F420751

General Info

Members Datasets Scaffolds Average Seq Length
357 197 714 266

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100015657|Ga0070663_1000156574
Length 285
Sequence MGSRWGSLLEANVMSSLTAGEVVARIKKNLGFPWRATTYRDTFKFGGPDTVVKGIATTMFCTYDAIRRASEQGCNMIIPHEDTYWNDRDDIEIVNRDPSYKLKTDFMRKHDIVVFRMHDHMHAQKPDFTYVGCARALGLESRYETAPQSHHFILPETTLGELAATFQKRIGDRAIRVVGDPKAKVKHVRLGVGYATPSINNPDIDVVVSGEQQESDGFLDSPAYVLDDTALGIPKGWIMLGHNVSEEQGMLEMAQWIKSFTPEVPVQLVRSGEPFWVPKSVSLDE

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
121 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
197 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.52
Nodule 0
Rhizoplane 1.12
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 21.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100015657 3300005455 Bacteria 4903
2 SwRhRL3b_contig_104527 2162886006 Unclassified 1134
3 SwRhRL3b_contig_291315 2162886006 Unclassified 1134
4 SwRhRL3b_contig_963595 2162886006 Unclassified 1526
5 rootH1_10140506 3300003316 Bacteria 2117
6 rootL2_10061044 3300003322 Bacteria 6165
7 rootH1_10332258 3300003323 Bacteria 1527
8 Ga0065712_10145231 3300005290 Unclassified 1414
9 Ga0065715_10004673 3300005293 Bacteria 4496
10 Ga0065715_10191568 3300005293 Unclassified 1412
11 Ga0065715_10214907 3300005293 Unclassified 1297
12 Ga0065707_10008443 3300005295 Bacteria 2338
13 Ga0070658_10183963 3300005327 Bacteria 1759
14 Ga0070683_100316518 3300005329 Bacteria 1485
15 Ga0070670_100035851 3300005331 Bacteria 4270
16 Ga0068869_100091747 3300005334 Unclassified 2285
17 Ga0068869_100478775 3300005334 Bacteria 1036
18 Ga0070666_10046209 3300005335 Unclassified 2920
19 Ga0070666_10201271 3300005335 Bacteria 1401
20 Ga0070682_100147148 3300005337 Bacteria 1612
21 Ga0068868_100004685 3300005338 Bacteria 9605
22 Ga0070660_100191843 3300005339 Bacteria 1655
23 Ga0070689_100019190 3300005340 Bacteria 5053
24 Ga0070689_100156890 3300005340 Bacteria 1838
25 Ga0070661_100001851 3300005344 Bacteria 14663
26 Ga0070661_100067684 3300005344 Bacteria 2624
27 Ga0070675_100004159 3300005354 Bacteria 10993
28 Ga0070675_100004846 3300005354 Bacteria 10268
29 Ga0070675_100005009 3300005354 Bacteria 10116
30 Ga0070675_100079317 3300005354 Bacteria 2735
31 Ga0070675_100082407 3300005354 Bacteria 2684
32 Ga0070671_100006395 3300005355 Bacteria 9412
33 Ga0070671_100016421 3300005355 Bacteria 5987
34 Ga0070671_100051184 3300005355 Bacteria 3435
35 Ga0070671_100248624 3300005355 Bacteria 1510
36 Ga0070674_100189290 3300005356 Unclassified 1582
37 Ga0070674_100194838 3300005356 Unclassified 1561
38 Ga0070673_100060486 3300005364 Bacteria 3002
39 Ga0070673_100098246 3300005364 Unclassified 2406
40 Ga0070673_100236315 3300005364 Bacteria 1587
41 Ga0070673_100353743 3300005364 Unclassified 1304
42 Ga0070688_100017028 3300005365 Bacteria 4166
43 Ga0070667_100004775 3300005367 Bacteria 11348
44 Ga0070667_100022511 3300005367 Bacteria 5226
45 Ga0070714_100155183 3300005435 Bacteria 2066
46 Ga0070714_100560962 3300005435 Bacteria 1094
47 Ga0070701_10106593 3300005438 Bacteria 1560
48 Ga0070678_100503831 3300005456 Bacteria 1068
49 Ga0068867_100470049 3300005459 Bacteria 1075
50 Ga0070685_10014685 3300005466 Unclassified 4151
51 Ga0070685_10047350 3300005466 Bacteria 2472
52 Ga0070685_10202408 3300005466 Unclassified 1291
53 Ga0070679_100427939 3300005530 Bacteria 1269
54 Ga0068853_100045377 3300005539 Bacteria 3764
55 Ga0070672_100017287 3300005543 Bacteria 5187
56 Ga0070672_100222439 3300005543 Bacteria 1584
57 Ga0070672_100233884 3300005543 Unclassified 1544
