F420787

General Info

Members Datasets Scaffolds Average Seq Length
357 181 714 248

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100097366|Ga0070716_1000973662
Length 290
Sequence MVNRPSTPSGLAELAGSPSTCVIVETAGSGDLDSAIRRKLDIPAVTAEALIVLIALAFAIGAAIVGFVVGRDSKSSKTVTVGAVVASQTVDPHVAAGAHDFVSFACAQCHGMQGRGGVSPDVPALTSVSKDLTPAQLRKIINHGLGESANPTKPYMPVWGEVISARQVSDLISYLRAGLPAVPTAEAPPIPQGQGAAVAGAALYQRYGCVNCHGPNGLGGVPNPQSPDKTIPPLSGADFKHEFNTDAKIIDFIRSGSVIGRAPIVSMPHWGGVIPPEQLRALAAYIKTLK

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
78 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
79 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
106 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
107 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
108 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
109 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
110 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
111 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
112 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
113 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
114 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 26.05
Rhizosphere 72.27
Stem 0
Stem Tuber 0
Unclassified 23.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_100097366 3300006173 Unclassified 1795
2 Ga0070658_10010082 3300005327 Bacteria 7585
3 Ga0070683_100107117 3300005329 Bacteria 2635
4 Ga0070682_100044121 3300005337 Bacteria 2760
5 Ga0070661_100056416 3300005344 Bacteria 2878
6 Ga0070671_100016924 3300005355 Bacteria 5897
7 Ga0070671_100232942 3300005355 Bacteria 1563
8 Ga0070673_100139178 3300005364 Unclassified 2046
9 Ga0070673_100262005 3300005364 Unclassified 1510
10 Ga0070659_100463936 3300005366 Bacteria 1076
11 Ga0070709_10172524 3300005434 Unclassified 1512
12 Ga0070714_100005088 3300005435 Bacteria 10007
13 Ga0070714_100024017 3300005435 Bacteria 5014
14 Ga0070714_100115463 3300005435 Bacteria 2382
15 Ga0070713_100036218 3300005436 Bacteria 3980
16 Ga0070713_100121987 3300005436 Unclassified 2287
17 Ga0070713_100833542 3300005436 Bacteria 885
18 Ga0070710_10029109 3300005437 Bacteria 2960
19 Ga0070711_100003600 3300005439 Bacteria 9039
20 Ga0070711_100156356 3300005439 Bacteria 1724
21 Ga0070663_100305026 3300005455 Bacteria 1276
22 Ga0070681_10296264 3300005458 Bacteria 1527
23 Ga0070706_100098830 3300005467 Bacteria 2712
24 Ga0070706_100120494 3300005467 Bacteria 2446
25 Ga0070707_100033944 3300005468 Bacteria 4866
26 Ga0070698_100017998 3300005471 Bacteria 7441
27 Ga0070698_100100340 3300005471 Bacteria 2867
28 Ga0070698_100152622 3300005471 Bacteria 2257
29 Ga0070699_100162238 3300005518 Bacteria 1978
30 Ga0070679_100391048 3300005530 Bacteria 1337
31 Ga0070684_100039552 3300005535 Bacteria 4057
32 Ga0068853_100489039 3300005539 Bacteria 1161
33 Ga0070693_100108310 3300005547 Bacteria 1704
34 Ga0070693_100122294 3300005547 Bacteria 1616
35 Ga0068855_100039683 3300005563 Bacteria 5589
36 Ga0070664_100209616 3300005564 Unclassified 1741
37 Ga0068856_100099943 3300005614 Bacteria 2893
38 Ga0068856_100146222 3300005614 Bacteria 2371
39 Ga0068856_100451551 3300005614 Unclassified 1306
40 Ga0068864_100173900 3300005618 Unclassified 1965
41 Ga0070717_10422831 3300006028 Bacteria 1199
42 Ga0070717_10868337 3300006028 Unclassified 821
43 Ga0070715_10283879 3300006163 Bacteria 879
44 Ga0070716_100017273 3300006173 Bacteria 3736
45 Ga0070712_100016441 3300006175 Bacteria 4780
46 Ga0070712_100022547 3300006175 Bacteria 4150
47 Ga0070712_100030057 3300006175 Bacteria 3647
48 Ga0070712_100036005 3300006175 Bacteria 3364
49 Ga0070712_100131766 3300006175 Unclassified 1895
50 Ga0097621_100049176 3300006237 Bacteria 3425
51 Ga0097621_100052083 3300006237 Bacteria 3333
52 Ga0105238_10078397 3300009551 Bacteria 3294
