F420744

General Info

Members Datasets Scaffolds Average Seq Length
357 207 357 129

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10275741|Ga0070709_102757413
Length 128
Sequence MNRTKKIAVAAVLLAAAVAGAQAPGIKRTVLQKADVTPEREVVMAQAEISAGGETGRHTHPGVEVGYVLEGSTTVTVDGEEPRVYKAGDSYTIPYGKVHNAKNVSDKPAKVLANYIVEKGKPLASPAP

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
131 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
132 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
135 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
136 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
137 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
138 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
201 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
202 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
203 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
204 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
205 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
206 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
207 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.08
Nodule 0
Rhizoplane 0.56
Rhizosphere 95.8
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10011638 3300005295 Bacteria 2641
2 Ga0070690_100001786 3300005330 Bacteria 11379
3 Ga0068869_100000861 3300005334 Bacteria 17438
4 Ga0070666_10634774 3300005335 Bacteria 781
5 Ga0070680_100000425 3300005336 Bacteria 28804
6 Ga0070680_100065990 3300005336 Bacteria 2967
7 Ga0070682_100005149 3300005337 Bacteria 7268
8 Ga0068868_100008269 3300005338 Bacteria 7450
9 Ga0070689_100082452 3300005340 Bacteria 2526
10 Ga0070689_100440022 3300005340 Bacteria 1108
11 Ga0070691_10000474 3300005341 Bacteria 15007
12 Ga0070687_100000066 3300005343 Bacteria 34385
13 Ga0070692_10002172 3300005345 Bacteria 7513
14 Ga0070692_10188718 3300005345 Bacteria 1199
15 Ga0070675_100100079 3300005354 Bacteria 2441
16 Ga0070673_100056928 3300005364 Bacteria 3087
17 Ga0070688_100125321 3300005365 Unclassified 1726
18 Ga0070667_100253447 3300005367 Bacteria 1574
19 Ga0070709_10275741 3300005434 Bacteria 1220
20 Ga0070714_100220816 3300005435 Bacteria 1741
21 Ga0070713_100005108 3300005436 Bacteria 8929
22 Ga0070710_10077969 3300005437 Bacteria 1927
23 Ga0070701_10000851 3300005438 Bacteria 10957
24 Ga0070701_10219897 3300005438 Bacteria 1132
25 Ga0070711_100021407 3300005439 Bacteria 4181
26 Ga0070711_100583359 3300005439 Bacteria 931
27 Ga0070705_100000090 3300005440 Bacteria 50516
28 Ga0070705_100257310 3300005440 Bacteria 1229
29 Ga0070700_100000660 3300005441 Bacteria 17043
30 Ga0070700_100642492 3300005441 Unclassified 837
31 Ga0070694_100000122 3300005444 Bacteria 38260
32 Ga0070694_100079925 3300005444 Bacteria 2271
33 Ga0070694_100155110 3300005444 Bacteria 1676
34 Ga0070694_100340943 3300005444 Bacteria 1158
35 Ga0070694_101093409 3300005444 Unclassified 665
36 Ga0070708_100334788 3300005445 Unclassified 1426
37 Ga0070708_100402417 3300005445 Bacteria 1291
38 Ga0070678_100638324 3300005456 Bacteria 954
39 Ga0070662_100953923 3300005457 Bacteria 733
40 Ga0070681_10016633 3300005458 Bacteria 7343
41 Ga0070681_10069449 3300005458 Bacteria 3489
42 Ga0070681_10567981 3300005458 Unclassified 1048
43 Ga0068867_100001835 3300005459 Bacteria 14810
44 Ga0070706_100071071 3300005467 Bacteria 3219
45 Ga0070698_100770016 3300005471 Bacteria 906
46 Ga0070699_100118727 3300005518 Bacteria 2325
47 Ga0070699_100598729 3300005518 Bacteria 1005
48 Ga0070699_101828914 3300005518 Unclassified 556
49 Ga0070679_100042423 3300005530 Bacteria 4530
50 Ga0070679_100055747 3300005530 Bacteria 3937
51 Ga0070679_100058839 3300005530 Bacteria 3830
52 Ga0070697_100023594 3300005536 Bacteria 4892
53 Ga0070697_100060806 3300005536 Bacteria 3080
54 Ga0070697_100199617 3300005536 Bacteria 1700
55 Ga0068853_100033613 3300005539 Bacteria 4352
56 Ga0068853_102071672 3300005539 Bacteria 552
57 Ga0070686_100000292 3300005544 Bacteria 33649
58 Ga0070686_100479025 3300005544 Bacteria 962
59 Ga0070695_100000095 3300005545 Bacteria 37826
60 Ga0070695_100180028 3300005545 Bacteria 1497
61 Ga0070695_100420051 3300005545 Bacteria 1018
62 Ga0070696_100000133 3300005546 Bacteria 40142
63 Ga0070696_100001385 3300005546 Bacteria 15850
64 Ga0070696_100870278 3300005546 Bacteria 746
65 Ga0070693_100000075 3300005547 Bacteria 41068
66 Ga0070704_100000230 3300005549 Bacteria 23696
67 Ga0070704_100091399 3300005549 Bacteria 2270
68 Ga0070704_100174533 3300005549 Bacteria 1713
69 Ga0070704_101100158 3300005549 Unclassified 722
70 Ga0068855_100001022 3300005563 Bacteria 34876
71 Ga0068855_100027573 3300005563 Bacteria 6794
72 Ga0068854_100006861 3300005578 Bacteria 7261
73 Ga0068854_102109886 3300005578 Bacteria 520
74 Ga0068856_100079297 3300005614 Bacteria 3256
75 Ga0068856_100135113 3300005614 Bacteria 2472
76 Ga0070702_100000043 3300005615 Bacteria 34094
77 Ga0070702_100299845 3300005615 Unclassified 1111
78 Ga0068852_100201177 3300005616 Bacteria 1885
79 Ga0068859_100014434 3300005617 Bacteria 7927
80 Ga0068859_100670378 3300005617 Bacteria 1129
81 Ga0068864_100241963 3300005618 Bacteria 1672
82 Ga0068866_10000104 3300005718 Bacteria 36131
83 Ga0068861_100000193 3300005719 Bacteria 32735
84 Ga0068861_100564992 3300005719 Bacteria 1039
85 Ga0068870_10101631 3300005840 Bacteria 1626
86 Ga0068863_102017568 3300005841 Bacteria 587
87 Ga0068858_100001082 3300005842 Bacteria 28191
88 Ga0068860_100002195 3300005843 Bacteria 20532
89 Ga0068860_100457912 3300005843 Bacteria 1269
90 Ga0068862_100002970 3300005844 Bacteria 14809
91 Ga0075365_10235404 3300006038 Bacteria 1286
92 Ga0070715_10686400 3300006163 Bacteria 610
93 Ga0070716_100502958 3300006173 Unclassified 894
94 Ga0070716_100649296 3300006173 Unclassified 800
95 Ga0070712_100227292 3300006175 Bacteria 1480
96 Ga0097621_100000248 3300006237 Bacteria 36293
97 Ga0097621_101440917 3300006237 Bacteria 653
98 Ga0068871_100000205 3300006358 Bacteria 40986
99 Ga0068871_100027053 3300006358 Bacteria 4482
100 Ga0075428_100000254 3300006844 Bacteria 52519
101 Ga0075430_100071333 3300006846 Bacteria 2914
102 Ga0075433_10002965 3300006852 Bacteria 13031
103 Ga0075434_100000078 3300006871 Bacteria 52232
