0496112_0139946 3300048915 Bacteria 2390
343 Ga0496112_0168924 3300048915 Bacteria 2153
344 Ga0496112_0234652 3300048915 Unclassified 1788
345 Ga0496112_0251685 3300048915 Unclassified 1717
346 Ga0496113_0061502 3300048916 Bacteria 2834
347 Ga0496113_0091521 3300048916 Unclassified 2345
348 Ga0496115_0034396 3300048918 Bacteria 4005
349 Ga0496115_0174487 3300048918 Bacteria 1777
350 Ga0501080_0017977 3300049742 Bacteria 6545
351 nmdc:mga05p37_873790_c1 3300050507 Unclassified 973
352 nmdc:mga06r32_450608_c1 3300050510 Bacteria 1266
353 nmdc:mga0n895_711421_c1 3300050512 Unclassified 1000
354 nmdc:mga0n895_88553_c1 3300050512 Bacteria 3095
355 nmdc:mga08x19_25536_c1 3300050514 Bacteria 3680
356 nmdc:mga08x19_350911_c1 3300050514 Bacteria 1030
357 Ga0495601_0054172 3300053077 Bacteria 2537
358 Ga0207646_10205096
359 MBSR1b_contig_2883371
360 rootL2_10211206
361 JGI25405J52794_10001788
362 JGI25405J52794_10014010
363 JGI25405J52794_10018357
364 Ga0065703_1019812
365 Ga0065704_10160398
366 Ga0065712_10086425
367 Ga0065712_10124294
368 Ga0065712_10151742
369 Ga0065715_10042948
370 Ga0065715_10232504
371 Ga0065707_10007115
372 Ga0070658_10092156
373 Ga0070676_10002148
374 Ga0070676_10027022
375 Ga0070676_10207022
376 Ga0070683_100233172
377 Ga0070690_100075625
378 Ga0070670_100006737
379 Ga0070670_100015825
380 Ga0070670_100112249
381 Ga0070670_100209596
382 Ga0070666_10012303
383 Ga0070666_10077863
384 Ga0068868_100003409
385 Ga0068868_100012508
386 Ga0068868_100101563
387 Ga0068868_100144559
388 Ga0068868_100480174
389 Ga0070689_100015604
390 Ga0070689_100077177
391 Ga0070689_100442376
392 Ga0070661_100068523
393 Ga0070668_100002975
394 Ga0070668_100105260
395 Ga0070668_100225004
396 Ga0070668_100322205
397 Ga0070669_100003155
398 Ga0070669_100019608
399 Ga0070669_100204724
400 Ga0070669_100328957
401 Ga0070675_100010168
402 Ga0070675_100023298
403 Ga0070675_100102025
404 Ga0070675_100340329
405 Ga0070671_100005121
406 Ga0070671_100039820
407 Ga0070671_100170533
408 Ga0070674_100022896
409 Ga0070674_100053487
410 Ga0070673_100007787
411 Ga0070673_100104003
412 Ga0070673_100465132
413 Ga0070688_100005373
414 Ga0070659_100245999
415 Ga0070667_100023707
416 Ga0070667_100039689
417 Ga0070667_100071176
418 Ga0070667_100544480
419 Ga0070709_10381567
420 Ga0070714_100042541
421 Ga0070714_100099938
422 Ga0070714_100476786
423 Ga0070711_100313260
424 Ga0070708_100018385
425 Ga0070708_100078645
426 Ga0070708_100169827
427 Ga0070708_100217187
428 Ga0070708_100351390
429 Ga0070708_100458559
430 Ga0070663_100107988
431 Ga0070678_100135215
432 Ga0070662_100243937
433 Ga0068867_100356594
434 Ga0070706_100000286
435 Ga0070706_100020243
436 Ga0070706_100023572
437 Ga0070706_100046759
438 Ga0070706_100057064
439 Ga0070706_100059108
440 Ga0070706_100162043
441 Ga0070706_100357698
442 Ga0070707_100000049
443 Ga0070707_100007862
444 Ga0070707_100028100
445 Ga0070707_100056677
446 Ga0070707_100167526
447 Ga0070707_100196849
448 Ga0070707_100226825
449 Ga0070707_100300628
450 Ga0070698_100003008
451 Ga0070698_100006750
452 Ga0070698_100085095
453 Ga0070698_100218724
454 Ga0070699_100040579
455 Ga0070699_100323372
456 Ga0070697_100015024
457 Ga0070697_100018778
458 Ga0070697_100052099
459 Ga0070697_100054816
460 Ga0070697_100058782
461 Ga0070697_100292646
462 Ga0070697_100348475
463 Ga0070697_100572478
464 Ga0070672_100004471
465 Ga0070695_100257829
466 Ga0070665_100072432
467 Ga0070665_100345161
468 Ga0070664_100022085
469 Ga0068866_10105716
470 Ga0068863_100081564
471 Ga0068863_100083662
472 Ga0068858_100176233
473 Ga0068858_100209159
474 Ga0068858_100471572
475 Ga0068860_100000575
476 Ga0068862_100351126
477 Ga0081455_10001685
478 Ga0081455_10004706
479 Ga0081455_10010335
480 Ga0081455_10308255
481 Ga0081540_1000020
482 Ga0081540_1018307
483 Ga0081539_10001203
484 Ga0081539_10007297
485 Ga0081539_10042306
486 Ga0081539_10083872
487 Ga0070717_10009885
488 Ga0070717_10034604
489 Ga0070717_10608536
490 Ga0070715_10106990
491 Ga0070716_100067347
492 Ga0070712_100012785
493 Ga0070712_100240673
494 Ga0097621_100056498
495 Ga0097621_100165693
496 Ga0097621_100330771
497 Ga0068871_100068587
498 Ga0068871_100077596
499 Ga0068871_100094861
500 Ga0068871_100364736
501 Ga0075428_100354267
502 Ga0068865_100012642
503 Ga0105240_10000018
504 Ga0105240_10115641
505 Ga0105240_11001011
506 Ga0105245_10021894
507 Ga0105245_10078710
508 Ga0114129_10028457
509 Ga0114129_10503995
510 Ga0105243_10181572
511 Ga0105242_10005489
512 Ga0105242_10045861
513 Ga0105237_10013346
514 Ga0105237_10090805
515 Ga0105237_10097635