53 Ga0157370_10006232 3300013104 Bacteria 13213
54 Ga0157370_10286507 3300013104 Bacteria 1522
55 Ga0157369_10013786 3300013105 Bacteria 9137
56 Ga0157369_10869192 3300013105 Bacteria 925
57 Ga0163162_10379651 3300013306 Bacteria 1546
58 Ga0157372_10020035 3300013307 Bacteria 7212
59 Ga0157375_10059178 3300013308 Unclassified 3794
60 Ga0157375_10381281 3300013308 Bacteria 1576
61 Ga0157377_10134804 3300014745 Bacteria 1512
62 Ga0157377_10293806 3300014745 Bacteria 1070
63 Ga0157379_10000652 3300014968 Bacteria 28069
64 Ga0157376_10153716 3300014969 Bacteria 2078
65 Ga0206354_11267910 3300020081 Bacteria 1817
66 Ga0207692_10227941 3300025898 Bacteria 1107
67 Ga0207680_10407806 3300025903 Unclassified 961
68 Ga0207685_10037075 3300025905 Bacteria 1792
69 Ga0207699_10067664 3300025906 Unclassified 2172
70 Ga0207699_10071507 3300025906 Bacteria 2122
71 Ga0207684_10030652 3300025910 Bacteria 4578
72 Ga0207684_10076293 3300025910 Bacteria 2849
73 Ga0207684_10415722 3300025910 Bacteria 1156
74 Ga0207684_10452480 3300025910 Bacteria 1102
75 Ga0207693_10017063 3300025915 Bacteria 5795
76 Ga0207693_10036654 3300025915 Bacteria 3866
77 Ga0207693_10125306 3300025915 Unclassified 2019
78 Ga0207663_10002020 3300025916 Bacteria 9641
79 Ga0207663_10003069 3300025916 Bacteria 8095
80 Ga0207663_10011971 3300025916 Bacteria 4675
81 Ga0207663_10201125 3300025916 Unclassified 1437
82 Ga0207663_10263275 3300025916 Unclassified 1274
83 Ga0207657_10051827 3300025919 Bacteria 3566
84 Ga0207649_10009900 3300025920 Bacteria 5225
85 Ga0207652_10342936 3300025921 Bacteria 1349
86 Ga0207646_10003009 3300025922 Bacteria 19424
87 Ga0207687_10270321 3300025927 Bacteria 1359
88 Ga0207700_10226439 3300025928 Bacteria 1588
89 Ga0207700_10430871 3300025928 Unclassified 1160
90 Ga0207664_10002585 3300025929 Bacteria 11979
91 Ga0207664_10046137 3300025929 Bacteria 3419
92 Ga0207664_10920073 3300025929 Unclassified 785
93 Ga0207644_10269235 3300025931 Unclassified 1364
94 Ga0207690_10143777 3300025932 Bacteria 1761
95 Ga0207706_10068555 3300025933 Unclassified 3121
96 Ga0207665_10093910 3300025939 Bacteria 2083
97 Ga0207661_10118161 3300025944 Unclassified 2253
98 Ga0207679_10677582 3300025945 Bacteria 934
99 Ga0207651_10066002 3300025960 Bacteria 2541
100 Ga0207651_10247809 3300025960 Bacteria 1456
101 Ga0207677_10494270 3300026023 Bacteria 1056
102 Ga0207703_10392324 3300026035 Bacteria 1286
103 Ga0207678_10324730 3300026067 Bacteria 1324
104 Ga0207678_10607572 3300026067 Bacteria 959
105 Ga0207708_10057232 3300026075 Unclassified 2974
106 Ga0207708_10380012 3300026075 Unclassified 1164
107 Ga0207702_10007356 3300026078 Bacteria 9408
108 Ga0207702_10189863 3300026078 Unclassified 1897
109 Ga0207702_10269583 3300026078 Bacteria 1605
110 Ga0207702_10513580 3300026078 Bacteria 1169
111 Ga0207641_10320048 3300026088 Unclassified 1471
112 Ga0207676_10276519 3300026095 Bacteria 1523
113 Ga0207676_10648056 3300026095 Unclassified 1019
114 Ga0207698_10169143 3300026142 Bacteria 1922
115 Ga0209966_1016257 3300027695 Unclassified 1406
116 Ga0265337_1065301 3300028556 Bacteria 1004
117 Ga0265334_10012226 3300028573 Bacteria 3607
118 Ga0265334_10023007 3300028573 Unclassified 2538
119 Ga0265318_10001025 3300028577 Bacteria 17763
120 Ga0265318_10022138 3300028577 Bacteria 2544
121 Ga0265318_10065558 3300028577 Bacteria 1350
122 Ga0265336_10001810 3300028666 Bacteria 9341
123 Ga0265338_10003498 3300028800 Bacteria 22042
124 Ga0265338_10007410 3300028800 Bacteria 13628
125 Ga0265338_10050646 3300028800 Bacteria 3751
126 Ga0265338_10114115 3300028800 Bacteria 2168
127 Ga0265324_10008106 3300029957 Bacteria 4204
128 Ga0265330_10149305 3300031235 Bacteria 993
129 Ga0265332_10021659 3300031238 Bacteria 2838
130 Ga0265332_10100439 3300031238 Bacteria 1221
131 Ga0265328_10010661 3300031239 Bacteria 3693