104 Ga0075434_100004556 3300006871 Bacteria 12516
105 Ga0075434_100009066 3300006871 Bacteria 9267
106 Ga0075434_100855090 3300006871 Unclassified 925
107 Ga0075434_101078790 3300006871 Unclassified 816
108 Ga0075434_101350193 3300006871 Bacteria 723
109 Ga0075434_101937873 3300006871 Bacteria 595
110 Ga0075429_100012782 3300006880 Bacteria 7281
111 Ga0075429_100241871 3300006880 Bacteria 1581
112 Ga0075429_101411968 3300006880 Unclassified 606
113 Ga0068865_100000346 3300006881 Bacteria 25628
114 Ga0075436_100000360 3300006914 Bacteria 29065
115 Ga0075436_100012897 3300006914 Bacteria 5731
116 Ga0075436_100103779 3300006914 Bacteria 1981
117 Ga0075436_100124593 3300006914 Bacteria 1805
118 Ga0075436_100191306 3300006914 Bacteria 1448
119 Ga0075436_100318584 3300006914 Bacteria 1117
120 Ga0075436_100430576 3300006914 Bacteria 959
121 Ga0075436_100786140 3300006914 Bacteria 708
122 Ga0075436_100973454 3300006914 Bacteria 636
123 Ga0097620_100014436 3300006931 Bacteria 7927
124 Ga0097620_100670340 3300006931 Bacteria 1129
125 Ga0075435_100000045 3300007076 Bacteria 62303
126 Ga0075435_100001714 3300007076 Bacteria 14245
127 Ga0075435_100049469 3300007076 Bacteria 3381
128 Ga0075435_100052518 3300007076 Bacteria 3285
129 Ga0075435_100235304 3300007076 Bacteria 1557
130 Ga0075435_100254931 3300007076 Bacteria 1494
131 Ga0075435_101225520 3300007076 Bacteria 657
132 Ga0099794_10003056 3300007265 Bacteria 6319
133 Ga0099794_10023308 3300007265 Bacteria 2830
134 Ga0111539_10014798 3300009094 Bacteria 9730
135 Ga0111539_10406016 3300009094 Unclassified 1587
136 Ga0105245_10000478 3300009098 Bacteria 36680
137 Ga0105245_10235431 3300009098 Bacteria 1773
138 Ga0114129_10000030 3300009147 Bacteria 111905
139 Ga0114129_10762454 3300009147 Bacteria 1238
140 Ga0114129_12028793 3300009147 Bacteria 695
141 Ga0105243_10000413 3300009148 Bacteria 44895
142 Ga0105241_10117336 3300009174 Bacteria 2139
143 Ga0105241_10245775 3300009174 Bacteria 1515
144 Ga0105242_10000394 3300009176 Bacteria 34588
145 Ga0105242_12081735 3300009176 Bacteria 611
146 Ga0105248_10254286 3300009177 Bacteria 1977
147 Ga0105248_12161079 3300009177 Unclassified 633
148 Ga0105249_10002974 3300009553 Bacteria 14613
149 Ga0105249_10580516 3300009553 Bacteria 1174
150 Ga0105239_10189653 3300010375 Bacteria 2301
151 Ga0105246_10048792 3300011119 Bacteria 2896
152 Ga0157371_10837445 3300013102 Unclassified 695
153 Ga0157378_10000543 3300013297 Bacteria 35895
154 Ga0157380_10040069 3300014326 Bacteria 3646
155 Ga0157376_10002891 3300014969 Bacteria 11772
156 Ga0157376_10006351 3300014969 Bacteria 8349
157 Ga0207642_10001996 3300025899 Bacteria 6293
158 Ga0207680_10273048 3300025903 Bacteria 1173
159 Ga0207685_10111570 3300025905 Bacteria 1186
160 Ga0207699_10421090 3300025906 Bacteria 954
161 Ga0207684_10128619 3300025910 Bacteria 2174
162 Ga0207654_10211400 3300025911 Unclassified 1282
163 Ga0207707_10012226 3300025912 Bacteria 7463
164 Ga0207707_10117972 3300025912 Bacteria 2320
165 Ga0207693_10299739 3300025915 Bacteria 1259
166 Ga0207663_10026245 3300025916 Bacteria 3379
167 Ga0207663_10460880 3300025916 Bacteria 982
168 Ga0207660_10003559 3300025917 Bacteria 10145
169 Ga0207660_10179817 3300025917 Bacteria 1642
170 Ga0207662_10000113 3300025918 Bacteria 38841
171 Ga0207662_11153138 3300025918 Unclassified 551
172 Ga0207652_10018948 3300025921 Bacteria 5651
173 Ga0207652_10100044 3300025921 Bacteria 2559
174 Ga0207652_10338162 3300025921 Bacteria 1359
175 Ga0207681_10217832 3300025923 Bacteria 1475
176 Ga0207659_10022295 3300025926 Bacteria 4215
177 Ga0207687_10000273 3300025927 Bacteria 35393
178 Ga0207687_10514232 3300025927 Bacteria 1001
179 Ga0207700_10024743 3300025928 Bacteria 4160
180 Ga0207700_11264247 3300025928 Unclassified 658
181 Ga0207664_10131637 3300025929 Bacteria 2106
182 Ga0207686_10000675 3300025934 Bacteria 21125
183 Ga0207709_10037231 3300025935 Bacteria 2890
184 Ga0207709_11150476 3300025935 Bacteria 638
185 Ga0207670_10002137 3300025936 Bacteria 10337
186 Ga0207670_10017972 3300025936 Bacteria 4285
187 Ga0207670_10090848 3300025936 Bacteria 2158
188 Ga0207704_10000665 3300025938 Bacteria 15224
189 Ga0207665_10059580 3300025939 Bacteria 2584
190 Ga0207665_10345178 3300025939 Bacteria 1123
191 Ga0207711_10200355 3300025941 Bacteria 1821
192 Ga0207689_10000554 3300025942 Bacteria 35670
193 Ga0207661_10036106 3300025944 Bacteria 3856
194 Ga0207667_10005883 3300025949 Bacteria 14937
195 Ga0207667_10042036 3300025949 Bacteria 4861
196 Ga0207667_10911930 3300025949 Bacteria 870
197 Ga0207651_10381795 3300025960 Unclassified 1194
198 Ga0207651_11592772 3300025960 Bacteria 588
199 Ga0207712_10009340 3300025961 Bacteria 6204
200 Ga0207712_10936751 3300025961 Unclassified 767
201 Ga0207640_10001066 3300025981 Bacteria 15195
202 Ga0207640_11927105 3300025981 Bacteria 535
203 Ga0207677_10000391 3300026023 Bacteria 30176
204 Ga0207703_10004713 3300026035 Bacteria 11130
205 Ga0207639_10040627 3300026041 Bacteria 3473
206 Ga0207708_10000505 3300026075 Bacteria 30021
207 Ga0207708_10193514 3300026075 Bacteria 1620
208 Ga0207708_10272829 3300026075 Bacteria 1368
209 Ga0207702_10012237 3300026078 Bacteria 7139
210 Ga0207648_10000548 3300026089 Bacteria 42037
211 Ga0207676_10123268 3300026095 Bacteria 2189
212 Ga0207674_10658401 3300026116 Bacteria 1011
213 Ga0207675_100000305 3300026118 Bacteria 47105
214 Ga0207675_101804558 3300026118 Unclassified 631
215 Ga0207698_10293581 3300026142 Bacteria 1510
216 Ga0209588_1062839 3300027671 Bacteria 1200
217 Ga0207428_10003517 3300027907 Bacteria 15166
218 Ga0207428_10085593 3300027907 Bacteria 2454
219 Ga0268265_10001208 3300028380 Bacteria 22438
220 Ga0268264_10000882 3300028381 Bacteria 31650
221 Ga0268264_10896072 3300028381 Bacteria 890
222 Ga0268264_10983528 3300028381 Bacteria 850
223 Ga0307511_10000001 3300030521 Bacteria 206079
224 Ga0307509_10565566 3300031507 Bacteria 813
225 Ga0373930_0049854 3300034816 Bacteria 912
226 Ga0373948_0172499 3300034817 Unclassified 551
227 Ga0373958_0086395 3300034819 Bacteria 717
228 Ga0373926_0043420 3300035083 Unclassified 1608
229 Ga0373928_0136514 3300035084 Bacteria 669
230 Ga0373940_0311353 3300035088 Bacteria 544
