F420783

General Info

Members Datasets Scaffolds Average Seq Length
357 211 290 345

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10006676|Ga0075364_100066764
Length 377
Sequence MPPPPSRQVASPPQTACRDPTPAVRLTFVHGEFKVPGGKLVVVDLSVADGRLTNVRVSGDFFLEPDEALAAIDAALTGLPVESDAKTIAAAVTAALPVGTTMFGFSAEAVATTVRRALQRATSWSDYEWEIVRPGPLSPHLHLALDQVLAEEVGDGRRRPTIRFWDWASPAVIIGSFQSVQNEVDPENAERYGFPVARRISGGGAMFIEPAGAVTYSIYAPIDLVQGMSFADSYAFFDEFAVQSLRDLGIEASYVPLNDIASPQGKIGGAAQKRLGNGGVLHHVTMAYDMDGARMAEVLRIGREKLSDKGTKSAAKRVDPLRSQTGLSREEIIEKMIGTFRGLHGLTEGKLTDFELERARELVETKFGTDEWLYRVP

Samples

Sample ID Description Type Environment
1 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
2 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
3 2643221553 Microbacterium sp. Root553 Isolate Unclassified
4 2643221572 Leifsonia sp. Root60 Isolate Unclassified
5 2643221613 Oerskovia sp. Root22 Isolate Unclassified
6 2643221616 Leifsonia sp. Root227 Isolate Unclassified
7 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
8 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
9 2643221649 Leifsonia sp. Root4 Isolate Unclassified
10 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
11 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
12 2643221721 Oerskovia sp. Root918 Isolate Unclassified
13 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
14 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
15 2808606372 Agromyces sp. 23-23 Isolate Unclassified
16 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
17 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
18 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
19 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
20 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
21 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
22 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
23 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
24 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
25 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
26 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
27 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
28 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
29 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
30 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
31 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
32 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
33 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
34 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
35 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
36 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
37 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
38 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
39 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
40 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
41 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
42 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
43 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
44 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
45 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
46 2922554459 Rhodococcus sp. 66b Isolate Unclassified
47 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
48 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
49 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
50 2928153084 Leifsonia sp. 563 Isolate Unclassified
51 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
52 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
53 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
54 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
55 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
56 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
57 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
58 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
59 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
60 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
61 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
62 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
63 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
64 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
65 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
66 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
67 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
68 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
69 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
70 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
71 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
72 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
73 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
74 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
75 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
76 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
77 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
132 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
188 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
192 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
193 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
194 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
195 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
196 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
197 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
198 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
200 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
201 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
204 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
207 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
208 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
209 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
210 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
211 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.39
Metatranscriptomes 0.84
Isolates 18.77