132 Ga0265320_10003780 3300031240 Bacteria 10062
133 Ga0265325_10047184 3300031241 Bacteria 2230
134 Ga0265329_10013345 3300031242 Bacteria 2931
135 Ga0265340_10044975 3300031247 Bacteria 2158
136 Ga0265340_10070139 3300031247 Bacteria 1662
137 Ga0265339_10006222 3300031249 Bacteria 7858
138 Ga0265339_10186716 3300031249 Unclassified 1030
139 Ga0265331_10015204 3300031250 Bacteria 4071
140 Ga0265327_10007152 3300031251 Bacteria 8701
141 Ga0265327_10016310 3300031251 Bacteria 4724
142 Ga0265327_10028871 3300031251 Bacteria 3163
143 Ga0265327_10039247 3300031251 Bacteria 2573
144 Ga0265327_10165075 3300031251 Bacteria 1020
145 Ga0265316_10018129 3300031344 Bacteria 6059
146 Ga0265316_10027486 3300031344 Unclassified 4709
147 Ga0265316_10043488 3300031344 Bacteria 3579
148 Ga0265316_10258056 3300031344 Bacteria 1278
149 Ga0265313_10018915 3300031595 Bacteria 3853
150 Ga0265313_10032455 3300031595 Bacteria 2666
151 Ga0265313_10047377 3300031595 Bacteria 2080
152 Ga0265314_10004937 3300031711 Bacteria 12173
153 Ga0265314_10013048 3300031711 Bacteria 6743
154 Ga0265314_10028962 3300031711 Bacteria 4121
155 Ga0265314_10046000 3300031711 Bacteria 3081
156 Ga0265342_10004057 3300031712 Bacteria 11681
157 Ga0265342_10020694 3300031712 Bacteria 4213
158 Ga0265342_10026305 3300031712 Bacteria 3648
159 Ga0265342_10054511 3300031712 Bacteria 2375
160 Ga0373954_0314565 3300035118 Bacteria 773
161 Ga0373960_0110136 3300035121 Bacteria 902
162 Ga0373943_0019486 3300035170 Bacteria 3121
163 Ga0373946_0017816 3300035171 Bacteria 2721
164 Ga0373955_0026478 3300035172 Unclassified 2988
165 Ga0373927_0038664 3300035695 Bacteria 3098
166 Ga0373947_0002929 3300035725 Bacteria 10181
167 Ga0373937_0313752 3300036401 Bacteria 1483
168 Ga0373925_0013128 3300037068 Bacteria 5995
169 Ga0395900_0097857 3300037418 Bacteria 3015
170 Ga0395898_0540373 3300037466 Unclassified 1107
171 Ga0395905_0055036 3300037471 Bacteria 3724
172 Ga0395905_0215536 3300037471 Unclassified 1798
173 Ga0395901_0063659 3300038443 Bacteria 3839
174 Ga0395901_0091232 3300038443 Bacteria 3189
175 Ga0242420_020284 3300038996 Bacteria 1182
176 Ga0451793_1529103 3300041452 Bacteria 1262
177 Ga0451800_0485338 3300041459 Bacteria 5455
178 Ga0451802_0371960 3300041460 Bacteria 2766
179 Ga0451804_0820439 3300041463 Bacteria 1809
180 Ga0451835_1052713 3300041492 Bacteria 1390
181 Ga0451839_1614688 3300041496 Bacteria 2063
182 Ga0451845_0318858 3300041501 Bacteria 1272
183 Ga0451847_0546638 3300041503 Bacteria 2756
184 Ga0451849_0286941 3300041505 Bacteria 1052
185 Ga0451853_1108279 3300041512 Bacteria 2040
186 Ga0453683_0085111 3300044673 Bacteria 1981
187 Ga0466957_0109150 3300044842 Bacteria 1753
188 Ga0451576_0460442 3300045051 Bacteria 1335
189 Ga0495592_0049548 3300046454 Unclassified 3123
190 Ga0495603_0000677 3300046455 Bacteria 19327
191 Ga0495629_0271552 3300046459 Bacteria 1165
192 Ga0495641_0001857 3300046461 Bacteria 17335
193 Ga0495641_0109106 3300046461 Unclassified 1235
194 Ga0495651_0080231 3300046462 Unclassified 2465
195 Ga0495651_0299293 3300046462 Bacteria 1079
196 Ga0495653_0027654 3300046463 Unclassified 4540
197 Ga0495653_0161968 3300046463 Unclassified 1552
198 Ga0495582_0008278 3300046473 Bacteria 5741
199 Ga0495664_0203314 3300046477 Bacteria 1200
200 Ga0495664_0247622 3300046477 Bacteria 1078
201 Ga0495584_0058621 3300046491 Bacteria 1937
202 Ga0495594_0006683 3300046499 Bacteria 5933
203 Ga0495607_0051245 3300046501 Bacteria 2398
204 Ga0495616_0086129 3300046513 Bacteria 1495
205 Ga0495618_0132323 3300046514 Bacteria 1596
206 Ga0495628_0119578 3300046516 Bacteria 2022
207 Ga0495630_0071782 3300046517 Unclassified 2606
208 Ga0495630_0179066 3300046517 Unclassified 1616
209 Ga0495630_0198560 3300046517 Bacteria 1531
210 Ga0495630_0253014 3300046517 Bacteria 1346