58 Ga0070686_100012830 3300005544 Bacteria 4782
59 Ga0070704_100189297 3300005549 Bacteria 1653
60 Ga0068855_100067538 3300005563 Unclassified 4164
61 Ga0068855_100308130 3300005563 Unclassified 1752
62 Ga0070664_100000431 3300005564 Bacteria 31412
63 Ga0068854_100364041 3300005578 Unclassified 1187
64 Ga0068856_100211581 3300005614 Bacteria 1954
65 Ga0068852_100020849 3300005616 Bacteria 5217
66 Ga0068852_100089257 3300005616 Bacteria 2755
67 Ga0068859_100000628 3300005617 Bacteria 35337
68 Ga0068859_100005909 3300005617 Bacteria 12423
69 Ga0068859_100025701 3300005617 Bacteria 5905
70 Ga0068859_100068551 3300005617 Bacteria 3582
71 Ga0068859_100403110 3300005617 Unclassified 1464
72 Ga0068859_100437105 3300005617 Bacteria 1405
73 Ga0068861_100115012 3300005719 Bacteria 2161
74 Ga0068861_100437648 3300005719 Bacteria 1169
75 Ga0068863_100015370 3300005841 Bacteria 7357
76 Ga0068863_100138070 3300005841 Bacteria 2329
77 Ga0068858_100011719 3300005842 Bacteria 8268
78 Ga0068858_100017626 3300005842 Bacteria 6694
79 Ga0068858_100044224 3300005842 Bacteria 4129
80 Ga0068860_100011559 3300005843 Bacteria 8702
81 Ga0068860_100172366 3300005843 Bacteria 2090
82 Ga0068862_100045789 3300005844 Unclassified 3733
83 Ga0068862_100573709 3300005844 Bacteria 1080
84 Ga0068862_100739590 3300005844 Bacteria 956
85 Ga0070717_10218554 3300006028 Bacteria 1674
86 Ga0075365_10185527 3300006038 Bacteria 1455
87 Ga0075368_10193650 3300006042 Unclassified 859
88 Ga0075367_10117864 3300006178 Bacteria 1634
89 Ga0075367_10224786 3300006178 Bacteria 1175
90 Ga0075366_10087403 3300006195 Bacteria 1866
91 Ga0097621_100019177 3300006237 Bacteria 5245
92 Ga0097621_100165244 3300006237 Bacteria 1905
93 Ga0097621_100310517 3300006237 Bacteria 1395
94 Ga0068871_100030504 3300006358 Bacteria 4246
95 Ga0068871_100130925 3300006358 Bacteria 2127
96 Ga0068871_100234743 3300006358 Unclassified 1593
97 Ga0075428_100000042 3300006844 Bacteria 102264
98 Ga0075428_100050636 3300006844 Unclassified 4554
99 Ga0075430_100038624 3300006846 Unclassified 4043
100 Ga0075430_100147044 3300006846 Bacteria 1962
101 Ga0075431_100027468 3300006847 Bacteria 5839
102 Ga0075431_100086108 3300006847 Bacteria 3243
103 Ga0075431_100113639 3300006847 Bacteria 2795
104 Ga0075431_100228410 3300006847 Bacteria 1897
105 Ga0075431_100236063 3300006847 Unclassified 1862
106 Ga0075433_10048294 3300006852 Unclassified 3701
107 Ga0075433_10166338 3300006852 Bacteria 1963
108 Ga0075429_100131563 3300006880 Unclassified 2189
109 Ga0097620_100000628 3300006931 Bacteria 35337
110 Ga0097620_100005909 3300006931 Bacteria 12423
111 Ga0097620_100025701 3300006931 Bacteria 5905
112 Ga0097620_100068548 3300006931 Bacteria 3582
113 Ga0097620_100403132 3300006931 Unclassified 1464
114 Ga0097620_100437119 3300006931 Bacteria 1405
115 Ga0105240_10012069 3300009093 Bacteria 11971
116 Ga0105240_10385715 3300009093 Bacteria 1581
117 Ga0111539_10070034 3300009094 Unclassified 4141
118 Ga0105247_10094028 3300009101 Unclassified 1906
119 Ga0114129_10033888 3300009147 Bacteria 7213
120 Ga0105241_10088414 3300009174 Bacteria 2440
121 Ga0105241_10101281 3300009174 Bacteria 2290
122 Ga0105248_10027397 3300009177 Bacteria 6344
123 Ga0105248_10028440 3300009177 Bacteria 6228
124 Ga0105237_10126616 3300009545 Unclassified 2549
125 Ga0105238_10023945 3300009551 Bacteria 6224
126 Ga0105238_10127974 3300009551 Bacteria 2518
127 Ga0105238_10313333 3300009551 Bacteria 1554
128 Ga0105249_10034113 3300009553 Bacteria 4609
129 Ga0105239_10328298 3300010375 Bacteria 1725