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 18.77
Nodule 1.4
Rhizoplane 2.52
Rhizosphere 56.02
Stem 0
Stem Tuber 0.28
Unclassified 20.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10043128 3300001979 Bacteria 1347
2 JGI24739J22299_10012849 3300001989 Bacteria 3067
3 JGI24739J22299_10028282 3300001989 Bacteria 1956
4 JGI24737J22298_10023966 3300001990 Bacteria 1934
5 JGI24735J21928_10006352 3300002067 Bacteria 3899
6 JGI25164J39214_1000503 3300002772 Bacteria 19083
7 JGI25165J46597_1000092 3300003214 Bacteria 165407
8 Ga0006562J51391_1020254 3300003578 Bacteria 8180
9 Ga0006562J51391_1020255 3300003578 Bacteria 10030
10 Ga0055539_1000006 3300003752 Bacteria 580055
11 Ga0055533_1000002 3300003756 Bacteria 1196393
12 Ga0055525_1000205 3300003759 Bacteria 67917
13 Ga0055527_1000004 3300003760 Bacteria 570634
14 Ga0055542_1000055 3300003762 Bacteria 171477
15 Ga0055529_1000066 3300003763 Bacteria 170902
16 Ga0055541_1002759 3300003841 Bacteria 3419
17 Ga0065714_10009521 3300005288 Bacteria 2444
18 Ga0070658_10000261 3300005327 Bacteria 46322
19 Ga0070658_10023544 3300005327 Bacteria 4941
20 Ga0070667_100067931 3300005367 Bacteria 3032
21 Ga0070667_100311585 3300005367 Bacteria 1419
22 Ga0070710_10010159 3300005437 Bacteria 4619
23 Ga0070710_10011037 3300005437 Bacteria 4453
24 Ga0070678_100151048 3300005456 Bacteria 1871
25 Ga0070696_100000205 3300005546 Bacteria 35287
26 Ga0070665_100043477 3300005548 Bacteria 4515
27 Ga0070665_100262238 3300005548 Bacteria 1729
28 Ga0068855_100000930 3300005563 Bacteria 36451
29 Ga0068855_100015379 3300005563 Bacteria 9213
30 Ga0068855_100240594 3300005563 Bacteria 2023
31 Ga0068857_100086887 3300005577 Bacteria 2797
32 Ga0068862_100252076 3300005844 Bacteria 1609
33 Ga0081455_10009494 3300005937 Bacteria 9998
34 Ga0075365_10005673 3300006038 Bacteria 6765
35 Ga0075365_10009258 3300006038 Bacteria 5649
36 Ga0075364_10000018 3300006051 Bacteria 55324
37 Ga0075364_10006445 3300006051 Bacteria 6893
38 Ga0075364_10006676 3300006051 Bacteria 6803
39 Ga0075364_10009135 3300006051 Bacteria 5937
40 Ga0075369_10023828 3300006186 Bacteria 2533
41 Ga0079104_1000044 3300006946 Bacteria 185367
42 Ga0111539_10172904 3300009094 Bacteria 2523
43 Ga0105247_10012882 3300009101 Bacteria 5019
44 Ga0105248_10000340 3300009177 Bacteria 55043
45 Ga0105237_10065306 3300009545 Bacteria 3635
46 Ga0105238_10457933 3300009551 Bacteria 1273
47 Ga0157371_10000447 3300013102 Bacteria 50553
48 Ga0157369_10001527 3300013105 Bacteria 28378
49 Ga0157369_10013828 3300013105 Bacteria 9122
50 Ga0157369_10133695 3300013105 Bacteria 2627
51 Ga0157369_10150987 3300013105 Bacteria 2455
52 Ga0163162_10347803 3300013306 Bacteria 1615
53 Ga0197907_10545534 3300020069 Bacteria 1867
54 Ga0209566_100013 3300025225 Bacteria 474033
55 Ga0209674_100001 3300025226 Bacteria 4013750
56 Ga0209672_100011 3300025228 Bacteria 856297
57 Ga0209147_100892 3300025229 Bacteria 13661
58 Ga0209563_100001 3300025230 Bacteria 4013775
59 Ga0207427_100182 3300025231 Bacteria 64661
60 Ga0209437_101207 3300025233 Bacteria 7461
61 Ga0209258_103393 3300025242 Bacteria 3451
62 Ga0209677_100001 3300025253 Bacteria 4013787
63 Ga0209677_102238 3300025253 Bacteria 7501
64 Ga0209148_1000132 3300025254 Bacteria 171529
65 Ga0209233_1000014 3300025261 Bacteria 996641
66 Ga0209455_1000122 3300025272 Bacteria 170954
67 Ga0209455_1001399 3300025272 Bacteria 10952
68 Ga0207692_10011844 3300025898 Bacteria 3728
69 Ga0207647_10014391 3300025904 Bacteria 5454
70 Ga0207647_10022256 3300025904 Bacteria 4214
71 Ga0207705_10000001 3300025909 Bacteria 2061880
72 Ga0207671_10038042 3300025914 Bacteria 3566
73 Ga0207711_10000849 3300025941 Bacteria 29540
74 Ga0207667_10000837 3300025949 Bacteria 39713
75 Ga0207667_10232967 3300025949 Bacteria 1885
76 Ga0207674_10109035 3300026116 Bacteria 2745
77 Ga0207675_100150528 3300026118 Bacteria 2214
78 Ga0207683_10130632 3300026121 Bacteria 2259
79 Ga0209281_1000129 3300027111 Bacteria 194490
80 Ga0268266_10050758 3300028379 Bacteria 3559
81 Ga0268266_10222175 3300028379 Bacteria 1737
82 Ga0268265_10131283 3300028380 Bacteria 2082
83 Ga0307515_10037030 3300028794 Bacteria 7863
84 Ga0307515_10083937 3300028794 Bacteria 4099
85 Ga0307514_10143179 3300031649 Bacteria 1620
86 Ga0307406_10021836 3300031901 Bacteria 3792
87 Ga0395899_0017407 3300037312 Bacteria 5475
88 Ga0395899_0022144 3300037312 Bacteria 4818
89 Ga0395900_0002120 3300037418 Bacteria 22195
90 Ga0395900_0125425 3300037418 Bacteria 2633
91 Ga0395898_0000158 3300037466 Bacteria 172981
92 Ga0395901_0015198 3300038443 Bacteria 7831
93 Ga0395901_0261091 3300038443 Bacteria 1803
94 Ga0451791_0549191 3300041451 Bacteria 1230
95 Ga0466972_0011669 3300044658 Bacteria 4412
96 Ga0466965_0000019 3300044683 Bacteria 63668
97 Ga0466965_0014915 3300044683 Bacteria 3683
98 Ga0466965_0051923 3300044683 Bacteria 2035
99 Ga0466961_0048834 3300044693 Bacteria 2705
100 Ga0466961_0059507 3300044693 Bacteria 2430
101 Ga0466961_0078223 3300044693 Bacteria 2095
102 Ga0466971_0010107 3300044719 Bacteria 4122
103 Ga0466970_0007961 3300044765 Bacteria 5321
104 Ga0466970_0020276 3300044765 Bacteria 3452
105 Ga0466970_0032975 3300044765 Bacteria 2737
106 Ga0466970_0035305 3300044765 Bacteria 2649
107 Ga0466957_0061665 3300044842 Bacteria 2302
108 Ga0466960_0062272 3300044901 Bacteria 1833
109 Ga0466960_0169894 3300044901 Bacteria 1176
110 Ga0466959_0023807 3300045049 Bacteria 4534
111 Ga0466958_0122961 3300045836 Bacteria 1626
112 Ga0495590_0000076 3300046457 Bacteria 68651
113 Ga0495654_0000122 3300046530 Bacteria 86717
114 Ga0495668_0000123 3300046616 Bacteria 115173
115 Ga0495672_0008180 3300047320 Bacteria 7758
116 Ga0495672_0020549 3300047320 Bacteria 4322
117 Ga0495686_0024564 3300047472 Bacteria 3958
118 Ga0495686_0106185 3300047472 Bacteria 1689
119 Ga0496101_0017311 3300048904 Bacteria 4888
120 Ga0496102_0222658 3300048905 Bacteria 1779