211 Ga0495630_0319316 3300046517 Bacteria 1187
212 Ga0495644_0032938 3300046523 Bacteria 1958
213 Ga0495644_0072088 3300046523 Unclassified 1299
214 Ga0495652_0036669 3300046529 Bacteria 4260
215 Ga0495652_0207525 3300046529 Bacteria 1482
216 Ga0495587_0024699 3300046536 Unclassified 3680
217 Ga0495645_0103885 3300046543 Bacteria 2018
218 Ga0495645_0221491 3300046543 Bacteria 1272
219 Ga0495656_0009632 3300046615 Unclassified 3481
220 Ga0495634_0188020 3300046642 Unclassified 1290
221 Ga0495635_0038167 3300046663 Unclassified 3326
222 Ga0495635_0189436 3300046663 Bacteria 1397
223 Ga0495588_0000560 3300046674 Bacteria 17805
224 Ga0495588_0133064 3300046674 Bacteria 1312
225 Ga0495657_0148366 3300046675 Bacteria 1458
226 Ga0495599_0083788 3300046678 Bacteria 1991
227 Ga0495599_0170155 3300046678 Bacteria 1345
228 Ga0495646_0082241 3300046680 Unclassified 1874
229 Ga0495658_0232548 3300046683 Unclassified 1156
230 Ga0495658_0245802 3300046683 Bacteria 1124
231 Ga0495669_0298585 3300046684 Bacteria 776
232 Ga0495624_0259114 3300046690 Unclassified 1051
233 Ga0495670_0054402 3300046691 Bacteria 2005
234 Ga0495589_0025659 3300046794 Bacteria 2990
235 Ga0495589_0134301 3300046794 Bacteria 1187
236 Ga0495600_0355399 3300046809 Bacteria 917
237 Ga0495581_0000604 3300047315 Bacteria 18816
238 Ga0495581_0059529 3300047315 Bacteria 2207
239 Ga0495604_0025085 3300047317 Bacteria 4753
240 Ga0495604_0125423 3300047317 Unclassified 1852
241 Ga0495604_0498406 3300047317 Bacteria 790
242 Ga0495674_0046013 3300047319 Bacteria 3875
243 Ga0495674_0080118 3300047319 Bacteria 2803
244 Ga0495674_0187818 3300047319 Bacteria 1719
245 Ga0495676_0003465 3300047321 Bacteria 14277
246 Ga0495676_0035525 3300047321 Bacteria 4167
247 Ga0495680_0050361 3300047322 Unclassified 3257
248 Ga0495680_0156974 3300047322 Unclassified 1654
249 Ga0495680_0544477 3300047322 Unclassified 783
250 Ga0495675_0365240 3300047444 Unclassified 847
251 Ga0495684_0107406 3300047471 Bacteria 2108
252 Ga0495684_0232330 3300047471 Unclassified 1348
253 Ga0495602_0257268 3300048088 Bacteria 1297
254 Ga0495602_0472536 3300048088 Unclassified 881
255 Ga0496100_0093567 3300048903 Bacteria 2056
256 Ga0496100_0126388 3300048903 Bacteria 1795
257 Ga0496100_0206628 3300048903 Unclassified 1434
258 Ga0496101_0027110 3300048904 Bacteria 3986
259 Ga0496101_0064912 3300048904 Bacteria 2660
260 Ga0496101_0074717 3300048904 Unclassified 2493
261 Ga0496101_0460649 3300048904 Bacteria 1003
262 Ga0496102_0005174 3300048905 Bacteria 11068
263 Ga0496102_0038534 3300048905 Unclassified 4314
264 Ga0496102_0111145 3300048905 Bacteria 2554
265 Ga0496102_0572309 3300048905 Bacteria 1052
266 Ga0496103_0002445 3300048906 Bacteria 11681
267 Ga0496103_0116326 3300048906 Bacteria 1701
268 Ga0496104_0013439 3300048907 Bacteria 7377
269 Ga0496104_0029294 3300048907 Bacteria 5106
270 Ga0496104_0057117 3300048907 Bacteria 3693
271 Ga0496104_0094765 3300048907 Unclassified 2855
272 Ga0496104_0126304 3300048907 Unclassified 2456
273 Ga0496104_0195583 3300048907 Bacteria 1934
274 Ga0496104_0350729 3300048907 Bacteria 1388
275 Ga0496105_0000712 3300048908 Bacteria 22506
276 Ga0496105_0005955 3300048908 Bacteria 9307
277 Ga0496105_0006104 3300048908 Bacteria 9222
278 Ga0496105_0020442 3300048908 Bacteria 5349
279 Ga0496105_0024800 3300048908 Bacteria 4875
280 Ga0496105_0043191 3300048908 Bacteria 3717
281 Ga0496105_0108238 3300048908 Unclassified 2295
282 Ga0496105_0165463 3300048908 Bacteria 1814
283 Ga0496106_0041742 3300048909 Bacteria 3438
284 Ga0496106_0060267 3300048909 Bacteria 2876
285 Ga0496106_0079575 3300048909 Unclassified 2516
286 Ga0496107_0025454 3300048910 Bacteria 4190
287 Ga0496107_0029461 3300048910 Unclassified 3905
288 Ga0496107_0052205 3300048910 Bacteria 2949