130 Ga0157371_10257582 3300013102 Bacteria 1257
131 Ga0157370_10009751 3300013104 Bacteria 10196
132 Ga0157370_10256417 3300013104 Unclassified 1617
133 Ga0157369_10012682 3300013105 Bacteria 9558
134 Ga0157369_10200202 3300013105 Unclassified 2096
135 Ga0157369_10434309 3300013105 Bacteria 1360
136 Ga0157369_10499081 3300013105 Unclassified 1259
137 Ga0157374_10245290 3300013296 Bacteria 1762
138 Ga0157374_10623051 3300013296 Bacteria 1090
139 Ga0157378_10119169 3300013297 Unclassified 2430
140 Ga0163162_10001348 3300013306 Bacteria 22872
141 Ga0163162_10113837 3300013306 Unclassified 2804
142 Ga0157372_10008423 3300013307 Bacteria 10947
143 Ga0157372_10017778 3300013307 Bacteria 7633
144 Ga0157372_10092623 3300013307 Bacteria 3438
145 Ga0157375_10012861 3300013308 Bacteria 7435
146 Ga0157375_10024200 3300013308 Bacteria 5616
147 Ga0157375_10798682 3300013308 Unclassified 1092
148 Ga0163163_10005328 3300014325 Bacteria 11112
149 Ga0163163_10007059 3300014325 Bacteria 9873
150 Ga0163163_10009957 3300014325 Bacteria 8525
151 Ga0163163_10124920 3300014325 Bacteria 2610
152 Ga0157380_10068159 3300014326 Bacteria 2867
153 Ga0157377_10040202 3300014745 Bacteria 2588
154 Ga0157377_10124373 3300014745 Unclassified 1567
155 Ga0157379_10021919 3300014968 Bacteria 5660
156 Ga0157379_10233118 3300014968 Unclassified 1669
157 Ga0157376_10021948 3300014969 Bacteria 4966
158 Ga0163161_10027921 3300017792 Bacteria 4004
159 Ga0163161_10334659 3300017792 Unclassified 1200
160 Ga0207426_1027935 3300025302 Bacteria 1874
161 Ga0207680_10049141 3300025903 Unclassified 2509
162 Ga0207705_10037201 3300025909 Bacteria 3482
163 Ga0207695_10000331 3300025913 Bacteria 112894
164 Ga0207695_10426403 3300025913 Unclassified 1210
165 Ga0207671_10171738 3300025914 Unclassified 1684
166 Ga0207662_10269143 3300025918 Bacteria 1124
167 Ga0207649_10026413 3300025920 Unclassified 3397
168 Ga0207649_10045499 3300025920 Bacteria 2691
169 Ga0207694_10017269 3300025924 Bacteria 5454
170 Ga0207650_10014045 3300025925 Bacteria 5560
171 Ga0207659_10005472 3300025926 Bacteria 7701
172 Ga0207659_10017198 3300025926 Bacteria 4719
173 Ga0207659_10065896 3300025926 Bacteria 2626
174 Ga0207664_10419167 3300025929 Bacteria 1192
175 Ga0207644_10001748 3300025931 Bacteria 14056
176 Ga0207644_10036041 3300025931 Bacteria 3470
177 Ga0207644_10074661 3300025931 Bacteria 2489
178 Ga0207690_10005373 3300025932 Bacteria 7552
179 Ga0207706_10169857 3300025933 Bacteria 1916
180 Ga0207670_10127542 3300025936 Unclassified 1859
181 Ga0207670_10139873 3300025936 Bacteria 1784
182 Ga0207669_10118424 3300025937 Bacteria 1792
183 Ga0207669_10221765 3300025937 Unclassified 1388
184 Ga0207691_10009487 3300025940 Bacteria 9347
185 Ga0207691_10271882 3300025940 Unclassified 1459
186 Ga0207691_10510983 3300025940 Unclassified 1020
187 Ga0207711_10015283 3300025941 Bacteria 6373
188 Ga0207711_10096465 3300025941 Bacteria 2609
189 Ga0207661_10360495 3300025944 Unclassified 1313
190 Ga0207679_10012819 3300025945 Bacteria 5480
191 Ga0207679_10023666 3300025945 Bacteria 4203
192 Ga0207679_10510891 3300025945 Bacteria 1073
193 Ga0207667_10008994 3300025949 Bacteria 11815
194 Ga0207651_10049412 3300025960 Bacteria 2849
195 Ga0207651_10074611 3300025960 Unclassified 2416
196 Ga0207712_10078530 3300025961 Bacteria 2395
197 Ga0207712_10314257 3300025961 Bacteria 1290
198 Ga0207640_10288511 3300025981 Unclassified 1293
199 Ga0207658_10015981 3300025986 Bacteria 5156
200 Ga0207677_10009076 3300026023 Bacteria 5582
201 Ga0207703_10020679 3300026035 Bacteria 5148