121 Ga0496104_0059618 3300048907 Bacteria 3613
122 Ga0496104_0119953 3300048907 Bacteria 2525
123 Ga0496105_0005565 3300048908 Bacteria 9567
124 Ga0496113_0309742 3300048916 Bacteria 1265
125 Ga0496114_0013379 3300048917 Bacteria 6578
126 Ga0496114_0017264 3300048917 Bacteria 5823
127 Ga0496116_0018654 3300048919 Bacteria 5336
128 Ga0496117_0000091 3300048920 Bacteria 203826
129 Ga0496117_0000255 3300048920 Bacteria 100069
130 Ga0496117_0000451 3300048920 Bacteria 68385
131 Ga0496117_0038225 3300048920 Bacteria 3563
132 Ga0496117_0040843 3300048920 Bacteria 3407
133 Ga0496118_0000229 3300048921 Bacteria 98023
134 Ga0496118_0059107 3300048921 Bacteria 2858
135 Ga0496118_0099386 3300048921 Bacteria 1972
136 Ga0496119_0001294 3300048922 Bacteria 30906
137 Ga0496119_0008549 3300048922 Bacteria 8978
138 Ga0496119_0011744 3300048922 Bacteria 7205
139 Ga0496120_0006173 3300048923 Bacteria 9276
140 Ga0496120_0032326 3300048923 Bacteria 3156
141 Ga0496121_0000005 3300048924 Bacteria 1034486
142 Ga0496121_0000046 3300048924 Bacteria 335942
143 Ga0496121_0002138 3300048924 Bacteria 31031
144 Ga0496121_0009681 3300048924 Bacteria 11038
145 Ga0496121_0027623 3300048924 Bacteria 5306
146 Ga0496122_0001668 3300048925 Bacteria 34430
147 Ga0496122_0006095 3300048925 Bacteria 14042
148 Ga0496122_0036877 3300048925 Bacteria 3945
149 Ga0496122_0161967 3300048925 Bacteria 1363
150 Ga0496123_0000363 3300048926 Bacteria 85560
151 Ga0496123_0014270 3300048926 Bacteria 6598
152 Ga0496123_0021923 3300048926 Bacteria 4945
153 Ga0496123_0058846 3300048926 Bacteria 2489
154 Ga0496124_0000301 3300048927 Bacteria 91222
155 Ga0496124_0038728 3300048927 Bacteria 4137
156 Ga0496124_0069104 3300048927 Bacteria 2933
157 Ga0496124_0107438 3300048927 Bacteria 2251
158 Ga0496124_0193973 3300048927 Bacteria 1551
159 Ga0496125_0000107 3300048928 Bacteria 197483
160 Ga0496125_0018970 3300048928 Bacteria 6509
161 Ga0496126_0007904 3300048929 Bacteria 11577
162 Ga0496126_0010709 3300048929 Bacteria 9580
163 Ga0496126_0016273 3300048929 Bacteria 7443
164 Ga0496126_0130527 3300048929 Bacteria 2171
165 Ga0496126_0151886 3300048929 Bacteria 1984
166 Ga0496126_0366456 3300048929 Bacteria 1176
167 Ga0501031_0011211 3300049568 Bacteria 5841
168 Ga0501032_0010835 3300049569 Bacteria 6562
169 Ga0501032_0048636 3300049569 Bacteria 2863
170 Ga0501032_0051041 3300049569 Bacteria 2789
171 Ga0501033_0000552 3300049570 Bacteria 34849
172 Ga0501033_0109979 3300049570 Bacteria 2006
173 Ga0501033_0125350 3300049570 Bacteria 1862
174 Ga0501034_0007839 3300049571 Bacteria 11356
175 Ga0501034_0013473 3300049571 Bacteria 8415
176 Ga0501034_0025362 3300049571 Bacteria 6035
177 Ga0501034_0037902 3300049571 Bacteria 4882
178 Ga0501034_0040696 3300049571 Bacteria 4703
179 Ga0501034_0046178 3300049571 Bacteria 4401
180 Ga0501034_0053505 3300049571 Bacteria 4064
181 Ga0501034_0092636 3300049571 Bacteria 3018
182 Ga0501034_0109212 3300049571 Bacteria 2757
183 Ga0501034_0254975 3300049571 Bacteria 1698
184 Ga0501036_0001327 3300049572 Bacteria 18984
185 Ga0501036_0008662 3300049572 Bacteria 8347
186 Ga0501036_0014485 3300049572 Bacteria 6568
187 Ga0501037_0001812 3300049573 Bacteria 15524
188 Ga0501037_0010710 3300049573 Bacteria 6737
189 Ga0501037_0017450 3300049573 Bacteria 5283
190 Ga0501037_0018007 3300049573 Bacteria 5200
191 Ga0501037_0056995 3300049573 Bacteria 2853
192 Ga0501038_0009102 3300049574 Bacteria 9112
193 Ga0501038_0011055 3300049574 Bacteria 8243
194 Ga0501038_0023914 3300049574 Bacteria 5455
195 Ga0501038_0156712 3300049574 Bacteria 1854
196 Ga0501039_0018821 3300049575 Bacteria 5300
197 Ga0501039_0075231 3300049575 Bacteria 2625
198 Ga0501042_0002490 3300049578 Bacteria 11330
199 Ga0501042_0010594 3300049578 Bacteria 6191
200 Ga0501042_0029715 3300049578 Bacteria 3855
201 Ga0501043_0001451 3300049579 Bacteria 20715
202 Ga0501043_0007255 3300049579 Bacteria 8801
203 Ga0501046_0004573 3300049580 Bacteria 12518
204 Ga0501046_0029222 3300049580 Bacteria 4483
205 Ga0501046_0097699 3300049580 Bacteria 2256
206 Ga0501046_0291893 3300049580 Bacteria 1192
207 Ga0501047_0001493 3300049581 Bacteria 22795
208 Ga0501047_0024908 3300049581 Bacteria 5746
209 Ga0501047_0030146 3300049581 Bacteria 5230
210 Ga0501047_0050042 3300049581 Bacteria 4034
211 Ga0501047_0060960 3300049581 Bacteria 3640
212 Ga0501047_0272869 3300049581 Bacteria 1537
213 Ga0501048_0005781 3300049582 Bacteria 9402
214 Ga0501048_0005986 3300049582 Bacteria 9266
215 Ga0501069_0017126 3300049585 Bacteria 3896
216 Ga0501069_0034341 3300049585 Bacteria 2793
217 Ga0501069_0085402 3300049585 Bacteria 1781
218 Ga0501070_0000317 3300049586 Bacteria 43770
219 Ga0501070_0000620 3300049586 Bacteria 32572
220 Ga0501070_0012834 3300049586 Bacteria 7061
221 Ga0501070_0018927 3300049586 Bacteria 5776
222 Ga0501070_0019723 3300049586 Bacteria 5655
223 Ga0501071_0000631 3300049587 Bacteria 18302
224 Ga0501071_0249362 3300049587 Bacteria 1340
225 Ga0501072_0154309 3300049588 Bacteria 1831
226 Ga0501073_0000025 3300049589 Bacteria 127490
227 Ga0501073_0009182 3300049589 Bacteria 7294
228 Ga0501073_0016785 3300049589 Bacteria 5305
229 Ga0501073_0043587 3300049589 Bacteria 3164
230 Ga0501073_0047551 3300049589 Bacteria 3015
231 Ga0501073_0067567 3300049589 Bacteria 2492
232 Ga0501074_0002198 3300049590 Bacteria 13524
233 Ga0501074_0017757 3300049590 Bacteria 5167
234 Ga0501080_0000339 3300049742 Bacteria 35944
235 Ga0501080_0004262 3300049742 Bacteria 12693
236 Ga0501080_0024103 3300049742 Bacteria 5640
237 Ga0501080_0447658 3300049742 Bacteria 1158
238 Ga0501083_0000051 3300049744 Bacteria 85348
239 Ga0501083_0006437 3300049744 Bacteria 8331
240 Ga0501083_0082687 3300049744 Bacteria 2127
241 Ga0501035_0004510 3300049822 Bacteria 13214
242 Ga0501035_0023191 3300049822 Bacteria 5692
243 Ga0501035_0199138 3300049822 Bacteria 1719
244 Ga0501044_0010081 3300049823 Bacteria 10271
245 Ga0501044_0013737 3300049823 Bacteria 8751