516 Ga0105237_10684870
517 Ga0105249_10051374
518 Ga0105239_10035084
519 Ga0105239_10042630
520 Ga0105239_10333064
521 Ga0105239_10914058
522 Ga0157373_10146099
523 Ga0157374_10000059
524 Ga0157374_10010780
525 Ga0157374_10051161
526 Ga0157374_10067419
527 Ga0157374_10126218
528 Ga0157374_10338975
529 Ga0157378_10014852
530 Ga0157378_10061242
531 Ga0157378_10416080
532 Ga0157378_10444175
533 Ga0163162_10021631
534 Ga0163162_10028921
535 Ga0163162_10033256
536 Ga0163162_10165272
537 Ga0163162_10620937
538 Ga0157372_10095360
539 Ga0157372_10100352
540 Ga0157372_10224202
541 Ga0157375_10001276
542 Ga0157375_10008032
543 Ga0157375_10321529
544 Ga0157375_10407987
545 Ga0163163_10196795
546 Ga0157376_10000391
547 Ga0157376_10481532
548 Ga0157376_10514522
549 Ga0213876_10014278
550 Ga0213876_10135564
551 Ga0209050_1000908
552 Ga0207697_10000481
553 Ga0207697_10002304
554 Ga0207697_10006073
555 Ga0207697_10008502
556 Ga0207697_10012749
557 Ga0207642_10010973
558 Ga0207642_10104183
559 Ga0207688_10008548
560 Ga0207688_10015082
561 Ga0207680_10049078
562 Ga0207680_10111020
563 Ga0207680_10112870
564 Ga0207685_10078122
565 Ga0207699_10430518
566 Ga0207645_10008160
567 Ga0207645_10008668
568 Ga0207645_10011693
569 Ga0207645_10013449
570 Ga0207645_10101249
571 Ga0207705_10037936
572 Ga0207684_10000361
573 Ga0207684_10003031
574 Ga0207684_10016918
575 Ga0207684_10022205
576 Ga0207684_10047005
577 Ga0207684_10068213
578 Ga0207684_10256733
579 Ga0207684_10389225
580 Ga0207695_10000141
581 Ga0207695_10089538
582 Ga0207671_10027081
583 Ga0207671_10421944
584 Ga0207693_10009490
585 Ga0207693_10027791
586 Ga0207663_10162613
587 Ga0207663_10272489
588 Ga0207662_10000246
589 Ga0207657_10220497
590 Ga0207657_10235583
591 Ga0207646_10000761
592 Ga0207646_10002931
593 Ga0207646_10022025
594 Ga0207646_10068875
595 Ga0207646_10259066
596 Ga0207681_10006708
597 Ga0207681_10013001
598 Ga0207681_10310237
599 Ga0207650_10188613
600 Ga0207650_10304086
601 Ga0207659_10032627
602 Ga0207659_10041932
603 Ga0207659_10104140
604 Ga0207659_10234988
605 Ga0207659_10256007
606 Ga0207700_10072398
607 Ga0207700_10224308
608 Ga0207664_10271891
609 Ga0207644_10095205
610 Ga0207644_10097838
611 Ga0207706_10001969
612 Ga0207686_10057449
613 Ga0207670_10121468
614 Ga0207669_10007767
615 Ga0207665_10028866
616 Ga0207665_10045264
617 Ga0207665_10086607
618 Ga0207665_10367181
619 Ga0207691_10000149
620 Ga0207691_10012613
621 Ga0207691_10188938
622 Ga0207689_10049961
623 Ga0207679_10126963
624 Ga0207667_10004042
625 Ga0207651_10075418
626 Ga0207668_10015872
627 Ga0207668_10016490
628 Ga0207658_10018453
629 Ga0207658_10019081
630 Ga0207658_10032527
631 Ga0207658_10050463
632 Ga0207658_10060234
633 Ga0207677_10055998
634 Ga0207677_10064898
635 Ga0207677_10315308
636 Ga0207677_10321233
637 Ga0207703_10017898
638 Ga0207703_10095372
639 Ga0207703_10297441
640 Ga0207639_10000127
641 Ga0207639_10117376
642 Ga0207639_10301080
643 Ga0207678_10204692
644 Ga0207641_10042842
645 Ga0207641_10092353
646 Ga0207648_10004203
647 Ga0207648_10191314
648 Ga0207675_100378229
649 Ga0207683_10003001
650 Ga0207683_10007229
651 Ga0207683_10042463
652 Ga0207683_10058685
653 Ga0268266_10118286
654 Ga0268266_10211022
655 Ga0268266_10238366
656 Ga0268265_10026207
657 Ga0268265_10338489
658 Ga0268264_10000163
659 Ga0268264_10013120
660 Ga0268264_10068213
661 Ga0307513_10035296
662 Ga0373926_0132875
663 Ga0373923_0078588
664 Ga0373945_0066597
665 Ga0373931_0056331
666 Ga0373935_0153389
667 Ga0373937_0086296
668 Ga0373925_0201972
669 Ga0395900_0045105
670 Ga0395898_0128370
671 Ga0395901_0169477
672 Ga0395901_0202944
673 Ga0436365_0178835
674 Ga0436365_0428430
675 Ga0436365_0997917
676 Ga0451576_0198339
677 Ga0451576_0259709
678 Ga0495651_0097773
679 Ga0495628_0130309
680 Ga0495659_0125201
681 Ga0495658_0008974
682 Ga0495658_0135489
683 Ga0495669_0017485
684 Ga0495675_0016591
685 Ga0495684_0023585
686 Ga0496100_0226684
687 Ga0496101_0061747
688 Ga0496104_0210032
689 Ga0496106_0063170
690 Ga0496107_0018621
691 Ga0496108_0115881
692 Ga0496108_0141972
693 Ga0496108_0291408
694 Ga0496109_0043926
695 Ga0496109_0109490
696 Ga0496109_0341902
697 Ga0496110_0161583
698 Ga0496112_0069083
699 Ga0496112_0139946
700 Ga0496112_0168924
701 Ga0496112_0234652
702 Ga0496112_0251685
703 Ga0496113_0061502
704 Ga0496113_0091521
705 Ga0496115_0034396
706 Ga0496115_0174487
707 Ga0501080_0017977
708 nmdc:mga05p37_873790_c1
709 nmdc:mga06r32_450608_c1
710 nmdc:mga0n895_711421_c1
711 nmdc:mga0n895_88553_c1
712 nmdc:mga08x19_25536_c1
713 nmdc:mga08x19_350911_c1
714 Ga0495601_0054172