231 Ga0373944_0002610 3300035089 Bacteria 4591
232 Ga0373949_0015361 3300035090 Bacteria 1710
233 Ga0373951_0043216 3300035091 Bacteria 1092
234 Ga0373936_0052725 3300035113 Bacteria 1648
235 Ga0373939_0004132 3300035114 Bacteria 3421
236 Ga0373939_0084228 3300035114 Bacteria 1062
237 Ga0373939_0515389 3300035114 Unclassified 512
238 Ga0373953_0078181 3300035117 Bacteria 1372
239 Ga0373960_0056978 3300035121 Bacteria 1175
240 Ga0373946_0010410 3300035171 Bacteria 3442
241 Ga0373955_0142049 3300035172 Bacteria 1408
242 Ga0373955_0580934 3300035172 Bacteria 686
243 Ga0373942_0339004 3300035207 Bacteria 529
244 Ga0373924_0022910 3300035410 Bacteria 2444
245 Ga0373931_0003691 3300035691 Bacteria 6929
246 Ga0373931_0009081 3300035691 Bacteria 4742
247 Ga0373931_0050129 3300035691 Bacteria 2220
248 Ga0373935_0017353 3300035692 Bacteria 4365
249 Ga0373935_0033378 3300035692 Bacteria 3202
250 Ga0373935_0068885 3300035692 Bacteria 2277
251 Ga0373935_0268155 3300035692 Bacteria 1199
252 Ga0373927_0066282 3300035695 Unclassified 2335
253 Ga0373927_0189331 3300035695 Bacteria 1350
254 Ga0373933_0001521 3300035724 Bacteria 13543
255 Ga0373947_0008150 3300035725 Bacteria 6041
256 Ga0373947_0092165 3300035725 Bacteria 1891
257 Ga0373947_0339065 3300035725 Bacteria 1007
258 Ga0373937_0147213 3300036401 Bacteria 2205
259 Ga0373925_0013530 3300037068 Bacteria 5907
260 Ga0373925_0111557 3300037068 Bacteria 2113
261 Ga0373925_0299350 3300037068 Bacteria 1298
262 Ga0373925_0688047 3300037068 Bacteria 843
263 Ga0451798_0905266 3300041458 Bacteria 851
264 Ga0451577_0031216 3300042876 Bacteria 4809
265 Ga0451577_0912133 3300042876 Bacteria 791
266 Ga0453684_0966110 3300044712 Unclassified 908
267 Ga0451576_0006627 3300045051 Bacteria 14151
268 Ga0451576_0054200 3300045051 Bacteria 4199
269 Ga0451576_0177541 3300045051 Bacteria 2224
270 Ga0451576_0179408 3300045051 Bacteria 2211
271 Ga0451576_0677435 3300045051 Bacteria 1083
272 Ga0451576_1856697 3300045051 Bacteria 622
273 Ga0466967_0665825 3300045976 Bacteria 1030
274 Ga0495629_0342249 3300046459 Bacteria 1021
275 Ga0495653_0871345 3300046463 Bacteria 538
276 Ga0495580_0001664 3300046472 Bacteria 19521
277 Ga0495639_0112119 3300046475 Unclassified 1295
278 Ga0495639_0380490 3300046475 Bacteria 711
279 Ga0495662_0004510 3300046476 Bacteria 6984
280 Ga0495628_0089554 3300046516 Bacteria 2383
281 Ga0495628_0166619 3300046516 Bacteria 1672
282 Ga0495628_0343574 3300046516 Bacteria 1098
283 Ga0495630_0022094 3300046517 Bacteria 4701
284 Ga0495630_0182500 3300046517 Unclassified 1600
285 Ga0495630_0199182 3300046517 Bacteria 1528
286 Ga0495644_0413390 3300046523 Bacteria 535
287 Ga0495666_0007108 3300046526 Bacteria 5626
288 Ga0495652_0434672 3300046529 Bacteria 922
289 Ga0495652_0567309 3300046529 Bacteria 778
290 Ga0495665_0132868 3300046531 Bacteria 1303
291 Ga0495640_0025452 3300046533 Bacteria 4293
292 Ga0495586_0024165 3300046535 Bacteria 3246
293 Ga0495586_0029696 3300046535 Bacteria 2926
294 Ga0495621_0028454 3300046539 Bacteria 1900
295 Ga0495621_0072428 3300046539 Bacteria 1272
296 Ga0495656_0408234 3300046615 Bacteria 711
297 Ga0495634_0073799 3300046642 Bacteria 2243
298 Ga0495635_0353982 3300046663 Bacteria 979
299 Ga0495659_0013093 3300046664 Bacteria 2699
300 Ga0495659_0205487 3300046664 Unclassified 809
301 Ga0495659_0464822 3300046664 Bacteria 552
302 Ga0495588_0349471 3300046674 Unclassified 777
303 Ga0495623_0343913 3300046679 Bacteria 814
304 Ga0495647_0001515 3300046681 Bacteria 7175
305 Ga0495658_0001344 3300046683 Bacteria 12890
306 Ga0495669_0033292 3300046684 Bacteria 2268
307 Ga0495624_0051449 3300046690 Bacteria 2606
308 Ga0495600_0460691 3300046809 Unclassified 785
309 Ga0495604_0044141 3300047317 Bacteria 3486
310 Ga0495636_0087092 3300047318 Bacteria 1351
311 Ga0495674_0393979 3300047319 Bacteria 1119
312 Ga0495674_0689774 3300047319 Bacteria 802
313 Ga0495676_0158476 3300047321 Unclassified 1603
314 Ga0495680_0141215 3300047322 Bacteria 1762
315 Ga0495680_0623934 3300047322 Bacteria 719
316 Ga0496106_0360924 3300048909 Bacteria 1167
317 Ga0501068_0117371 3300049584 Bacteria 1657
318 nmdc:mga0yw44_173050_c1 3300050492 Bacteria 1418
319 nmdc:mga05p37_329_c2 3300050507 Bacteria 49812
320 nmdc:mga09592_13651_c1 3300050508 Bacteria 6638
321 nmdc:mga09592_607305_c1 3300050508 Bacteria 937
322 nmdc:mga0qj67_265820_c1 3300050509 Bacteria 1391
323 nmdc:mga0qj67_266923_c1 3300050509 Unclassified 1388
324 nmdc:mga08y16_137197_c1 3300050511 Bacteria 2543
325 nmdc:mga08y16_35714_c1 3300050511 Bacteria 5220
326 nmdc:mga08y16_6015_c1 3300050511 Bacteria 12717
327 nmdc:mga0n895_1680667_c1 3300050512 Bacteria 598
328 nmdc:mga0n895_1741_c1 3300050512 Bacteria 16462
329 nmdc:mga0n895_18812_c1 3300050512 Bacteria 6402
330 nmdc:mga0n895_324358_c1 3300050512 Bacteria 1561
331 nmdc:mga0n895_331578_c1 3300050512 Bacteria 1542
332 nmdc:mga0n895_394331_c1 3300050512 Bacteria 1400
333 nmdc:mga0n895_465228_c1 3300050512 Bacteria 1276
334 nmdc:mga0rr50_100059_c1 3300050513 Bacteria 2276
335 nmdc:mga0rr50_143704_c1 3300050513 Bacteria 1922
336 nmdc:mga0rr50_193345_c1 3300050513 Bacteria 1669
337 nmdc:mga0rr50_47873_c1 3300050513 Bacteria 3157
338 nmdc:mga0rr50_623353_c1 3300050513 Bacteria 920
339 nmdc:mga08x19_154586_c1 3300050514 Bacteria 1555
340 nmdc:mga08x19_167054_c1 3300050514 Bacteria 1497
341 nmdc:mga08x19_17549_c1 3300050514 Bacteria 4381
342 nmdc:mga08x19_197117_c1 3300050514 Bacteria 1379
343 nmdc:mga08x19_260488_c1 3300050514 Unclassified 1199
344 nmdc:mga08x19_278047_c1 3300050514 Bacteria 1160
345 nmdc:mga08x19_309014_c1 3300050514 Bacteria 1099
346 nmdc:mga08x19_5848_c1 3300050514 Bacteria 7279
347 nmdc:mga0a205_1339_c1 3300050515 Bacteria 20781
348 nmdc:mga0a205_412094_c1 3300050515 Bacteria 1214
349 Ga0500644_0202477 3300053088 Bacteria 821
350 Ga0500646_0003615 3300053090 Bacteria 3962
351 Ga0500583_0009319 3300053092 Bacteria 3581
352 Ga0500583_0173876 3300053092 Bacteria 1072
353 Ga0500655_000524 3300053133 Bacteria 7724
354 Ga0500577_0229985 3300053142 Bacteria 804
355 Ga0500604_0003693 3300053151 Bacteria 4101
356 Ga0500645_054209 3300053730 Bacteria 1167
357 Ga0500656_030887 3300053732 Bacteria 712