246 Ga0501044_0014045 3300049823 Bacteria 8647
247 Ga0501044_0046546 3300049823 Bacteria 4490
248 Ga0501044_0059477 3300049823 Bacteria 3914
249 Ga0501044_0204025 3300049823 Bacteria 1934
250 Ga0501045_0071688 3300049824 Bacteria 2550
251 Ga0501045_0116687 3300049824 Bacteria 1981
252 nmdc:mga00v17_1470_c1 3300050491 Bacteria 12338
253 nmdc:mga00v17_168_c1 3300050491 Bacteria 38334
254 nmdc:mga00v17_192539_c1 3300050491 Bacteria 1317
255 nmdc:mga00v17_37315_c1 3300050491 Bacteria 2901
256 nmdc:mga00v17_510_c1 3300050491 Bacteria 21768
257 nmdc:mga0yw44_116286_c1 3300050492 Bacteria 1719
258 nmdc:mga0yw44_33344_c1 3300050492 Bacteria 3008
259 nmdc:mga0yw44_649_c1 3300050492 Bacteria 12647
260 nmdc:mga07m45_217190_c1 3300050496 Bacteria 1112
261 nmdc:mga08y16_168743_c1 3300050511 Bacteria 2273
262 Ga0500635_0000059 3300053080 Bacteria 72321
263 Ga0500643_000181 3300053087 Bacteria 61492
264 Ga0500556_0000008 3300053104 Bacteria 304943
265 Ga0500556_0000108 3300053104 Bacteria 74136
266 Ga0500562_004146 3300053108 Bacteria 3655
267 Ga0500593_000842 3300053117 Bacteria 11437
268 Ga0500618_000464 3300053125 Bacteria 26377
269 Ga0500655_018176 3300053133 Bacteria 1305
270 Ga0500559_0000269 3300053136 Bacteria 40462
271 Ga0500559_0000416 3300053136 Bacteria 30508
272 Ga0500559_0000485 3300053136 Bacteria 28086
273 Ga0500559_0095161 3300053136 Bacteria 1367
274 Ga0500568_0000003 3300053139 Bacteria 863587
275 Ga0500568_0000072 3300053139 Bacteria 98290
276 Ga0500568_0000754 3300053139 Bacteria 23062
277 Ga0500568_0001893 3300053139 Bacteria 12869
278 Ga0500573_0001981 3300053140 Bacteria 10020
279 Ga0500573_0006392 3300053140 Bacteria 6374
280 Ga0500573_0015110 3300053140 Bacteria 4373
281 Ga0500573_0018826 3300053140 Bacteria 3943
282 Ga0500573_0130035 3300053140 Bacteria 1395
283 Ga0500577_0027879 3300053142 Bacteria 1939
284 Ga0500616_0000010 3300053153 Bacteria 761410
285 Ga0500616_0000209 3300053153 Bacteria 94705
286 Ga0500616_0002704 3300053153 Bacteria 14399
287 Ga0500616_0139087 3300053153 Bacteria 1137
288 Ga0500627_0016732 3300053158 Bacteria 2867
289 Ga0500645_024030 3300053730 Bacteria 1865
290 Ga0501084_0028269 3300054114 Bacteria 4686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_217190_c1 nmdc:mga07m45_217190_c1_191_1090 279
2 3300049742 Ga0501080_0004262 Ga0501080_0004262_8430_9512 293
3 3300049589 Ga0501073_0000025 Ga0501073_0000025_82564_83613 296
4 3300049571 Ga0501034_0040696 Ga0501034_0040696_1761_2810 301
5 3300049586 Ga0501070_0019723 Ga0501070_0019723_4367_5416 302
6 3300048923 Ga0496120_0032326 Ga0496120_0032326_497_1546 305
7 3300049571 Ga0501034_0109212 Ga0501034_0109212_1559_2614 305
8 3300049585 Ga0501069_0085402 Ga0501069_0085402_439_1488 305
9 3300053104 Ga0500556_0000108 Ga0500556_0000108_24034_25083 307
10 3300053117 Ga0500593_000842 Ga0500593_000842_5429_6478 307
11 3300053108 Ga0500562_004146 Ga0500562_004146_123_1172 308
12 3300053139 Ga0500568_0001893 Ga0500568_0001893_10462_11511 308
13 3300013105 Ga0157369_10013828 Ga0157369_100138285 309
14 3300048920 Ga0496117_0040843 Ga0496117_0040843_978_2027 309
15 3300053153 Ga0500616_0139087 Ga0500616_0139087_32_1081 311
16 iso_pu_bacteria 8056579771 8056582713 311
17 3300049571 Ga0501034_0092636 Ga0501034_0092636_847_1896 312
18 3300049589 Ga0501073_0009182 Ga0501073_0009182_3421_4470 312
19 3300049742 Ga0501080_0447658 Ga0501080_0447658_43_1092 312
20 3300044693 Ga0466961_0048834 Ga0466961_0048834_828_1886 315
21 3300044765 Ga0466970_0032975 Ga0466970_0032975_821_1879 315
22 3300044901 Ga0466960_0062272 Ga0466960_0062272_181_1239 315
23 3300049571 Ga0501034_0053505 Ga0501034_0053505_2557_3606 315
24 3300046457 Ga0495590_0000076 Ga0495590_0000076_53091_54140 316
25 3300037418 Ga0395900_0125425 Ga0395900_0125425_1283_2332 317
26 3300038443 Ga0395901_0261091 Ga0395901_0261091_101_1150 317
27 3300053136 Ga0500559_0000416 Ga0500559_0000416_8245_9294 317
28 3300048927 Ga0496124_0000301 Ga0496124_0000301_45775_46791 318
29 3300049571 Ga0501034_0037902 Ga0501034_0037902_791_1840 318
30 3300049573 Ga0501037_0010710 Ga0501037_0010710_5236_6285 318
31 3300049581 Ga0501047_0060960 Ga0501047_0060960_1403_2452 318
32 3300049586 Ga0501070_0000620 Ga0501070_0000620_24886_25935 318
33 3300049589 Ga0501073_0043587 Ga0501073_0043587_1960_3009 318
34 3300049742 Ga0501080_0000339 Ga0501080_0000339_25624_26673 318
35 3300049744 Ga0501083_0006437 Ga0501083_0006437_5823_6872 318
36 3300013105 Ga0157369_10150987 Ga0157369_101509872 321
37 3300049585 Ga0501069_0017126 Ga0501069_0017126_297_1346 321
38 3300049586 Ga0501070_0012834 Ga0501070_0012834_3690_4739 321
39 3300049587 Ga0501071_0000631 Ga0501071_0000631_10344_11393 321
40 iso_pu_bacteria 2643221681 2644455428 322
41 3300041451 Ga0451791_0549191 Ga0451791_0549191_27_1001 323
42 3300049586 Ga0501070_0000317 Ga0501070_0000317_10524_11573 323
43 iso_pu_bacteria 2837268691 2837271531 324
44 3300028794 Ga0307515_10037030 Ga0307515_100370307 325
45 3300049569 Ga0501032_0051041 Ga0501032_0051041_1100_2164 325
46 3300049571 Ga0501034_0007839 Ga0501034_0007839_8711_9775 325
47 3300049572 Ga0501036_0001327 Ga0501036_0001327_10804_11868 325
48 3300049573 Ga0501037_0017450 Ga0501037_0017450_1838_2902 325
49 3300049574 Ga0501038_0011055 Ga0501038_0011055_3833_4897 325
50 3300049578 Ga0501042_0029715 Ga0501042_0029715_658_1722 325
51 3300049580 Ga0501046_0029222 Ga0501046_0029222_2571_3635 325
52 3300049581 Ga0501047_0030146 Ga0501047_0030146_649_1713 325
53 3300049589 Ga0501073_0067567 Ga0501073_0067567_564_1628 325
54 3300049823 Ga0501044_0010081 Ga0501044_0010081_8379_9443 325
55 3300049824 Ga0501045_0116687 Ga0501045_0116687_452_1516 325
56 iso_pu_bacteria 2565956761 2566996580 325
57 iso_pu_bacteria 2585428094 2587861780 325
58 iso_pu_bacteria 2643221553 2643784869 325
59 iso_pu_bacteria 2643221572 2643877333 325
60 iso_pu_bacteria 2643221613 2644084655 325
61 iso_pu_bacteria 2643221616 2644094235 325