202 Ga0207703_10093554 3300026035 Bacteria 2532
203 Ga0207703_10094089 3300026035 Bacteria 2525
204 Ga0207703_10378956 3300026035 Unclassified 1308
205 Ga0207639_10021497 3300026041 Unclassified 4635
206 Ga0207678_10001594 3300026067 Bacteria 20861
207 Ga0207702_10015944 3300026078 Bacteria 6221
208 Ga0207702_10227932 3300026078 Bacteria 1740
209 Ga0207641_10054094 3300026088 Bacteria 3405
210 Ga0207641_10098010 3300026088 Unclassified 2577
211 Ga0207641_10160043 3300026088 Bacteria 2046
212 Ga0207648_10178873 3300026089 Unclassified 1877
213 Ga0207676_10033324 3300026095 Bacteria 3890
214 Ga0207676_10067191 3300026095 Unclassified 2863
215 Ga0207683_10218846 3300026121 Bacteria 1735
216 Ga0207683_10514960 3300026121 Unclassified 1105
217 Ga0207698_10495107 3300026142 Unclassified 1188
218 Ga0207428_10000004 3300027907 Bacteria 727800
219 Ga0268265_10126786 3300028380 Bacteria 2114
220 Ga0265318_10007562 3300028577 Bacteria 4899
221 Ga0265336_10003148 3300028666 Bacteria 6569
222 Ga0265338_10014579 3300028800 Bacteria 8730
223 Ga0265338_10092640 3300028800 Bacteria 2491
224 Ga0265330_10000360 3300031235 Bacteria 32097
225 Ga0265332_10018523 3300031238 Bacteria 3072
226 Ga0265328_10004924 3300031239 Bacteria 5752
227 Ga0265325_10000499 3300031241 Bacteria 28359
228 Ga0265340_10002015 3300031247 Bacteria 11629
229 Ga0265339_10000641 3300031249 Bacteria 27051
230 Ga0265339_10051800 3300031249 Bacteria 2238
231 Ga0265331_10028994 3300031250 Bacteria 2765
232 Ga0265316_10001317 3300031344 Bacteria 26719
233 Ga0265313_10019192 3300031595 Unclassified 3814
234 Ga0265314_10000063 3300031711 Bacteria 159305
235 Ga0265342_10001454 3300031712 Bacteria 22057
236 Ga0307413_10017672 3300031824 Bacteria 3720
237 Ga0307413_10398998 3300031824 Bacteria 1077
238 Ga0307406_10050042 3300031901 Bacteria 2647
239 Ga0307409_100176920 3300031995 Unclassified 1884
240 Ga0373955_0287956 3300035172 Unclassified 989
241 Ga0373937_0003437 3300036401 Bacteria 13293
242 Ga0373937_0035844 3300036401 Bacteria 4517
243 Ga0373937_0202134 3300036401 Bacteria 1868
244 Ga0495629_0039315 3300046459 Bacteria 3330
245 Ga0495653_0209036 3300046463 Bacteria 1319
246 Ga0495580_0052851 3300046472 Bacteria 2868
247 Ga0495582_0078934 3300046473 Bacteria 1827
248 Ga0495639_0103203 3300046475 Unclassified 1348
249 Ga0495594_0046910 3300046499 Bacteria 2373
250 Ga0495608_0027819 3300046511 Bacteria 3845
251 Ga0495667_0000690 3300046559 Bacteria 21599
252 Ga0495657_0002741 3300046675 Bacteria 14701
253 Ga0495613_0102972 3300046689 Unclassified 2061
254 Ga0495636_0115311 3300047318 Unclassified 1185
255 Ga0495674_0136085 3300047319 Bacteria 2067
256 Ga0495672_0090491 3300047320 Bacteria 1681
257 Ga0496101_0347866 3300048904 Bacteria 1165
258 Ga0496104_0000049 3300048907 Bacteria 144754
259 Ga0496104_0342400 3300048907 Bacteria 1408
260 Ga0496112_0076831 3300048915 Bacteria 3303
261 Ga0496126_0000734 3300048929 Bacteria 59483
262 Ga0501032_0008680 3300049569 Bacteria 7402
263 Ga0501033_0003708 3300049570 Bacteria 12428
264 Ga0501034_0015863 3300049571 Bacteria 7735
265 Ga0501034_0487363 3300049571 Unclassified 1147
266 Ga0501036_0011496 3300049572 Bacteria 7329
267 Ga0501036_0012250 3300049572 Bacteria 7104
268 Ga0501036_0072036 3300049572 Bacteria 2921
269 Ga0501037_0003484 3300049573 Bacteria 11419
270 Ga0501037_0017512 3300049573 Bacteria 5273
271 Ga0501037_0023365 3300049573 Bacteria 4572
272 Ga0501037_0163780 3300049573 Bacteria 1584
273 Ga0501038_0009687 3300049574 Bacteria 8836
274 Ga0501038_0038527 3300049574 Bacteria 4186