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10069449 Ga0070681_100694495 115
2 3300005530 Ga0070679_100055747 Ga0070679_1000557472 115
3 3300009174 Ga0105241_10117336 Ga0105241_101173362 115
4 3300025912 Ga0207707_10117972 Ga0207707_101179723 115
5 3300025921 Ga0207652_10338162 Ga0207652_103381622 115
6 3300006871 Ga0075434_101350193 Ga0075434_1013501932 116
7 3300037068 Ga0373925_0688047 Ga0373925_0688047_403_792 116
8 3300005563 Ga0068855_100027573 Ga0068855_1000275737 120
9 3300013102 Ga0157371_10837445 Ga0157371_108374451 120
10 3300025949 Ga0207667_10042036 Ga0207667_100420366 120
11 3300005444 Ga0070694_100155110 Ga0070694_1001551104 122
12 3300005445 Ga0070708_100334788 Ga0070708_1003347883 122
13 3300005458 Ga0070681_10567981 Ga0070681_105679813 122
14 3300005467 Ga0070706_100071071 Ga0070706_1000710715 122
15 3300005518 Ga0070699_101828914 Ga0070699_1018289141 122
16 3300005536 Ga0070697_100199617 Ga0070697_1001996174 122
17 3300005546 Ga0070696_100001385 Ga0070696_10000138516 122
18 3300005549 Ga0070704_100091399 Ga0070704_1000913993 122
19 3300006871 Ga0075434_100855090 Ga0075434_1008550902 122
20 3300006914 Ga0075436_100124593 Ga0075436_1001245934 122
21 3300007076 Ga0075435_100049469 Ga0075435_1000494693 122
22 3300007076 Ga0075435_100235304 Ga0075435_1002353044 122
23 3300007076 Ga0075435_100254931 Ga0075435_1002549314 122
24 3300009147 Ga0114129_10762454 Ga0114129_107624543 122
25 3300025910 Ga0207684_10128619 Ga0207684_101286194 122
26 3300035725 Ga0373947_0339065 Ga0373947_0339065_403_783 122
27 3300045976 Ga0466967_0665825 Ga0466967_0665825_338_727 122
28 3300046539 Ga0495621_0028454 Ga0495621_0028454_969_1358 122
29 3300050513 nmdc:mga0rr50_47873_c1 nmdc:mga0rr50_47873_c1_45_425 122
30 3300050514 nmdc:mga08x19_154586_c1 nmdc:mga08x19_154586_c1_400_783 122
31 3300050514 nmdc:mga08x19_278047_c1 nmdc:mga08x19_278047_c1_374_754 122
32 3300005434 Ga0070709_10275741 Ga0070709_102757413 123
33 3300005436 Ga0070713_100005108 Ga0070713_1000051087 123
34 3300005439 Ga0070711_100021407 Ga0070711_1000214074 123
35 3300005440 Ga0070705_100257310 Ga0070705_1002573102 123
36 3300005444 Ga0070694_100079925 Ga0070694_1000799251 123
37 3300005444 Ga0070694_100340943 Ga0070694_1003409434 123
38 3300005545 Ga0070695_100180028 Ga0070695_1001800282 123
39 3300005546 Ga0070696_100870278 Ga0070696_1008702782 123
40 3300005549 Ga0070704_101100158 Ga0070704_1011001581 123
41 3300006173 Ga0070716_100649296 Ga0070716_1006492962 123
42 3300006175 Ga0070712_100227292 Ga0070712_1002272922 123
43 3300006871 Ga0075434_101078790 Ga0075434_1010787902 123
44 3300006914 Ga0075436_100191306 Ga0075436_1001913062 123
45 3300007076 Ga0075435_100052518 Ga0075435_1000525184 123
46 3300025906 Ga0207699_10421090 Ga0207699_104210902 123
47 3300025915 Ga0207693_10299739 Ga0207693_102997392 123
48 3300025916 Ga0207663_10026245 Ga0207663_100262454 123
49 3300025918 Ga0207662_11153138 Ga0207662_111531382 123
50 3300025928 Ga0207700_10024743 Ga0207700_100247434 123
51 3300025939 Ga0207665_10345178 Ga0207665_103451782 123
52 3300026075 Ga0207708_10193514 Ga0207708_101935143 123
53 3300035088 Ga0373940_0311353 Ga0373940_0311353_60_449 123
54 3300035207 Ga0373942_0339004 Ga0373942_0339004_40_429 123
55 3300045051 Ga0451576_0179408 Ga0451576_0179408_424_813 123
56 3300046539 Ga0495621_0072428 Ga0495621_0072428_425_814 123
57 3300046664 Ga0495659_0205487 Ga0495659_0205487_140_529 123
58 3300046684 Ga0495669_0033292 Ga0495669_0033292_1818_2207 123
59 3300050512 nmdc:mga0n895_331578_c1 nmdc:mga0n895_331578_c1_194_577 123
60 3300050513 nmdc:mga0rr50_193345_c1 nmdc:mga0rr50_193345_c1_363_746 123
61 3300050514 nmdc:mga08x19_260488_c1 nmdc:mga08x19_260488_c1_157_540 123
62 3300005365 Ga0070688_100125321 Ga0070688_1001253214 124
63 3300005444 Ga0070694_101093409 Ga0070694_1010934091 124
64 3300005549 Ga0070704_100174533 Ga0070704_1001745333 124
65 3300005719 Ga0068861_100564992 Ga0068861_1005649921 124
66 3300006880 Ga0075429_101411968 Ga0075429_1014119682 124
67 3300009177 Ga0105248_12161079 Ga0105248_121610791 124
68 3300009553 Ga0105249_10580516 Ga0105249_105805162 124
69 3300025923 Ga0207681_10217832 Ga0207681_102178322 124
70 3300025961 Ga0207712_10936751 Ga0207712_109367511 124
71 3300026118 Ga0207675_101804558 Ga0207675_1018045581 124
72 3300028381 Ga0268264_10983528 Ga0268264_109835281 124
73 3300005336 Ga0070680_100065990 Ga0070680_1000659903 125
74 3300005340 Ga0070689_100440022 Ga0070689_1004400222 125
75 3300005435 Ga0070714_100220816 Ga0070714_1002208163 125
76 3300005458 Ga0070681_10016633 Ga0070681_1001663310 125
77 3300005530 Ga0070679_100058839 Ga0070679_1000588391 125
78 3300005544 Ga0070686_100479025 Ga0070686_1004790251 125
79 3300005578 Ga0068854_102109886 Ga0068854_1021098862 125
80 3300005615 Ga0070702_100299845 Ga0070702_1002998451 125
81 3300005617 Ga0068859_100670378 Ga0068859_1006703782 125
82 3300006173 Ga0070716_100502958 Ga0070716_1005029582 125
83 3300006871 Ga0075434_100009066 Ga0075434_1000090667 125
84 3300006871 Ga0075434_101937873 Ga0075434_1019378732 125
85 3300006880 Ga0075429_100241871 Ga0075429_1002418712 125
86 3300006914 Ga0075436_100318584 Ga0075436_1003185841 125
87 3300006914 Ga0075436_100973454 Ga0075436_1009734542 125
88 3300006931 Ga0097620_100670340 Ga0097620_1006703402 125
89 3300007076 Ga0075435_101225520 Ga0075435_1012255201 125
90 3300009094 Ga0111539_10014798 Ga0111539_100147987 125
91 3300025912 Ga0207707_10012226 Ga0207707_100122264 125
92 3300025916 Ga0207663_10460880 Ga0207663_104608802 125