289 Ga0496107_0123923 3300048910 Bacteria 1904
290 Ga0496107_0271924 3300048910 Unclassified 1261
291 Ga0496107_0332638 3300048910 Unclassified 1130
292 Ga0496108_0000861 3300048911 Bacteria 23689
293 Ga0496108_0003568 3300048911 Bacteria 12467
294 Ga0496108_0012452 3300048911 Bacteria 6924
295 Ga0496108_0014191 3300048911 Bacteria 6500
296 Ga0496108_0015915 3300048911 Bacteria 6131
297 Ga0496108_0026930 3300048911 Bacteria 4745
298 Ga0496108_0164611 3300048911 Bacteria 1917
299 Ga0496108_0275129 3300048911 Bacteria 1466
300 Ga0496108_0435260 3300048911 Unclassified 1145
301 Ga0496109_0001753 3300048912 Bacteria 18055
302 Ga0496109_0004683 3300048912 Bacteria 11419
303 Ga0496109_0005412 3300048912 Bacteria 10676
304 Ga0496109_0005559 3300048912 Bacteria 10553
305 Ga0496109_0043961 3300048912 Plasmid 4051
306 Ga0496109_0062613 3300048912 Bacteria 3402
307 Ga0496109_0107499 3300048912 Bacteria 2591
308 Ga0496110_0003095 3300048913 Bacteria 12622
309 Ga0496110_0029358 3300048913 Bacteria 4732
310 Ga0496110_0043839 3300048913 Bacteria 3905
311 Ga0496110_0315794 3300048913 Bacteria 1423
312 Ga0496111_0000061 3300048914 Bacteria 44168
313 Ga0496111_0012875 3300048914 Bacteria 5676
314 Ga0496111_0071897 3300048914 Unclassified 2517
315 Ga0496111_0073257 3300048914 Bacteria 2494
316 Ga0496111_0079162 3300048914 Bacteria 2397
317 Ga0496111_0279017 3300048914 Bacteria 1239
318 Ga0496111_0315205 3300048914 Bacteria 1159
319 Ga0496112_0007948 3300048915 Bacteria 9457
320 Ga0496112_0011312 3300048915 Bacteria 8143
321 Ga0496112_0024119 3300048915 Bacteria 5822
322 Ga0496112_0043780 3300048915 Unclassified 4383
323 Ga0496112_0093623 3300048915 Bacteria 2975
324 Ga0496112_0153854 3300048915 Bacteria 2267
325 Ga0496112_0507221 3300048915 Bacteria 1141
326 Ga0496112_0588506 3300048915 Unclassified 1045
327 Ga0496113_0001868 3300048916 Bacteria 11998
328 Ga0496113_0009823 3300048916 Bacteria 6297
329 Ga0496113_0026054 3300048916 Unclassified 4177
330 Ga0496113_0028741 3300048916 Unclassified 4003
331 Ga0496113_0124518 3300048916 Unclassified 2018
332 Ga0496113_0169878 3300048916 Bacteria 1727
333 Ga0496113_0221228 3300048916 Unclassified 1509
334 Ga0496113_0319461 3300048916 Bacteria 1244
335 Ga0496114_0222384 3300048917 Bacteria 1657
336 Ga0496114_0308963 3300048917 Bacteria 1396
337 Ga0496114_0351695 3300048917 Bacteria 1303
338 Ga0496114_0439475 3300048917 Unclassified 1155
339 Ga0496115_0107522 3300048918 Bacteria 2290
340 Ga0496115_0128210 3300048918 Bacteria 2090
341 Ga0496115_0170912 3300048918 Unclassified 1798
342 Ga0496115_0202180 3300048918 Unclassified 1641
343 Ga0496115_0315557 3300048918 Bacteria 1279
344 Ga0501036_0319725 3300049572 Unclassified 1297
345 Ga0501043_0445343 3300049579 Unclassified 974
346 Ga0501048_0559397 3300049582 Unclassified 821
347 Ga0495601_0040335 3300053077 Bacteria 2924
348 Ga0495601_0073209 3300053077 Bacteria 2190
349 Ga0495601_0207216 3300053077 Bacteria 1281
350 Ga0495612_0019209 3300053078 Unclassified 2738
351 Ga0495612_0031972 3300053078 Bacteria 2125
352 Ga0495612_0041945 3300053078 Unclassified 1867
353 Ga0495595_0071945 3300053084 Bacteria 1636
354 Ga0495619_0050002 3300053085 Unclassified 2758
355 Ga0495619_0057996 3300053085 Unclassified 2569
356 Ga0495619_0079208 3300053085 Bacteria 2210
357 Ga0495619_0329683 3300053085 Unclassified 1056
358 Ga0070716_100097366
359 Ga0070658_10010082
360 Ga0070683_100107117
361 Ga0070682_100044121
362 Ga0070661_100056416
363 Ga0070671_100016924
364 Ga0070671_100232942
365 Ga0070673_100139178
366 Ga0070673_100262005
367 Ga0070659_100463936
368 Ga0070709_10172524
369 Ga0070714_100005088
370 Ga0070714_100024017
371 Ga0070714_100115463
372 Ga0070713_100036218
373 Ga0070713_100121987
374 Ga0070713_100833542
375 Ga0070710_10029109
376 Ga0070711_100003600
377 Ga0070711_100156356