62 iso_pu_bacteria 2643221632 2644181555 325
63 iso_pu_bacteria 2643221635 2644197731 325
64 iso_pu_bacteria 2643221649 2644279997 325
65 iso_pu_bacteria 2643221669 2644384388 325
66 iso_pu_bacteria 2643221721 2644667267 325
67 iso_pu_bacteria 2738543005 2739204924 325
68 iso_pu_bacteria 2751185788 2753300822 325
69 iso_pu_bacteria 2808606372 2808899578 325
70 iso_pu_bacteria 2816332119 2816423795 325
71 iso_pu_bacteria 2821123053 2821127198 325
72 iso_pu_bacteria 2835188231 2835188331 325
73 iso_pu_bacteria 2838736955 2838740659 325
74 iso_pu_bacteria 2841840854 2841844500 325
75 iso_pu_bacteria 2842140634 2842144432 325
76 iso_pu_bacteria 2844841374 2844844533 325
77 iso_pu_bacteria 2844852863 2844853776 325
78 iso_pu_bacteria 2852643534 2852643829 325
79 iso_pu_bacteria 2857531043 2857534822 325
80 iso_pu_bacteria 2857729791 2857731642 325
81 iso_pu_bacteria 2857733635 2857736976 325
82 iso_pu_bacteria 2857737099 2857738929 325
83 iso_pu_bacteria 2862993130 2862994279 325
84 iso_pu_bacteria 2870622029 2870625151 325
85 iso_pu_bacteria 2883821847 2883824752 325
86 iso_pu_bacteria 2884763398 2884763683 325
87 iso_pu_bacteria 2895660088 2895661854 325
88 iso_pu_bacteria 2904430863 2904431245 325
89 iso_pu_bacteria 2904501621 2904504639 325
90 iso_pu_bacteria 2904535858 2904539098 325
91 iso_pu_bacteria 2908674828 2908674933 325
92 iso_pu_bacteria 2909074476 2909075752 325
93 iso_pu_bacteria 2919039151 2919041015 325
94 iso_pu_bacteria 2919042368 2919046001 325
95 iso_pu_bacteria 2919055335 2919056490 325
96 iso_pu_bacteria 2919443155 2919444382 325
97 iso_pu_bacteria 2919523602 2919526484 325
98 iso_pu_bacteria 2922554459 2922555765 325
99 iso_pu_bacteria 2928104781 2928106649 325
100 iso_pu_bacteria 2928121344 2928124455 325
101 iso_pu_bacteria 2928142448 2928144343 325
102 iso_pu_bacteria 2928153084 2928155298 325
103 iso_pu_bacteria 2928500415 2928501901 325
104 iso_pu_bacteria 2929138655 2929142316 325
105 iso_pu_bacteria 2935890801 2935892467 325
106 iso_pu_bacteria 2939657138 2939659920 325
107 iso_pu_bacteria 2939660829 2939661805 325
108 iso_pu_bacteria 2964326757 2964327722 325
109 iso_pu_bacteria 2966921586 2966922473 325
110 iso_pu_bacteria 2966924647 2966927360 325
111 iso_pu_bacteria 2984551494 2984552890 325
112 iso_pu_bacteria 8054357960 8054358028 325
113 iso_pu_bacteria 8056037122 8056040589 325
114 iso_pu_bacteria 8057345674 8057346740 325
115 3300006038 Ga0075365_10005673 Ga0075365_100056732 326
116 3300006051 Ga0075364_10009135 Ga0075364_100091356 326
117 3300038443 Ga0395901_0015198 Ga0395901_0015198_1350_2414 326
118 3300044683 Ga0466965_0051923 Ga0466965_0051923_366_1439 326
119 3300044765 Ga0466970_0035305 Ga0466970_0035305_1271_2359 326
120 3300048907 Ga0496104_0119953 Ga0496104_0119953_1292_2350 326
121 3300048926 Ga0496123_0058846 Ga0496123_0058846_340_1386 326
122 3300048927 Ga0496124_0193973 Ga0496124_0193973_470_1516 326
123 3300050491 nmdc:mga00v17_1470_c1 nmdc:mga00v17_1470_c1_7100_8146 326
124 3300050491 nmdc:mga00v17_192539_c1 nmdc:mga00v17_192539_c1_134_1186 326
125 3300050492 nmdc:mga0yw44_116286_c1 nmdc:mga0yw44_116286_c1_251_1303 326
126 3300020069 Ga0197907_10545534 Ga0197907_105455341 327
127 3300025253 Ga0209677_102238 Ga0209677_1022382 327
128 iso_pu_bacteria 2995726249 2995729192 327
129 iso_pu_bacteria 8055034563 8055037468 327
130 iso_pu_bacteria 8055037949 8055039717 327
131 3300005437 Ga0070710_10011037 Ga0070710_100110372 328
132 3300005548 Ga0070665_100043477 Ga0070665_1000434773 328
133 3300006051 Ga0075364_10000018 Ga0075364_1000001857 328
134 3300025898 Ga0207692_10011844 Ga0207692_100118442 328
135 3300028379 Ga0268266_10050758 Ga0268266_100507581 328
136 3300050491 nmdc:mga00v17_510_c1 nmdc:mga00v17_510_c1_19307_20356 328
137 3300001979 JGI24740J21852_10043128 JGI24740J21852_100431282 329
138 3300001989 JGI24739J22299_10012849 JGI24739J22299_100128494 329
139 3300001989 JGI24739J22299_10028282 JGI24739J22299_100282821 329
140 3300001990 JGI24737J22298_10023966 JGI24737J22298_100239662 329
141 3300002067 JGI24735J21928_10006352 JGI24735J21928_100063525 329
142 3300002772 JGI25164J39214_1000503 JGI25164J39214_100050314 329
143 3300003214 JGI25165J46597_1000092 JGI25165J46597_100009257 329
144 3300003578 Ga0006562J51391_1020254 Ga0006562J51391_102025410 329
145 3300003578 Ga0006562J51391_1020255 Ga0006562J51391_10202552 329
146 3300003752 Ga0055539_1000006 Ga0055539_1000006499 329
147 3300003756 Ga0055533_1000002 Ga0055533_1000002584 329
148 3300003759 Ga0055525_1000205 Ga0055525_100020532 329
149 3300003760 Ga0055527_1000004 Ga0055527_100000489 329
150 3300003762 Ga0055542_1000055 Ga0055542_100005589 329
151 3300003763 Ga0055529_1000066 Ga0055529_100006672 329
152 3300003841 Ga0055541_1002759 Ga0055541_10027593 329
153 3300005288 Ga0065714_10009521 Ga0065714_100095212 329
154 3300005327 Ga0070658_10000261 Ga0070658_1000026117 329
155 3300005327 Ga0070658_10023544 Ga0070658_100235442 329
156 3300005367 Ga0070667_100067931 Ga0070667_1000679311 329
157 3300005367 Ga0070667_100311585 Ga0070667_1003115852 329
158 3300005437 Ga0070710_10010159 Ga0070710_100101594 329
159 3300005456 Ga0070678_100151048 Ga0070678_1001510482 329
160 3300005546 Ga0070696_100000205 Ga0070696_10000020519 329
161 3300005548 Ga0070665_100262238 Ga0070665_1002622382 329
162 3300005563 Ga0068855_100000930 Ga0068855_1000009308 329
163 3300005563 Ga0068855_100015379 Ga0068855_1000153794 329
164 3300005563 Ga0068855_100240594 Ga0068855_1002405942 329
165 3300005577 Ga0068857_100086887 Ga0068857_1000868873 329
166 3300005844 Ga0068862_100252076 Ga0068862_1002520762 329
167 3300005937 Ga0081455_10009494 Ga0081455_1000949414 329
168 3300006038 Ga0075365_10009258 Ga0075365_100092584 329
169 3300006051 Ga0075364_10006445 Ga0075364_100064452 329
170 3300006051 Ga0075364_10006676 Ga0075364_100066764 329
171 3300006186 Ga0075369_10023828 Ga0075369_100238284 329
172 3300006946 Ga0079104_1000044 Ga0079104_100004430 329