93 3300025917 Ga0207660_10179817 Ga0207660_101798174 125
94 3300025921 Ga0207652_10018948 Ga0207652_1001894810 125
95 3300025929 Ga0207664_10131637 Ga0207664_101316373 125
96 3300025936 Ga0207670_10090848 Ga0207670_100908483 125
97 3300025939 Ga0207665_10059580 Ga0207665_100595803 125
98 3300025960 Ga0207651_11592772 Ga0207651_115927721 125
99 3300025981 Ga0207640_11927105 Ga0207640_119271052 125
100 3300035091 Ga0373951_0043216 Ga0373951_0043216_586_972 125
101 3300035121 Ga0373960_0056978 Ga0373960_0056978_351_737 125
102 3300035691 Ga0373931_0009081 Ga0373931_0009081_296_682 125
103 3300045051 Ga0451576_1856697 Ga0451576_1856697_168_551 125
104 3300046459 Ga0495629_0342249 Ga0495629_0342249_555_938 125
105 3300046463 Ga0495653_0871345 Ga0495653_0871345_142_525 125
106 3300046475 Ga0495639_0380490 Ga0495639_0380490_236_619 125
107 3300046476 Ga0495662_0004510 Ga0495662_0004510_5117_5500 125
108 3300046516 Ga0495628_0166619 Ga0495628_0166619_688_1071 125
109 3300046517 Ga0495630_0022094 Ga0495630_0022094_4215_4598 125
110 3300046523 Ga0495644_0413390 Ga0495644_0413390_72_455 125
111 3300046529 Ga0495652_0567309 Ga0495652_0567309_23_406 125
112 3300046533 Ga0495640_0025452 Ga0495640_0025452_939_1322 125
113 3300046535 Ga0495586_0024165 Ga0495586_0024165_169_552 125
114 3300046642 Ga0495634_0073799 Ga0495634_0073799_920_1303 125
115 3300046663 Ga0495635_0353982 Ga0495635_0353982_89_472 125
116 3300046690 Ga0495624_0051449 Ga0495624_0051449_327_710 125
117 3300047317 Ga0495604_0044141 Ga0495604_0044141_1519_1902 125
118 3300047318 Ga0495636_0087092 Ga0495636_0087092_475_858 125
119 3300047319 Ga0495674_0689774 Ga0495674_0689774_358_741 125
120 3300050508 nmdc:mga09592_607305_c1 nmdc:mga09592_607305_c1_137_520 125
121 3300050511 nmdc:mga08y16_35714_c1 nmdc:mga08y16_35714_c1_3793_4176 125
122 3300050512 nmdc:mga0n895_1680667_c1 nmdc:mga0n895_1680667_c1_48_431 125
123 3300050512 nmdc:mga0n895_18812_c1 nmdc:mga0n895_18812_c1_3705_4088 125
124 3300050512 nmdc:mga0n895_465228_c1 nmdc:mga0n895_465228_c1_447_830 125
125 3300050513 nmdc:mga0rr50_623353_c1 nmdc:mga0rr50_623353_c1_263_646 125
126 3300050515 nmdc:mga0a205_412094_c1 nmdc:mga0a205_412094_c1_491_874 125
127 3300006163 Ga0070715_10686400 Ga0070715_106864001 126
128 3300006914 Ga0075436_100103779 Ga0075436_1001037792 126
129 3300009098 Ga0105245_10000478 Ga0105245_1000047812 126
130 3300009174 Ga0105241_10245775 Ga0105241_102457752 126
131 3300009176 Ga0105242_10000394 Ga0105242_100003945 126
132 3300009177 Ga0105248_10254286 Ga0105248_102542863 126
133 3300009553 Ga0105249_10002974 Ga0105249_100029745 126
134 3300010375 Ga0105239_10189653 Ga0105239_101896532 126
135 3300011119 Ga0105246_10048792 Ga0105246_100487924 126
136 3300013297 Ga0157378_10000543 Ga0157378_1000054312 126
137 3300014326 Ga0157380_10040069 Ga0157380_100400692 126
138 3300014969 Ga0157376_10002891 Ga0157376_1000289111 126
139 3300025905 Ga0207685_10111570 Ga0207685_101115702 126
140 3300026075 Ga0207708_10272829 Ga0207708_102728293 126
141 3300034817 Ga0373948_0172499 Ga0373948_0172499_43_423 126
142 3300035083 Ga0373926_0043420 Ga0373926_0043420_386_766 126
143 3300035089 Ga0373944_0002610 Ga0373944_0002610_2939_3319 126
144 3300035113 Ga0373936_0052725 Ga0373936_0052725_24_404 126
145 3300035114 Ga0373939_0084228 Ga0373939_0084228_233_613 126
146 3300035171 Ga0373946_0010410 Ga0373946_0010410_1353_1733 126
147 3300035172 Ga0373955_0580934 Ga0373955_0580934_127_519 126
148 3300035691 Ga0373931_0003691 Ga0373931_0003691_2128_2508 126
149 3300035692 Ga0373935_0017353 Ga0373935_0017353_807_1187 126
150 3300035692 Ga0373935_0033378 Ga0373935_0033378_1845_2237 126
151 3300035692 Ga0373935_0068885 Ga0373935_0068885_329_709 126
152 3300035695 Ga0373927_0066282 Ga0373927_0066282_1812_2192 126
153 3300035695 Ga0373927_0189331 Ga0373927_0189331_148_540 126
154 3300035725 Ga0373947_0008150 Ga0373947_0008150_3186_3566 126
155 3300035725 Ga0373947_0092165 Ga0373947_0092165_32_412 126
156 3300037068 Ga0373925_0013530 Ga0373925_0013530_1504_1884 126
157 3300037068 Ga0373925_0111557 Ga0373925_0111557_1506_1886 126
158 3300037068 Ga0373925_0299350 Ga0373925_0299350_686_1078 126
159 3300046472 Ga0495580_0001664 Ga0495580_0001664_15030_15410 126
160 3300046475 Ga0495639_0112119 Ga0495639_0112119_865_1245 126
161 3300046517 Ga0495630_0182500 Ga0495630_0182500_1136_1516 126
162 3300046526 Ga0495666_0007108 Ga0495666_0007108_1935_2315 126
163 3300046531 Ga0495665_0132868 Ga0495665_0132868_623_1003 126
164 3300046535 Ga0495586_0029696 Ga0495586_0029696_884_1264 126
165 3300046664 Ga0495659_0464822 Ga0495659_0464822_24_419 126
166 3300046674 Ga0495588_0349471 Ga0495588_0349471_121_501 126
167 3300046681 Ga0495647_0001515 Ga0495647_0001515_5130_5510 126
168 3300046683 Ga0495658_0001344 Ga0495658_0001344_6373_6753 126
169 3300047321 Ga0495676_0158476 Ga0495676_0158476_560_940 126
170 3300047322 Ga0495680_0623934 Ga0495680_0623934_110_493 126
171 3300048909 Ga0496106_0360924 Ga0496106_0360924_141_521 126
172 3300050514 nmdc:mga08x19_167054_c1 nmdc:mga08x19_167054_c1_980_1375 126
173 3300050514 nmdc:mga08x19_197117_c1 nmdc:mga08x19_197117_c1_355_750 126
174 3300005441 Ga0070700_100642492 Ga0070700_1006424922 127
175 3300007265 Ga0099794_10003056 Ga0099794_100030566 127
176 3300007265 Ga0099794_10023308 Ga0099794_100233082 127
177 3300027671 Ga0209588_1062839 Ga0209588_10628392 127
178 3300005536 Ga0070697_100023594 Ga0070697_1000235943 128
179 3300025928 Ga0207700_11264247 Ga0207700_112642472 128