275 Ga0501038_0083145 3300049574 Bacteria 2695
276 Ga0501039_0040016 3300049575 Bacteria 3619
277 Ga0501039_0061982 3300049575 Bacteria 2897
278 Ga0501039_0083282 3300049575 Bacteria 2491
279 Ga0501039_0136797 3300049575 Bacteria 1924
280 Ga0501039_0462818 3300049575 Unclassified 996
281 Ga0501040_0112562 3300049576 Bacteria 1904
282 Ga0501041_0071733 3300049577 Bacteria 2126
283 Ga0501042_0005683 3300049578 Bacteria 8049
284 Ga0501042_0216680 3300049578 Bacteria 1381
285 Ga0501042_0217789 3300049578 Bacteria 1377
286 Ga0501043_0017110 3300049579 Bacteria 5684
287 Ga0501046_0003380 3300049580 Bacteria 14645
288 Ga0501046_0026192 3300049580 Bacteria 4763
289 Ga0501046_0060083 3300049580 Unclassified 2975
290 Ga0501047_0006594 3300049581 Bacteria 10925
291 Ga0501047_0011298 3300049581 Bacteria 8452
292 Ga0501047_0068592 3300049581 Unclassified 3415
293 Ga0501047_0099001 3300049581 Unclassified 2794
294 Ga0501047_0262478 3300049581 Bacteria 1574
295 Ga0501048_0003292 3300049582 Bacteria 12309
296 Ga0501048_0098446 3300049582 Unclassified 2063
297 Ga0501067_0004747 3300049583 Bacteria 7525
298 Ga0501068_0007584 3300049584 Bacteria 6006
299 Ga0501068_0130304 3300049584 Bacteria 1572
300 Ga0501070_0007898 3300049586 Bacteria 9012
301 Ga0501070_0036855 3300049586 Bacteria 4083
302 Ga0501071_0008287 3300049587 Bacteria 6864
303 Ga0501071_0021586 3300049587 Bacteria 4485
304 Ga0501071_0248306 3300049587 Bacteria 1343
305 Ga0501072_0026082 3300049588 Bacteria 4554
306 Ga0501072_0156007 3300049588 Bacteria 1820
307 Ga0501073_0005783 3300049589 Bacteria 9242
308 Ga0501073_0010525 3300049589 Bacteria 6774
309 Ga0501073_0035272 3300049589 Bacteria 3556
310 Ga0501073_0041791 3300049589 Bacteria 3238
311 Ga0501074_0028689 3300049590 Bacteria 4033
312 Ga0501074_0029437 3300049590 Bacteria 3977
313 Ga0501075_0105817 3300049591 Bacteria 2138
314 Ga0501076_0117619 3300049592 Bacteria 2151
315 Ga0501076_0659853 3300049592 Unclassified 863
316 Ga0501079_0022346 3300049741 Bacteria 4849
317 Ga0501079_0194005 3300049741 Bacteria 1585
318 Ga0501080_0001708 3300049742 Bacteria 18750
319 Ga0501080_0002199 3300049742 Bacteria 16944
320 Ga0501080_0048555 3300049742 Bacteria 3950
321 Ga0501083_0001244 3300049744 Bacteria 17296
322 Ga0501083_0003585 3300049744 Bacteria 10885
323 Ga0501083_0013406 3300049744 Bacteria 5729
324 Ga0501083_0016659 3300049744 Bacteria 5136
325 Ga0501083_0024414 3300049744 Bacteria 4187
326 Ga0501035_0026732 3300049822 Bacteria 5278
327 Ga0501035_0051554 3300049822 Bacteria 3684
328 Ga0501035_0093899 3300049822 Bacteria 2639
329 Ga0501044_0004357 3300049823 Bacteria 15852
330 Ga0501044_0054256 3300049823 Bacteria 4121
331 Ga0501044_0080957 3300049823 Bacteria 3288
332 Ga0501044_0141997 3300049823 Bacteria 2389
333 Ga0501044_0273931 3300049823 Bacteria 1622
334 Ga0501045_0115200 3300049824 Bacteria 1994
335 nmdc:mga00v17_65133_c1 3300050491 Unclassified 2247
336 nmdc:mga0k408_232906_c1 3300050493 Unclassified 1099
337 nmdc:mga05p37_32535_c1 3300050507 Bacteria 6379
338 nmdc:mga0qj67_117921_c1 3300050509 Bacteria 2145
339 nmdc:mga0qj67_122355_c1 3300050509 Unclassified 2105
340 nmdc:mga0qj67_36216_c2 3300050509 Unclassified 2524
341 nmdc:mga06r32_192922_c1 3300050510 Bacteria 2024
342 nmdc:mga06r32_218202_c1 3300050510 Bacteria 1895
343 nmdc:mga06r32_76742_c1 3300050510 Bacteria 3245
344 nmdc:mga08y16_200163_c1 3300050511 Bacteria 2070
345 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
346 nmdc:mga08y16_420791_c1 3300050511 Bacteria 1365
347 nmdc:mga0a205_180319_c1 3300050515 Unclassified 2006