378 Ga0070663_100305026
379 Ga0070681_10296264
380 Ga0070706_100098830
381 Ga0070706_100120494
382 Ga0070707_100033944
383 Ga0070698_100017998
384 Ga0070698_100100340
385 Ga0070698_100152622
386 Ga0070699_100162238
387 Ga0070679_100391048
388 Ga0070684_100039552
389 Ga0068853_100489039
390 Ga0070693_100108310
391 Ga0070693_100122294
392 Ga0068855_100039683
393 Ga0070664_100209616
394 Ga0068856_100099943
395 Ga0068856_100146222
396 Ga0068856_100451551
397 Ga0068864_100173900
398 Ga0070717_10422831
399 Ga0070717_10868337
400 Ga0070715_10283879
401 Ga0070716_100017273
402 Ga0070712_100016441
403 Ga0070712_100022547
404 Ga0070712_100030057
405 Ga0070712_100036005
406 Ga0070712_100131766
407 Ga0097621_100049176
408 Ga0097621_100052083
409 Ga0105238_10078397
410 Ga0157370_10006232
411 Ga0157370_10286507
412 Ga0157369_10013786
413 Ga0157369_10869192
414 Ga0163162_10379651
415 Ga0157372_10020035
416 Ga0157375_10059178
417 Ga0157375_10381281
418 Ga0157377_10134804
419 Ga0157377_10293806
420 Ga0157379_10000652
421 Ga0157376_10153716
422 Ga0206354_11267910
423 Ga0207692_10227941
424 Ga0207680_10407806
425 Ga0207685_10037075
426 Ga0207699_10067664
427 Ga0207699_10071507
428 Ga0207684_10030652
429 Ga0207684_10076293
430 Ga0207684_10415722
431 Ga0207684_10452480
432 Ga0207693_10017063
433 Ga0207693_10036654
434 Ga0207693_10125306
435 Ga0207663_10002020
436 Ga0207663_10003069
437 Ga0207663_10011971
438 Ga0207663_10201125
439 Ga0207663_10263275
440 Ga0207657_10051827
441 Ga0207649_10009900
442 Ga0207652_10342936
443 Ga0207646_10003009
444 Ga0207687_10270321
445 Ga0207700_10226439
446 Ga0207700_10430871
447 Ga0207664_10002585
448 Ga0207664_10046137
449 Ga0207664_10920073
450 Ga0207644_10269235
451 Ga0207690_10143777
452 Ga0207706_10068555
453 Ga0207665_10093910
454 Ga0207661_10118161
455 Ga0207679_10677582
456 Ga0207651_10066002
457 Ga0207651_10247809
458 Ga0207677_10494270
459 Ga0207703_10392324
460 Ga0207678_10324730
461 Ga0207678_10607572
462 Ga0207708_10057232
463 Ga0207708_10380012
464 Ga0207702_10007356
465 Ga0207702_10189863
466 Ga0207702_10269583
467 Ga0207702_10513580
468 Ga0207641_10320048
469 Ga0207676_10276519
470 Ga0207676_10648056
471 Ga0207698_10169143
472 Ga0209966_1016257
473 Ga0265337_1065301
474 Ga0265334_10012226
475 Ga0265334_10023007
476 Ga0265318_10001025
477 Ga0265318_10022138
478 Ga0265318_10065558
479 Ga0265336_10001810
480 Ga0265338_10003498
481 Ga0265338_10007410
482 Ga0265338_10050646
483 Ga0265338_10114115
484 Ga0265324_10008106
485 Ga0265330_10149305
486 Ga0265332_10021659
487 Ga0265332_10100439
488 Ga0265328_10010661
489 Ga0265320_10003780
490 Ga0265325_10047184
491 Ga0265329_10013345
492 Ga0265340_10044975
493 Ga0265340_10070139
494 Ga0265339_10006222
495 Ga0265339_10186716
496 Ga0265331_10015204
497 Ga0265327_10007152
498 Ga0265327_10016310
499 Ga0265327_10028871
500 Ga0265327_10039247
501 Ga0265327_10165075
502 Ga0265316_10018129
503 Ga0265316_10027486
504 Ga0265316_10043488
505 Ga0265316_10258056
506 Ga0265313_10018915
507 Ga0265313_10032455
508 Ga0265313_10047377
509 Ga0265314_10004937
510 Ga0265314_10013048
511 Ga0265314_10028962
512 Ga0265314_10046000
513 Ga0265342_10004057
514 Ga0265342_10020694
515 Ga0265342_10026305
516 Ga0265342_10054511
517 Ga0373954_0314565
518 Ga0373960_0110136
519 Ga0373943_0019486
520 Ga0373946_0017816
521 Ga0373955_0026478
522 Ga0373927_0038664
523 Ga0373947_0002929
524 Ga0373937_0313752
525 Ga0373925_0013128
526 Ga0395900_0097857
527 Ga0395898_0540373
528 Ga0395905_0055036
529 Ga0395905_0215536
530 Ga0395901_0063659
531 Ga0395901_0091232
532 Ga0242420_020284
533 Ga0451793_1529103
534 Ga0451800_0485338
535 Ga0451802_0371960
536 Ga0451804_0820439
537 Ga0451835_1052713
538 Ga0451839_1614688
539 Ga0451845_0318858
540 Ga0451847_0546638
541 Ga0451849_0286941
542 Ga0451853_1108279