180 3300031507 Ga0307509_10565566 Ga0307509_105655662 128
181 3300036401 Ga0373937_0147213 Ga0373937_0147213_1115_1516 128
182 3300046516 Ga0495628_0089554 Ga0495628_0089554_1798_2199 128
183 3300046517 Ga0495630_0199182 Ga0495630_0199182_700_1101 128
184 3300046529 Ga0495652_0434672 Ga0495652_0434672_462_863 128
185 3300046809 Ga0495600_0460691 Ga0495600_0460691_355_756 128
186 3300047322 Ga0495680_0141215 Ga0495680_0141215_603_1004 128
187 3300049584 Ga0501068_0117371 Ga0501068_0117371_456_848 128
188 3300005295 Ga0065707_10011638 Ga0065707_100116382 129
189 3300005330 Ga0070690_100001786 Ga0070690_1000017867 129
190 3300005334 Ga0068869_100000861 Ga0068869_1000008617 129
191 3300005335 Ga0070666_10634774 Ga0070666_106347742 129
192 3300005336 Ga0070680_100000425 Ga0070680_10000042525 129
193 3300005337 Ga0070682_100005149 Ga0070682_1000051496 129
194 3300005338 Ga0068868_100008269 Ga0068868_1000082694 129
195 3300005340 Ga0070689_100082452 Ga0070689_1000824523 129
196 3300005341 Ga0070691_10000474 Ga0070691_100004747 129
197 3300005343 Ga0070687_100000066 Ga0070687_10000006610 129
198 3300005345 Ga0070692_10002172 Ga0070692_100021727 129
199 3300005345 Ga0070692_10188718 Ga0070692_101887182 129
200 3300005354 Ga0070675_100100079 Ga0070675_1001000794 129
201 3300005364 Ga0070673_100056928 Ga0070673_1000569283 129
202 3300005367 Ga0070667_100253447 Ga0070667_1002534473 129
203 3300005437 Ga0070710_10077969 Ga0070710_100779691 129
204 3300005438 Ga0070701_10000851 Ga0070701_100008511 129
205 3300005438 Ga0070701_10219897 Ga0070701_102198972 129
206 3300005439 Ga0070711_100583359 Ga0070711_1005833592 129
207 3300005440 Ga0070705_100000090 Ga0070705_10000009035 129
208 3300005441 Ga0070700_100000660 Ga0070700_10000066013 129
209 3300005444 Ga0070694_100000122 Ga0070694_10000012214 129
210 3300005445 Ga0070708_100402417 Ga0070708_1004024173 129
211 3300005456 Ga0070678_100638324 Ga0070678_1006383242 129
212 3300005457 Ga0070662_100953923 Ga0070662_1009539231 129
213 3300005459 Ga0068867_100001835 Ga0068867_1000018357 129
214 3300005471 Ga0070698_100770016 Ga0070698_1007700162 129
215 3300005518 Ga0070699_100118727 Ga0070699_1001187274 129
216 3300005518 Ga0070699_100598729 Ga0070699_1005987292 129
217 3300005530 Ga0070679_100042423 Ga0070679_1000424236 129
218 3300005536 Ga0070697_100060806 Ga0070697_1000608062 129
219 3300005539 Ga0068853_100033613 Ga0068853_1000336134 129
220 3300005539 Ga0068853_102071672 Ga0068853_1020716721 129
221 3300005544 Ga0070686_100000292 Ga0070686_10000029211 129
222 3300005545 Ga0070695_100000095 Ga0070695_10000009526 129
223 3300005545 Ga0070695_100420051 Ga0070695_1004200512 129
224 3300005546 Ga0070696_100000133 Ga0070696_10000013329 129
225 3300005547 Ga0070693_100000075 Ga0070693_10000007533 129
226 3300005549 Ga0070704_100000230 Ga0070704_10000023011 129
227 3300005563 Ga0068855_100001022 Ga0068855_10000102217 129
228 3300005578 Ga0068854_100006861 Ga0068854_1000068616 129
229 3300005614 Ga0068856_100079297 Ga0068856_1000792972 129
230 3300005614 Ga0068856_100135113 Ga0068856_1001351132 129
231 3300005615 Ga0070702_100000043 Ga0070702_10000004327 129
232 3300005616 Ga0068852_100201177 Ga0068852_1002011773 129
233 3300005617 Ga0068859_100014434 Ga0068859_1000144349 129
234 3300005618 Ga0068864_100241963 Ga0068864_1002419632 129
235 3300005718 Ga0068866_10000104 Ga0068866_1000010414 129
236 3300005719 Ga0068861_100000193 Ga0068861_10000019310 129
237 3300005840 Ga0068870_10101631 Ga0068870_101016313 129
238 3300005841 Ga0068863_102017568 Ga0068863_1020175682 129
239 3300005842 Ga0068858_100001082 Ga0068858_10000108217 129
240 3300005843 Ga0068860_100002195 Ga0068860_1000021957 129
241 3300005843 Ga0068860_100457912 Ga0068860_1004579122 129
242 3300005844 Ga0068862_100002970 Ga0068862_10000297011 129
243 3300006038 Ga0075365_10235404 Ga0075365_102354042 129
244 3300006237 Ga0097621_100000248 Ga0097621_10000024815 129
245 3300006237 Ga0097621_101440917 Ga0097621_1014409172 129
246 3300006358 Ga0068871_100000205 Ga0068871_10000020531 129
247 3300006358 Ga0068871_100027053 Ga0068871_1000270534 129
248 3300006844 Ga0075428_100000254 Ga0075428_10000025411 129
249 3300006846 Ga0075430_100071333 Ga0075430_1000713332 129
250 3300006852 Ga0075433_10002965 Ga0075433_100029658 129
251 3300006871 Ga0075434_100000078 Ga0075434_10000007842 129
252 3300006871 Ga0075434_100004556 Ga0075434_1000045566 129
253 3300006880 Ga0075429_100012782 Ga0075429_1000127827 129
254 3300006881 Ga0068865_100000346 Ga0068865_1000003467 129
255 3300006914 Ga0075436_100000360 Ga0075436_10000036025 129
256 3300006914 Ga0075436_100012897 Ga0075436_1000128976 129
257 3300006914 Ga0075436_100430576 Ga0075436_1004305762 129
258 3300006914 Ga0075436_100786140 Ga0075436_1007861402 129
259 3300006931 Ga0097620_100014436 Ga0097620_1000144369 129
260 3300007076 Ga0075435_100000045 Ga0075435_10000004554 129
261 3300007076 Ga0075435_100001714 Ga0075435_1000017146 129
262 3300009094 Ga0111539_10406016 Ga0111539_104060162 129
263 3300009098 Ga0105245_10235431 Ga0105245_102354312 129
264 3300009147 Ga0114129_10000030 Ga0114129_1000003041 129
265 3300009147 Ga0114129_12028793 Ga0114129_120287932 129
266 3300009148 Ga0105243_10000413 Ga0105243_1000041337 129
267 3300009176 Ga0105242_12081735 Ga0105242_120817351 129
268 3300014969 Ga0157376_10006351 Ga0157376_100063516 129
269 3300025899 Ga0207642_10001996 Ga0207642_100019967 129
270 3300025903 Ga0207680_10273048 Ga0207680_102730482 129
271 3300025911 Ga0207654_10211400 Ga0207654_102114003 129