173 3300009094 Ga0111539_10172904 Ga0111539_101729043 329
174 3300009101 Ga0105247_10012882 Ga0105247_100128825 329
175 3300009177 Ga0105248_10000340 Ga0105248_1000034018 329
176 3300009545 Ga0105237_10065306 Ga0105237_100653064 329
177 3300009551 Ga0105238_10457933 Ga0105238_104579332 329
178 3300013102 Ga0157371_10000447 Ga0157371_1000044729 329
179 3300013105 Ga0157369_10001527 Ga0157369_100015279 329
180 3300013105 Ga0157369_10133695 Ga0157369_101336953 329
181 3300013306 Ga0163162_10347803 Ga0163162_103478031 329
182 3300025225 Ga0209566_100013 Ga0209566_100013204 329
183 3300025226 Ga0209674_100001 Ga0209674_1000012979 329
184 3300025228 Ga0209672_100011 Ga0209672_10001189 329
185 3300025229 Ga0209147_100892 Ga0209147_1008927 329
186 3300025230 Ga0209563_100001 Ga0209563_1000012979 329
187 3300025231 Ga0207427_100182 Ga0207427_1001822 329
188 3300025233 Ga0209437_101207 Ga0209437_1012072 329
189 3300025242 Ga0209258_103393 Ga0209258_1033935 329
190 3300025253 Ga0209677_100001 Ga0209677_1000012979 329
191 3300025254 Ga0209148_1000132 Ga0209148_100013273 329
192 3300025261 Ga0209233_1000014 Ga0209233_1000014888 329
193 3300025272 Ga0209455_1000122 Ga0209455_100012289 329
194 3300025272 Ga0209455_1001399 Ga0209455_10013996 329
195 3300025904 Ga0207647_10014391 Ga0207647_100143917 329
196 3300025904 Ga0207647_10022256 Ga0207647_100222565 329
197 3300025909 Ga0207705_10000001 Ga0207705_10000001854 329
198 3300025914 Ga0207671_10038042 Ga0207671_100380424 329
199 3300025941 Ga0207711_10000849 Ga0207711_100008495 329
200 3300025949 Ga0207667_10000837 Ga0207667_1000083716 329
201 3300025949 Ga0207667_10232967 Ga0207667_102329672 329
202 3300026116 Ga0207674_10109035 Ga0207674_101090353 329
203 3300026118 Ga0207675_100150528 Ga0207675_1001505281 329
204 3300026121 Ga0207683_10130632 Ga0207683_101306322 329
205 3300027111 Ga0209281_1000129 Ga0209281_1000129140 329
206 3300028379 Ga0268266_10222175 Ga0268266_102221752 329
207 3300028380 Ga0268265_10131283 Ga0268265_101312832 329
208 3300028794 Ga0307515_10083937 Ga0307515_100839375 329
209 3300031649 Ga0307514_10143179 Ga0307514_101431792 329
210 3300031901 Ga0307406_10021836 Ga0307406_100218364 329
211 3300037312 Ga0395899_0017407 Ga0395899_0017407_993_2042 329
212 3300037312 Ga0395899_0022144 Ga0395899_0022144_1472_2521 329
213 3300037418 Ga0395900_0002120 Ga0395900_0002120_15037_16086 329
214 3300037466 Ga0395898_0000158 Ga0395898_0000158_71174_72223 329
215 3300044658 Ga0466972_0011669 Ga0466972_0011669_1432_2481 329
216 3300044683 Ga0466965_0000019 Ga0466965_0000019_17265_18314 329
217 3300044683 Ga0466965_0014915 Ga0466965_0014915_36_1085 329
218 3300044693 Ga0466961_0059507 Ga0466961_0059507_69_1118 329
219 3300044693 Ga0466961_0078223 Ga0466961_0078223_236_1285 329
220 3300044719 Ga0466971_0010107 Ga0466971_0010107_1398_2447 329
221 3300044765 Ga0466970_0007961 Ga0466970_0007961_2872_3921 329
222 3300044765 Ga0466970_0020276 Ga0466970_0020276_555_1604 329
223 3300044842 Ga0466957_0061665 Ga0466957_0061665_462_1511 329
224 3300044901 Ga0466960_0169894 Ga0466960_0169894_90_1139 329
225 3300045049 Ga0466959_0023807 Ga0466959_0023807_2958_4007 329
226 3300045836 Ga0466958_0122961 Ga0466958_0122961_448_1497 329
227 3300046530 Ga0495654_0000122 Ga0495654_0000122_45672_46721 329
228 3300046616 Ga0495668_0000123 Ga0495668_0000123_105013_106062 329
229 3300047320 Ga0495672_0008180 Ga0495672_0008180_5175_6224 329
230 3300047320 Ga0495672_0020549 Ga0495672_0020549_2783_3832 329
231 3300047472 Ga0495686_0024564 Ga0495686_0024564_442_1491 329
232 3300047472 Ga0495686_0106185 Ga0495686_0106185_123_1175 329
233 3300048904 Ga0496101_0017311 Ga0496101_0017311_947_1996 329
234 3300048905 Ga0496102_0222658 Ga0496102_0222658_458_1507 329
235 3300048907 Ga0496104_0059618 Ga0496104_0059618_2321_3370 329
236 3300048908 Ga0496105_0005565 Ga0496105_0005565_3573_4622 329
237 3300048916 Ga0496113_0309742 Ga0496113_0309742_163_1212 329
238 3300048917 Ga0496114_0013379 Ga0496114_0013379_2131_3180 329
239 3300048917 Ga0496114_0017264 Ga0496114_0017264_1714_2763 329
240 3300048919 Ga0496116_0018654 Ga0496116_0018654_256_1305 329
241 3300048920 Ga0496117_0000091 Ga0496117_0000091_96100_97149 329
242 3300048920 Ga0496117_0000255 Ga0496117_0000255_17724_18773 329
243 3300048920 Ga0496117_0000451 Ga0496117_0000451_18263_19312 329
244 3300048920 Ga0496117_0038225 Ga0496117_0038225_415_1464 329
245 3300048921 Ga0496118_0000229 Ga0496118_0000229_51390_52439 329
246 3300048921 Ga0496118_0059107 Ga0496118_0059107_985_2034 329
247 3300048921 Ga0496118_0099386 Ga0496118_0099386_576_1625 329
248 3300048922 Ga0496119_0001294 Ga0496119_0001294_23653_24702 329
249 3300048922 Ga0496119_0008549 Ga0496119_0008549_770_1819 329
250 3300048922 Ga0496119_0011744 Ga0496119_0011744_2653_3702 329
251 3300048923 Ga0496120_0006173 Ga0496120_0006173_1683_2732 329
252 3300048924 Ga0496121_0000005 Ga0496121_0000005_392446_393495 329
253 3300048924 Ga0496121_0000046 Ga0496121_0000046_297034_298083 329
254 3300048924 Ga0496121_0002138 Ga0496121_0002138_22305_23354 329
255 3300048924 Ga0496121_0009681 Ga0496121_0009681_4848_5897 329
256 3300048924 Ga0496121_0027623 Ga0496121_0027623_907_1956 329
257 3300048925 Ga0496122_0001668 Ga0496122_0001668_13078_14127 329
258 3300048925 Ga0496122_0006095 Ga0496122_0006095_61_1110 329
259 3300048925 Ga0496122_0036877 Ga0496122_0036877_2845_3894 329
260 3300048925 Ga0496122_0161967 Ga0496122_0161967_301_1350 329
261 3300048926 Ga0496123_0000363 Ga0496123_0000363_66944_67993 329
262 3300048926 Ga0496123_0014270 Ga0496123_0014270_2609_3658 329
263 3300048926 Ga0496123_0021923 Ga0496123_0021923_3094_4143 329
264 3300048927 Ga0496124_0038728 Ga0496124_0038728_2240_3289 329
265 3300048927 Ga0496124_0069104 Ga0496124_0069104_918_1967 329
266 3300048927 Ga0496124_0107438 Ga0496124_0107438_1034_2083 329
267 3300048928 Ga0496125_0000107 Ga0496125_0000107_104836_105885 329