543 Ga0453683_0085111
544 Ga0466957_0109150
545 Ga0451576_0460442
546 Ga0495592_0049548
547 Ga0495603_0000677
548 Ga0495629_0271552
549 Ga0495641_0001857
550 Ga0495641_0109106
551 Ga0495651_0080231
552 Ga0495651_0299293
553 Ga0495653_0027654
554 Ga0495653_0161968
555 Ga0495582_0008278
556 Ga0495664_0203314
557 Ga0495664_0247622
558 Ga0495584_0058621
559 Ga0495594_0006683
560 Ga0495607_0051245
561 Ga0495616_0086129
562 Ga0495618_0132323
563 Ga0495628_0119578
564 Ga0495630_0071782
565 Ga0495630_0179066
566 Ga0495630_0198560
567 Ga0495630_0253014
568 Ga0495630_0319316
569 Ga0495644_0032938
570 Ga0495644_0072088
571 Ga0495652_0036669
572 Ga0495652_0207525
573 Ga0495587_0024699
574 Ga0495645_0103885
575 Ga0495645_0221491
576 Ga0495656_0009632
577 Ga0495634_0188020
578 Ga0495635_0038167
579 Ga0495635_0189436
580 Ga0495588_0000560
581 Ga0495588_0133064
582 Ga0495657_0148366
583 Ga0495599_0083788
584 Ga0495599_0170155
585 Ga0495646_0082241
586 Ga0495658_0232548
587 Ga0495658_0245802
588 Ga0495669_0298585
589 Ga0495624_0259114
590 Ga0495670_0054402
591 Ga0495589_0025659
592 Ga0495589_0134301
593 Ga0495600_0355399
594 Ga0495581_0000604
595 Ga0495581_0059529
596 Ga0495604_0025085
597 Ga0495604_0125423
598 Ga0495604_0498406
599 Ga0495674_0046013
600 Ga0495674_0080118
601 Ga0495674_0187818
602 Ga0495676_0003465
603 Ga0495676_0035525
604 Ga0495680_0050361
605 Ga0495680_0156974
606 Ga0495680_0544477
607 Ga0495675_0365240
608 Ga0495684_0107406
609 Ga0495684_0232330
610 Ga0495602_0257268
611 Ga0495602_0472536
612 Ga0496100_0093567
613 Ga0496100_0126388
614 Ga0496100_0206628
615 Ga0496101_0027110
616 Ga0496101_0064912
617 Ga0496101_0074717
618 Ga0496101_0460649
619 Ga0496102_0005174
620 Ga0496102_0038534
621 Ga0496102_0111145
622 Ga0496102_0572309
623 Ga0496103_0002445
624 Ga0496103_0116326
625 Ga0496104_0013439
626 Ga0496104_0029294
627 Ga0496104_0057117
628 Ga0496104_0094765
629 Ga0496104_0126304
630 Ga0496104_0195583
631 Ga0496104_0350729
632 Ga0496105_0000712
633 Ga0496105_0005955
634 Ga0496105_0006104
635 Ga0496105_0020442
636 Ga0496105_0024800
637 Ga0496105_0043191
638 Ga0496105_0108238
639 Ga0496105_0165463
640 Ga0496106_0041742
641 Ga0496106_0060267
642 Ga0496106_0079575
643 Ga0496107_0025454
644 Ga0496107_0029461
645 Ga0496107_0052205
646 Ga0496107_0123923
647 Ga0496107_0271924
648 Ga0496107_0332638
649 Ga0496108_0000861
650 Ga0496108_0003568
651 Ga0496108_0012452
652 Ga0496108_0014191
653 Ga0496108_0015915
654 Ga0496108_0026930
655 Ga0496108_0164611
656 Ga0496108_0275129
657 Ga0496108_0435260
658 Ga0496109_0001753
659 Ga0496109_0004683
660 Ga0496109_0005412
661 Ga0496109_0005559
662 Ga0496109_0043961
663 Ga0496109_0062613
664 Ga0496109_0107499
665 Ga0496110_0003095
666 Ga0496110_0029358
667 Ga0496110_0043839
668 Ga0496110_0315794
669 Ga0496111_0000061
670 Ga0496111_0012875
671 Ga0496111_0071897
672 Ga0496111_0073257
673 Ga0496111_0079162
674 Ga0496111_0279017
675 Ga0496111_0315205
676 Ga0496112_0007948
677 Ga0496112_0011312
678 Ga0496112_0024119
679 Ga0496112_0043780
680 Ga0496112_0093623
681 Ga0496112_0153854
682 Ga0496112_0507221
683 Ga0496112_0588506
684 Ga0496113_0001868
685 Ga0496113_0009823
686 Ga0496113_0026054
687 Ga0496113_0028741
688 Ga0496113_0124518
689 Ga0496113_0169878
690 Ga0496113_0221228
691 Ga0496113_0319461
692 Ga0496114_0222384
693 Ga0496114_0308963
694 Ga0496114_0351695
695 Ga0496114_0439475
696 Ga0496115_0107522
697 Ga0496115_0128210
698 Ga0496115_0170912
699 Ga0496115_0202180
700 Ga0496115_0315557
701 Ga0501036_0319725
702 Ga0501043_0445343
703 Ga0501048_0559397
704 Ga0495601_0040335
705 Ga0495601_0073209
706 Ga0495601_0207216
707 Ga0495612_0019209
708 Ga0495612_0031972
709 Ga0495612_0041945
710 Ga0495595_0071945
711 Ga0495619_0050002
712 Ga0495619_0057996
713 Ga0495619_0079208
714 Ga0495619_0329683