272 3300025917 Ga0207660_10003559 Ga0207660_100035599 129
273 3300025918 Ga0207662_10000113 Ga0207662_1000011311 129
274 3300025921 Ga0207652_10100044 Ga0207652_101000443 129
275 3300025926 Ga0207659_10022295 Ga0207659_100222956 129
276 3300025927 Ga0207687_10000273 Ga0207687_1000027325 129
277 3300025927 Ga0207687_10514232 Ga0207687_105142322 129
278 3300025934 Ga0207686_10000675 Ga0207686_1000067521 129
279 3300025935 Ga0207709_10037231 Ga0207709_100372312 129
280 3300025935 Ga0207709_11150476 Ga0207709_111504761 129
281 3300025936 Ga0207670_10002137 Ga0207670_1000213710 129
282 3300025936 Ga0207670_10017972 Ga0207670_100179723 129
283 3300025938 Ga0207704_10000665 Ga0207704_1000066510 129
284 3300025941 Ga0207711_10200355 Ga0207711_102003553 129
285 3300025942 Ga0207689_10000554 Ga0207689_1000055412 129
286 3300025944 Ga0207661_10036106 Ga0207661_100361064 129
287 3300025949 Ga0207667_10005883 Ga0207667_100058836 129
288 3300025949 Ga0207667_10911930 Ga0207667_109119302 129
289 3300025960 Ga0207651_10381795 Ga0207651_103817952 129
290 3300025961 Ga0207712_10009340 Ga0207712_100093406 129
291 3300025981 Ga0207640_10001066 Ga0207640_1000106613 129
292 3300026023 Ga0207677_10000391 Ga0207677_1000039124 129
293 3300026035 Ga0207703_10004713 Ga0207703_100047135 129
294 3300026041 Ga0207639_10040627 Ga0207639_100406274 129
295 3300026075 Ga0207708_10000505 Ga0207708_1000050513 129
296 3300026078 Ga0207702_10012237 Ga0207702_100122372 129
297 3300026089 Ga0207648_10000548 Ga0207648_1000054828 129
298 3300026095 Ga0207676_10123268 Ga0207676_101232682 129
299 3300026116 Ga0207674_10658401 Ga0207674_106584013 129
300 3300026118 Ga0207675_100000305 Ga0207675_10000030516 129
301 3300026142 Ga0207698_10293581 Ga0207698_102935812 129
302 3300027907 Ga0207428_10003517 Ga0207428_1000351716 129
303 3300027907 Ga0207428_10085593 Ga0207428_100855932 129
304 3300028380 Ga0268265_10001208 Ga0268265_1000120816 129
305 3300028381 Ga0268264_10000882 Ga0268264_1000088226 129
306 3300028381 Ga0268264_10896072 Ga0268264_108960722 129
307 3300030521 Ga0307511_10000001 Ga0307511_10000001133 129
308 3300034816 Ga0373930_0049854 Ga0373930_0049854_16_405 129
309 3300034819 Ga0373958_0086395 Ga0373958_0086395_12_422 129
310 3300035084 Ga0373928_0136514 Ga0373928_0136514_93_482 129
311 3300035090 Ga0373949_0015361 Ga0373949_0015361_105_494 129
312 3300035114 Ga0373939_0004132 Ga0373939_0004132_1916_2305 129
313 3300035114 Ga0373939_0515389 Ga0373939_0515389_29_439 129
314 3300035117 Ga0373953_0078181 Ga0373953_0078181_383_772 129
315 3300035172 Ga0373955_0142049 Ga0373955_0142049_160_549 129
316 3300035410 Ga0373924_0022910 Ga0373924_0022910_402_791 129
317 3300035691 Ga0373931_0050129 Ga0373931_0050129_219_608 129
318 3300035692 Ga0373935_0268155 Ga0373935_0268155_534_923 129
319 3300035724 Ga0373933_0001521 Ga0373933_0001521_1549_1938 129
320 3300041458 Ga0451798_0905266 Ga0451798_0905266_13_405 129
321 3300042876 Ga0451577_0031216 Ga0451577_0031216_951_1340 129
322 3300042876 Ga0451577_0912133 Ga0451577_0912133_226_696 129
323 3300044712 Ga0453684_0966110 Ga0453684_0966110_140_529 129
324 3300045051 Ga0451576_0006627 Ga0451576_0006627_3574_3963 129
325 3300045051 Ga0451576_0054200 Ga0451576_0054200_3439_3864 129
326 3300045051 Ga0451576_0177541 Ga0451576_0177541_545_955 129
327 3300045051 Ga0451576_0677435 Ga0451576_0677435_562_951 129
328 3300046516 Ga0495628_0343574 Ga0495628_0343574_403_792 129
329 3300046615 Ga0495656_0408234 Ga0495656_0408234_81_473 129
330 3300046664 Ga0495659_0013093 Ga0495659_0013093_1506_1895 129
331 3300046679 Ga0495623_0343913 Ga0495623_0343913_59_448 129
332 3300047319 Ga0495674_0393979 Ga0495674_0393979_18_407 129
333 3300050492 nmdc:mga0yw44_173050_c1 nmdc:mga0yw44_173050_c1_366_767 129
334 3300050507 nmdc:mga05p37_329_c2 nmdc:mga05p37_329_c2_48336_48725 129
335 3300050508 nmdc:mga09592_13651_c1 nmdc:mga09592_13651_c1_5154_5543 129
336 3300050509 nmdc:mga0qj67_265820_c1 nmdc:mga0qj67_265820_c1_789_1178 129
337 3300050509 nmdc:mga0qj67_266923_c1 nmdc:mga0qj67_266923_c1_446_853 129
338 3300050511 nmdc:mga08y16_137197_c1 nmdc:mga08y16_137197_c1_1728_2144 129
339 3300050511 nmdc:mga08y16_6015_c1 nmdc:mga08y16_6015_c1_5952_6341 129
340 3300050512 nmdc:mga0n895_1741_c1 nmdc:mga0n895_1741_c1_568_984 129
341 3300050512 nmdc:mga0n895_324358_c1 nmdc:mga0n895_324358_c1_53_442 129
342 3300050512 nmdc:mga0n895_394331_c1 nmdc:mga0n895_394331_c1_198_590 129
343 3300050513 nmdc:mga0rr50_100059_c1 nmdc:mga0rr50_100059_c1_769_1158 129
344 3300050513 nmdc:mga0rr50_143704_c1 nmdc:mga0rr50_143704_c1_1028_1444 129
345 3300050514 nmdc:mga08x19_17549_c1 nmdc:mga08x19_17549_c1_371_760 129
346 3300050514 nmdc:mga08x19_309014_c1 nmdc:mga08x19_309014_c1_545_955 129
347 3300050514 nmdc:mga08x19_5848_c1 nmdc:mga08x19_5848_c1_3971_4387 129
348 3300050515 nmdc:mga0a205_1339_c1 nmdc:mga0a205_1339_c1_568_984 129
349 3300053088 Ga0500644_0202477 Ga0500644_0202477_202_609 129
350 3300053090 Ga0500646_0003615 Ga0500646_0003615_2374_2781 129
351 3300053092 Ga0500583_0009319 Ga0500583_0009319_1418_1825 129
352 3300053092 Ga0500583_0173876 Ga0500583_0173876_90_497 129
353 3300053133 Ga0500655_000524 Ga0500655_000524_1151_1558 129
354 3300053142 Ga0500577_0229985 Ga0500577_0229985_44_451 129
355 3300053151 Ga0500604_0003693 Ga0500604_0003693_2760_3167 129
356 3300053730 Ga0500645_054209 Ga0500645_054209_498_905 129
357 3300053732 Ga0500656_030887 Ga0500656_030887_113_520 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