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

52

252

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jf0-assembly1.cif.gz_A crystal structure of type 2 pdf from streptococcus agalactiae in complex with tripeptide met-ala-arg 0.8913 230 244
4eox-assembly1.cif.gz_P x-ray structure of polypeptide deformylase bound to a acylprolinamide inhibitor 0.864 230 244
2kkn-assembly1.cif.gz_A solution nmr structure of themotoga maritima protein tm1076: northeast structural genomics consortium target vt57 0.6865 11 244
2kkn-assembly1.cif.gz_A solution nmr structure of themotoga maritima protein tm1076: northeast structural genomics consortium target vt57 0.6607 11 244
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.6489 11 244
ID Description Score Start End Superfamily
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7183 11 244 3.60.21.10
2kknA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6865 11 244 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6709 11 244 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6707 11 243 3.60.21.10
2kknA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6607 11 244 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A2V6X366-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9762 5 88 GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-A0A7V5L0G8-F1-model_v4 UDP-2,3-diacylglucosamine diphosphatase 0.9669 8 93 GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-A0A2E8X2D6-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9617 5 89 GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-A0A2V6GLG7-F1-model_v4 UDP-2,3-diacylglucosamine hydrolase 0.9586 6 109 GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-Q8KMJ9-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9559 6 122 GO:0005886
GO:0008758
GO:0009245
GO:0046872

Map