348 Ga0495619_0283335 3300053085 Bacteria 1148
349 Ga0500611_028259 3300053727 Archaea 1137
350 Ga0501084_0164367 3300054114 Bacteria 1873
351 Ga0501084_0380322 3300054114 Bacteria 1193
352 Ga0501082_0007842 3300060353 Bacteria 9212
353 Ga0501082_0032724 3300060353 Bacteria 4485
354 Ga0501082_0050624 3300060353 Unclassified 3581
355 Ga0501082_0423676 3300060353 Bacteria 1162
356 Ga0530510_0599543 3300061734 Bacteria 838
357 2884217917 2884215851 Bacteria 4554841
358 Ga0070663_100015657
359 SwRhRL3b_contig_104527
360 SwRhRL3b_contig_291315
361 SwRhRL3b_contig_963595
362 rootH1_10140506
363 rootL2_10061044
364 rootH1_10332258
365 Ga0065712_10145231
366 Ga0065715_10004673
367 Ga0065715_10191568
368 Ga0065715_10214907
369 Ga0065707_10008443
370 Ga0070658_10183963
371 Ga0070683_100316518
372 Ga0070670_100035851
373 Ga0068869_100091747
374 Ga0068869_100478775
375 Ga0070666_10046209
376 Ga0070666_10201271
377 Ga0070682_100147148
378 Ga0068868_100004685
379 Ga0070660_100191843
380 Ga0070689_100019190
381 Ga0070689_100156890
382 Ga0070661_100001851
383 Ga0070661_100067684
384 Ga0070675_100004159
385 Ga0070675_100004846
386 Ga0070675_100005009
387 Ga0070675_100079317
388 Ga0070675_100082407
389 Ga0070671_100006395
390 Ga0070671_100016421
391 Ga0070671_100051184
392 Ga0070671_100248624
393 Ga0070674_100189290
394 Ga0070674_100194838
395 Ga0070673_100060486
396 Ga0070673_100098246
397 Ga0070673_100236315
398 Ga0070673_100353743
399 Ga0070688_100017028
400 Ga0070667_100004775
401 Ga0070667_100022511
402 Ga0070714_100155183
403 Ga0070714_100560962
404 Ga0070701_10106593
405 Ga0070678_100503831
406 Ga0068867_100470049
407 Ga0070685_10014685
408 Ga0070685_10047350
409 Ga0070685_10202408
410 Ga0070679_100427939
411 Ga0068853_100045377
412 Ga0070672_100017287
413 Ga0070672_100222439
414 Ga0070672_100233884
415 Ga0070686_100012830
416 Ga0070704_100189297
417 Ga0068855_100067538
418 Ga0068855_100308130
419 Ga0070664_100000431
420 Ga0068854_100364041
421 Ga0068856_100211581
422 Ga0068852_100020849
423 Ga0068852_100089257
424 Ga0068859_100000628
425 Ga0068859_100005909
426 Ga0068859_100025701
427 Ga0068859_100068551
428 Ga0068859_100403110
429 Ga0068859_100437105
430 Ga0068861_100115012
431 Ga0068861_100437648
432 Ga0068863_100015370
433 Ga0068863_100138070
434 Ga0068858_100011719
435 Ga0068858_100017626
436 Ga0068858_100044224
437 Ga0068860_100011559
438 Ga0068860_100172366
439 Ga0068862_100045789
440 Ga0068862_100573709
441 Ga0068862_100739590
442 Ga0070717_10218554
443 Ga0075365_10185527
444 Ga0075368_10193650
445 Ga0075367_10117864
446 Ga0075367_10224786
447 Ga0075366_10087403
448 Ga0097621_100019177
449 Ga0097621_100165244
450 Ga0097621_100310517
451 Ga0068871_100030504
452 Ga0068871_100130925
453 Ga0068871_100234743
454 Ga0075428_100000042
455 Ga0075428_100050636
456 Ga0075430_100038624
457 Ga0075430_100147044
458 Ga0075431_100027468
459 Ga0075431_100086108
460 Ga0075431_100113639
461 Ga0075431_100228410
462 Ga0075431_100236063
463 Ga0075433_10048294
464 Ga0075433_10166338
465 Ga0075429_100131563
466 Ga0097620_100000628
467 Ga0097620_100005909
468 Ga0097620_100025701
469 Ga0097620_100068548
470 Ga0097620_100403132
471 Ga0097620_100437119
472 Ga0105240_10012069
473 Ga0105240_10385715
474 Ga0111539_10070034
475 Ga0105247_10094028
476 Ga0114129_10033888
477 Ga0105241_10088414
478 Ga0105241_10101281
479 Ga0105248_10027397
480 Ga0105248_10028440
481 Ga0105237_10126616
482 Ga0105238_10023945
483 Ga0105238_10127974
484 Ga0105238_10313333
485 Ga0105249_10034113
486 Ga0105239_10328298