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

197

290

0.87

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

195

286

0.85

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

92

175

0.82

PF00034

Cytochrom_C

Cytochrome c

94

178

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6onq-assembly1.cif.gz_A crystal structure of c-type cytochrome xoxg from methylobacterium extorquens am1 0.795 40 128
1c75-assembly1.cif.gz_A "0.97 a ""ab initio"" crystal structure of cytochrome c-553 from bacillus pasteurii" 0.7869 47 127
4h0j-assembly2.cif.gz_B mutant m58c of nostoc sp cytochrome c6 0.751 146 235
2zbo-assembly1.cif.gz_A crystal structure of low-redox-potential cytochrom c6 from brown alga hizikia fusiformis at 1.6 a resolution 0.7494 149 237
1c75-assembly1.cif.gz_A "0.97 a ""ab initio"" crystal structure of cytochrome c-553 from bacillus pasteurii" 0.7494 47 127
ID Description Score Start End Superfamily
1h9yA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7602 40 130 1.10.760.10
1h9yB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7519 43 130 1.10.760.10
1kv9A02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7518 38 128 1.10.760.10
2zboK00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7515 149 237 1.10.760.10
1k3gA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7454 47 127 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A538IYC1-F1-model_v4 C-type cytochrome 0.9026 35 107 GO:0009055
GO:0020037
GO:0046872
AF-A0A7R8B8A9-F1-model_v4 deleted 0.8547 36 124
AF-A0A538BM13-F1-model_v4 C-type cytochrome 0.8029 3 239 GO:0009055
GO:0020037
GO:0046872
AF-A0A7C8D4W9-F1-model_v4 deleted 0.7972 37 125
AF-A0A538K1R1-F1-model_v4 C-type cytochrome 0.7935 2 239 GO:0009055
GO:0016020
GO:0020037
GO:0046872

Map