268 3300048928 Ga0496125_0018970 Ga0496125_0018970_1907_2956 329
269 3300048929 Ga0496126_0007904 Ga0496126_0007904_1885_2934 329
270 3300048929 Ga0496126_0010709 Ga0496126_0010709_7667_8716 329
271 3300048929 Ga0496126_0016273 Ga0496126_0016273_2758_3807 329
272 3300048929 Ga0496126_0130527 Ga0496126_0130527_284_1333 329
273 3300048929 Ga0496126_0151886 Ga0496126_0151886_305_1354 329
274 3300048929 Ga0496126_0366456 Ga0496126_0366456_78_1127 329
275 3300049568 Ga0501031_0011211 Ga0501031_0011211_2684_3775 329
276 3300049569 Ga0501032_0010835 Ga0501032_0010835_2881_3972 329
277 3300049569 Ga0501032_0048636 Ga0501032_0048636_1315_2364 329
278 3300049570 Ga0501033_0000552 Ga0501033_0000552_2484_3575 329
279 3300049570 Ga0501033_0109979 Ga0501033_0109979_914_1963 329
280 3300049570 Ga0501033_0125350 Ga0501033_0125350_580_1629 329
281 3300049571 Ga0501034_0013473 Ga0501034_0013473_2997_4088 329
282 3300049571 Ga0501034_0025362 Ga0501034_0025362_566_1615 329
283 3300049571 Ga0501034_0046178 Ga0501034_0046178_1883_2932 329
284 3300049571 Ga0501034_0254975 Ga0501034_0254975_386_1435 329
285 3300049572 Ga0501036_0008662 Ga0501036_0008662_1696_2745 329
286 3300049572 Ga0501036_0014485 Ga0501036_0014485_2879_3970 329
287 3300049573 Ga0501037_0001812 Ga0501037_0001812_15_1064 329
288 3300049573 Ga0501037_0018007 Ga0501037_0018007_1192_2283 329
289 3300049573 Ga0501037_0056995 Ga0501037_0056995_1301_2350 329
290 3300049574 Ga0501038_0009102 Ga0501038_0009102_4962_6053 329
291 3300049574 Ga0501038_0023914 Ga0501038_0023914_2220_3269 329
292 3300049574 Ga0501038_0156712 Ga0501038_0156712_545_1594 329
293 3300049575 Ga0501039_0018821 Ga0501039_0018821_1192_2283 329
294 3300049575 Ga0501039_0075231 Ga0501039_0075231_434_1483 329
295 3300049578 Ga0501042_0002490 Ga0501042_0002490_549_1598 329
296 3300049578 Ga0501042_0010594 Ga0501042_0010594_425_1474 329
297 3300049579 Ga0501043_0001451 Ga0501043_0001451_16763_17854 329
298 3300049579 Ga0501043_0007255 Ga0501043_0007255_5973_7022 329
299 3300049580 Ga0501046_0004573 Ga0501046_0004573_3394_4485 329
300 3300049580 Ga0501046_0097699 Ga0501046_0097699_111_1160 329
301 3300049580 Ga0501046_0291893 Ga0501046_0291893_38_1087 329
302 3300049581 Ga0501047_0001493 Ga0501047_0001493_6037_7086 329
303 3300049581 Ga0501047_0024908 Ga0501047_0024908_1696_2787 329
304 3300049581 Ga0501047_0050042 Ga0501047_0050042_784_1833 329
305 3300049581 Ga0501047_0272869 Ga0501047_0272869_414_1463 329
306 3300049582 Ga0501048_0005781 Ga0501048_0005781_6426_7475 329
307 3300049582 Ga0501048_0005986 Ga0501048_0005986_7132_8223 329
308 3300049585 Ga0501069_0034341 Ga0501069_0034341_1686_2777 329
309 3300049586 Ga0501070_0018927 Ga0501070_0018927_3485_4534 329
310 3300049587 Ga0501071_0249362 Ga0501071_0249362_244_1293 329
311 3300049588 Ga0501072_0154309 Ga0501072_0154309_431_1522 329
312 3300049589 Ga0501073_0016785 Ga0501073_0016785_1508_2599 329
313 3300049589 Ga0501073_0047551 Ga0501073_0047551_770_1819 329
314 3300049590 Ga0501074_0002198 Ga0501074_0002198_4719_5768 329
315 3300049590 Ga0501074_0017757 Ga0501074_0017757_1066_2157 329
316 3300049742 Ga0501080_0024103 Ga0501080_0024103_1578_2669 329
317 3300049744 Ga0501083_0000051 Ga0501083_0000051_41868_42917 329
318 3300049744 Ga0501083_0082687 Ga0501083_0082687_68_1147 329
319 3300049822 Ga0501035_0004510 Ga0501035_0004510_1002_2051 329
320 3300049822 Ga0501035_0023191 Ga0501035_0023191_1696_2787 329
321 3300049822 Ga0501035_0199138 Ga0501035_0199138_459_1508 329
322 3300049823 Ga0501044_0013737 Ga0501044_0013737_3574_4623 329
323 3300049823 Ga0501044_0014045 Ga0501044_0014045_4847_5938 329
324 3300049823 Ga0501044_0046546 Ga0501044_0046546_301_1371 329
325 3300049823 Ga0501044_0059477 Ga0501044_0059477_1968_3017 329
326 3300049823 Ga0501044_0204025 Ga0501044_0204025_363_1412 329
327 3300049824 Ga0501045_0071688 Ga0501045_0071688_1191_2282 329
328 3300050491 nmdc:mga00v17_168_c1 nmdc:mga00v17_168_c1_34928_35977 329
329 3300050491 nmdc:mga00v17_37315_c1 nmdc:mga00v17_37315_c1_1037_2086 329
330 3300050492 nmdc:mga0yw44_33344_c1 nmdc:mga0yw44_33344_c1_64_1113 329
331 3300050492 nmdc:mga0yw44_649_c1 nmdc:mga0yw44_649_c1_10750_11799 329
332 3300050511 nmdc:mga08y16_168743_c1 nmdc:mga08y16_168743_c1_921_1970 329
333 3300053080 Ga0500635_0000059 Ga0500635_0000059_64565_65614 329
334 3300053087 Ga0500643_000181 Ga0500643_000181_18387_19436 329
335 3300053104 Ga0500556_0000008 Ga0500556_0000008_193092_194141 329
336 3300053125 Ga0500618_000464 Ga0500618_000464_3779_4828 329
337 3300053133 Ga0500655_018176 Ga0500655_018176_168_1217 329
338 3300053136 Ga0500559_0000269 Ga0500559_0000269_26774_27823 329
339 3300053136 Ga0500559_0000485 Ga0500559_0000485_413_1462 329
340 3300053136 Ga0500559_0095161 Ga0500559_0095161_300_1349 329
341 3300053139 Ga0500568_0000003 Ga0500568_0000003_115964_117013 329
342 3300053139 Ga0500568_0000072 Ga0500568_0000072_80_1132 329
343 3300053139 Ga0500568_0000754 Ga0500568_0000754_2159_3208 329
344 3300053140 Ga0500573_0001981 Ga0500573_0001981_946_1995 329
345 3300053140 Ga0500573_0006392 Ga0500573_0006392_1290_2339 329
346 3300053140 Ga0500573_0015110 Ga0500573_0015110_2720_3769 329
347 3300053140 Ga0500573_0018826 Ga0500573_0018826_687_1757 329
348 3300053140 Ga0500573_0130035 Ga0500573_0130035_88_1137 329
349 3300053142 Ga0500577_0027879 Ga0500577_0027879_77_1126 329
350 3300053153 Ga0500616_0000010 Ga0500616_0000010_93880_94929 329
351 3300053153 Ga0500616_0000209 Ga0500616_0000209_83814_84863 329
352 3300053153 Ga0500616_0002704 Ga0500616_0002704_2294_3343 329
353 3300053158 Ga0500627_0016732 Ga0500627_0016732_549_1598 329
354 3300053730 Ga0500645_024030 Ga0500645_024030_198_1247 329
355 3300054114 Ga0501084_0028269 Ga0501084_0028269_2739_3830 329
356 iso_pu_bacteria 2848551377 2848551797 329
357 iso_pu_bacteria 3002998708 3003001113 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