45

115

0.94

PF02311

AraC_binding

AraC-like ligand binding domain

43

117

0.89

PF00190

Cupin_1

Cupin

23

118

0.88

PF05899

Cupin_3

EutQ-like cupin domain

36

110

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wpw-assembly1.cif.gz_A crystal structure of coconut allergen cocosin 0.9354 41 114
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.9174 41 113
2q1z-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr 0.91 23 114
7zyb-assembly1.cif.gz_A bekdgf with ca 0.9093 22 115
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.8982 36 114
ID Description Score Start End Superfamily
af_A0A0R0GUX4_36_216_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.927 41 114 2.60.120.10
3kscB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9258 41 114 2.60.120.10
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9174 41 113 2.60.120.10
5cadA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9141 41 119 2.60.120.10
af_F1LVA4_66_267_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.909 41 118 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A521BEV1-F1-model_v4 Cupin domain-containing protein 0.9851 23 127
AF-A0A809GPB4-F1-model_v4 deleted 0.9827 25 127
AF-A0A840LM23-F1-model_v4 deleted 0.9805 25 127
AF-A0A0Q7FZH1-F1-model_v4 Cupin type-2 domain-containing protein 0.9802 23 127
AF-A0A177HIB5-F1-model_v4 Cupin domain protein 0.9794 22 127

Feature Viewer

pLDDT pTM Quality
89.12 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map