487 Ga0157371_10257582
488 Ga0157370_10009751
489 Ga0157370_10256417
490 Ga0157369_10012682
491 Ga0157369_10200202
492 Ga0157369_10434309
493 Ga0157369_10499081
494 Ga0157374_10245290
495 Ga0157374_10623051
496 Ga0157378_10119169
497 Ga0163162_10001348
498 Ga0163162_10113837
499 Ga0157372_10008423
500 Ga0157372_10017778
501 Ga0157372_10092623
502 Ga0157375_10012861
503 Ga0157375_10024200
504 Ga0157375_10798682
505 Ga0163163_10005328
506 Ga0163163_10007059
507 Ga0163163_10009957
508 Ga0163163_10124920
509 Ga0157380_10068159
510 Ga0157377_10040202
511 Ga0157377_10124373
512 Ga0157379_10021919
513 Ga0157379_10233118
514 Ga0157376_10021948
515 Ga0163161_10027921
516 Ga0163161_10334659
517 Ga0207426_1027935
518 Ga0207680_10049141
519 Ga0207705_10037201
520 Ga0207695_10000331
521 Ga0207695_10426403
522 Ga0207671_10171738
523 Ga0207662_10269143
524 Ga0207649_10026413
525 Ga0207649_10045499
526 Ga0207694_10017269
527 Ga0207650_10014045
528 Ga0207659_10005472
529 Ga0207659_10017198
530 Ga0207659_10065896
531 Ga0207664_10419167
532 Ga0207644_10001748
533 Ga0207644_10036041
534 Ga0207644_10074661
535 Ga0207690_10005373
536 Ga0207706_10169857
537 Ga0207670_10127542
538 Ga0207670_10139873
539 Ga0207669_10118424
540 Ga0207669_10221765
541 Ga0207691_10009487
542 Ga0207691_10271882
543 Ga0207691_10510983
544 Ga0207711_10015283
545 Ga0207711_10096465
546 Ga0207661_10360495
547 Ga0207679_10012819
548 Ga0207679_10023666
549 Ga0207679_10510891
550 Ga0207667_10008994
551 Ga0207651_10049412
552 Ga0207651_10074611
553 Ga0207712_10078530
554 Ga0207712_10314257
555 Ga0207640_10288511
556 Ga0207658_10015981
557 Ga0207677_10009076
558 Ga0207703_10020679
559 Ga0207703_10093554
560 Ga0207703_10094089
561 Ga0207703_10378956
562 Ga0207639_10021497
563 Ga0207678_10001594
564 Ga0207702_10015944
565 Ga0207702_10227932
566 Ga0207641_10054094
567 Ga0207641_10098010
568 Ga0207641_10160043
569 Ga0207648_10178873
570 Ga0207676_10033324
571 Ga0207676_10067191
572 Ga0207683_10218846
573 Ga0207683_10514960
574 Ga0207698_10495107
575 Ga0207428_10000004
576 Ga0268265_10126786
577 Ga0265318_10007562
578 Ga0265336_10003148
579 Ga0265338_10014579
580 Ga0265338_10092640
581 Ga0265330_10000360
582 Ga0265332_10018523
583 Ga0265328_10004924
584 Ga0265325_10000499
585 Ga0265340_10002015
586 Ga0265339_10000641
587 Ga0265339_10051800
588 Ga0265331_10028994
589 Ga0265316_10001317
590 Ga0265313_10019192
591 Ga0265314_10000063
592 Ga0265342_10001454
593 Ga0307413_10017672
594 Ga0307413_10398998
595 Ga0307406_10050042
596 Ga0307409_100176920
597 Ga0373955_0287956
598 Ga0373937_0003437
599 Ga0373937_0035844
600 Ga0373937_0202134
601 Ga0495629_0039315
602 Ga0495653_0209036
603 Ga0495580_0052851
604 Ga0495582_0078934
605 Ga0495639_0103203
606 Ga0495594_0046910
607 Ga0495608_0027819
608 Ga0495667_0000690
609 Ga0495657_0002741
610 Ga0495613_0102972
611 Ga0495636_0115311
612 Ga0495674_0136085
613 Ga0495672_0090491
614 Ga0496101_0347866
615 Ga0496104_0000049
616 Ga0496104_0342400
617 Ga0496112_0076831
618 Ga0496126_0000734
619 Ga0501032_0008680
620 Ga0501033_0003708
621 Ga0501034_0015863
622 Ga0501034_0487363
623 Ga0501036_0011496
624 Ga0501036_0012250
625 Ga0501036_0072036
626 Ga0501037_0003484
627 Ga0501037_0017512
628 Ga0501037_0023365
629 Ga0501037_0163780
630 Ga0501038_0009687
631 Ga0501038_0038527
632 Ga0501038_0083145
633 Ga0501039_0040016
634 Ga0501039_0061982
635 Ga0501039_0083282
636 Ga0501039_0136797
637 Ga0501039_0462818
638 Ga0501040_0112562
639 Ga0501041_0071733
640 Ga0501042_0005683
641 Ga0501042_0216680
642 Ga0501042_0217789