138

341

0.96

PF03099

BPL_LplA_LipB

Biotin/lipoate A/B protein ligase family

174

291

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r07-assembly1.cif.gz_A structural analysis of an archaeal lipoylation system. a bi-partite lipoate protein ligase and its e2 lipoyl domain from thermoplasma acidophilum 0.8741 100 324
6jom-assembly1.cif.gz_A crystal structure of lipoate protein ligase from mycoplasma hyopneumoniae 0.8454 102 323
2aru-assembly1.cif.gz_A crystal structure of lipoate-protein ligase a bound with atp 0.8328 100 324
2c8m-assembly4.cif.gz_D structure of protein ta0514, putative lipoate protein ligase from t. acidophilum with bound lipoic acid 0.8292 100 324
2c7i-assembly2.cif.gz_B structure of protein ta0514, putative lipoate protein ligase from t. acidophilum. 0.824 100 326
ID Description Score Start End Superfamily
3r07A00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8741 100 324 3.30.930.10
af_Q2FZN7_2_241_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8621 102 324 3.30.930.10
af_Q2FY37_5_276_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8311 101 326 3.30.930.10
1vqzA02 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.8292 1 86 3.30.390.50
af_Q54KY1_54_299_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8263 100 323 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A4S1ECE8-F1-model_v4 Biotin--protein ligase 1 2 90 GO:0016874
AF-A0A4R3LPN1-F1-model_v4 Lipoate--protein ligase 0.9944 2 90
AF-A0A8B5XI26-F1-model_v4 Biotin--protein ligase 0.9895 2 90 GO:0016874
AF-M1L2C3-F1-model_v4 Lipoate--protein ligase 0.9878 1 90
AF-A0A0D0RY12-F1-model_v4 Lipoate-protein ligase A 0.9873 2 90 GO:0016874

Feature Viewer

pLDDT pTM Quality
90.64 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map