643 Ga0501043_0017110
644 Ga0501046_0003380
645 Ga0501046_0026192
646 Ga0501046_0060083
647 Ga0501047_0006594
648 Ga0501047_0011298
649 Ga0501047_0068592
650 Ga0501047_0099001
651 Ga0501047_0262478
652 Ga0501048_0003292
653 Ga0501048_0098446
654 Ga0501067_0004747
655 Ga0501068_0007584
656 Ga0501068_0130304
657 Ga0501070_0007898
658 Ga0501070_0036855
659 Ga0501071_0008287
660 Ga0501071_0021586
661 Ga0501071_0248306
662 Ga0501072_0026082
663 Ga0501072_0156007
664 Ga0501073_0005783
665 Ga0501073_0010525
666 Ga0501073_0035272
667 Ga0501073_0041791
668 Ga0501074_0028689
669 Ga0501074_0029437
670 Ga0501075_0105817
671 Ga0501076_0117619
672 Ga0501076_0659853
673 Ga0501079_0022346
674 Ga0501079_0194005
675 Ga0501080_0001708
676 Ga0501080_0002199
677 Ga0501080_0048555
678 Ga0501083_0001244
679 Ga0501083_0003585
680 Ga0501083_0013406
681 Ga0501083_0016659
682 Ga0501083_0024414
683 Ga0501035_0026732
684 Ga0501035_0051554
685 Ga0501035_0093899
686 Ga0501044_0004357
687 Ga0501044_0054256
688 Ga0501044_0080957
689 Ga0501044_0141997
690 Ga0501044_0273931
691 Ga0501045_0115200
692 nmdc:mga00v17_65133_c1
693 nmdc:mga0k408_232906_c1
694 nmdc:mga05p37_32535_c1
695 nmdc:mga0qj67_117921_c1
696 nmdc:mga0qj67_122355_c1
697 nmdc:mga0qj67_36216_c2
698 nmdc:mga06r32_192922_c1
699 nmdc:mga06r32_218202_c1
700 nmdc:mga06r32_76742_c1
701 nmdc:mga08y16_200163_c1
702 nmdc:mga08y16_2_c1
703 nmdc:mga08y16_420791_c1
704 nmdc:mga0a205_180319_c1
705 Ga0495619_0283335
706 Ga0500611_028259
707 Ga0501084_0164367
708 Ga0501084_0380322
709 Ga0501082_0007842
710 Ga0501082_0032724
711 Ga0501082_0050624
712 Ga0501082_0423676
713 Ga0530510_0599543
714 2884217917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01784

DUF34_NIF3

Duf34/NIF3 (NGG1p interacting factor 3)

37

264

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nmo-assembly1.cif.gz_A structural genomics, protein ybgi, unknown function 0.7696 1 259
1nmo-assembly1.cif.gz_A structural genomics, protein ybgi, unknown function 0.7669 1 259
3lnl-assembly1.cif.gz_B crystal structure of staphylococcus aureus protein sa1388 0.7554 1 261
2nyd-assembly1.cif.gz_A-3 crystal structure of staphylococcus aureus hypothetical protein sa1388 0.7511 1 253
3lnl-assembly1.cif.gz_B crystal structure of staphylococcus aureus protein sa1388 0.7476 1 261
ID Description Score Start End Superfamily
af_Q2FY14_1_121_3.40.1390.30 Alpha Beta;3-Layer(aba) Sandwich;Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1;NIF3 (NGG1p interacting factor 3)-like 0.7923 1 125 3.40.1390.30
af_Q2FY14_1_121_3.40.1390.30 Alpha Beta;3-Layer(aba) Sandwich;Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1;NIF3 (NGG1p interacting factor 3)-like 0.7809 1 125 3.40.1390.30
af_P9WFM1_1_122_3.40.1390.30 Alpha Beta;3-Layer(aba) Sandwich;Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1;NIF3 (NGG1p interacting factor 3)-like 0.7548 1 124 3.40.1390.30
2yybB01 Alpha Beta;3-Layer(aba) Sandwich;Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1;NIF3 (NGG1p interacting factor 3)-like 0.7403 1 101 3.40.1390.30
2hvvA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.74 40 102 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A1E3Y2W2-F1-model_v4 NGG1p interacting factor NIF3 0.9613 1 263
AF-A0A352MG31-F1-model_v4 NGG1p interacting factor NIF3 0.9298 1 111
AF-A0A2E9G0S7-F1-model_v4 deleted 0.9258 2 263
AF-A0A0E4A261-F1-model_v4 NGG1p interacting factor 3 protein, NIF3 0.9255 1 262 GO:0005737
AF-A0A327WX76-F1-model_v4 Putative NIF3 family GTP cyclohydrolase 1 type 2 0.9248 2 262 GO:0005737
GO:0016787

Map