F420733

General Info

Members Datasets Scaffolds Average Seq Length
357 193 714 101

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100153911|Ga0070680_1001539114
Length 112
Sequence MATPGLAANAYAQMARITDAAAGIKRTAAGIAGTADQGGQTFTDMLKDALGSVRQTGAKSDAQARALASGGNKADLVDVVTAVAETETAVNTLVSVRDKVVAAYQQIMQMPI

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
46 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
49 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
50 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
68 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
76 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
77 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
80 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
132 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
182 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
183 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
184 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
185 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
186 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
189 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.8
Nodule 0
Rhizoplane 0.56
Rhizosphere 86.27
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100153911 3300005336 Bacteria 1931
2 Ga0070658_10395543 3300005327 Bacteria 1187
3 Ga0070676_11338568 3300005328 Bacteria 548
4 Ga0070680_100065287 3300005336 Bacteria 2982
5 Ga0070660_100144027 3300005339 Bacteria 1913
6 Ga0070687_101113927 3300005343 Bacteria 578
7 Ga0070668_100346437 3300005347 Bacteria 1256
8 Ga0070688_101031524 3300005365 Bacteria 655
9 Ga0070709_10121510 3300005434 Bacteria 1771
10 Ga0070709_11497533 3300005434 Bacteria 548
11 Ga0070714_100364137 3300005435 Bacteria 1360
12 Ga0070713_100428837 3300005436 Bacteria 1239
13 Ga0070713_102106155 3300005436 Bacteria 547
14 Ga0070710_10447418 3300005437 Bacteria 875
15 Ga0070705_100076239 3300005440 Bacteria 2044
16 Ga0070694_100663399 3300005444 Bacteria 845
17 Ga0070708_100583647 3300005445 Bacteria 1054
18 Ga0070681_10043386 3300005458 Bacteria 4506
19 Ga0070681_10048667 3300005458 Bacteria 4236
20 Ga0070679_100216342 3300005530 Bacteria 1878
21 Ga0070697_100002804 3300005536 Bacteria 13422
22 Ga0070686_100559418 3300005544 Bacteria 896
23 Ga0070695_100001945 3300005545 Bacteria 11708
24 Ga0070695_100188462 3300005545 Bacteria 1466
25 Ga0070695_101768717 3300005545 Bacteria 518
26 Ga0070696_100012209 3300005546 Bacteria 5756
27 Ga0070696_100849556 3300005546 Bacteria 754
28 Ga0070665_100973487 3300005548 Bacteria 861
29 Ga0070665_102261502 3300005548 Bacteria 547
30 Ga0070704_100053993 3300005549 Bacteria 2842
31 Ga0070704_100198237 3300005549 Bacteria 1619
32 Ga0068855_101460627 3300005563 Bacteria 703
33 Ga0081538_10035073 3300005981 Bacteria 3303
34 Ga0081540_1000068 3300005983 Bacteria 112697
35 Ga0081539_10060752 3300005985 Bacteria 2073
36 Ga0070717_10088016 3300006028 Bacteria 2617
37 Ga0070717_10178537 3300006028 Bacteria 1850
38 Ga0075365_10002786 3300006038 Bacteria 8739
39 Ga0075365_10323600 3300006038 Bacteria 1086
40 Ga0075368_10494205 3300006042 Bacteria 545
41 Ga0075364_10020609 3300006051 Bacteria 4148
42 Ga0070716_101042438 3300006173 Bacteria 649
43 Ga0070712_100418076 3300006175 Bacteria 1111
44 Ga0075362_10023130 3300006177 Bacteria 2626
45 Ga0075362_10186649 3300006177 Bacteria 1006
46 Ga0075367_10211405 3300006178 Bacteria 1213
47 Ga0075366_10390703 3300006195 Bacteria 856
48 Ga0075436_100005213 3300006914 Bacteria 8946
49 Ga0075435_100391715 3300007076 Bacteria 1194
50 Ga0105243_10155014 3300009148 Bacteria 1969
51 Ga0105243_11045757 3300009148 Bacteria 822
52 Ga0105242_11758912 3300009176 Bacteria 657
53 Ga0105249_10006997 3300009553 Bacteria 9843
54 Ga0157378_10157910 3300013297 Bacteria 2118
55 Ga0157372_13308871 3300013307 Bacteria 513
56 Ga0157379_11482327 3300014968 Bacteria 660
57 Ga0163161_10681346 3300017792 Bacteria 854
58 Ga0213873_10292353 3300021358 Bacteria 524
59 Ga0213874_10088145 3300021377 Bacteria 1015
60 Ga0213876_10317428 3300021384 Bacteria 828
61 Ga0224572_1009661 3300024225 Bacteria 1804
62 Ga0224572_1011463 3300024225 Bacteria 1677
63 Ga0228598_1053270 3300024227 Bacteria 803
64 Ga0207685_10210361 3300025905 Bacteria 919
65 Ga0207699_10103008 3300025906 Bacteria 1815
66 Ga0207705_10462398 3300025909 Bacteria 984
67 Ga0207707_10065647 3300025912 Bacteria 3161
68 Ga0207707_10169201 3300025912 Bacteria 1910
69 Ga0207660_10209944 3300025917 Bacteria 1524
70 Ga0207657_10420746 3300025919 Bacteria 1050
71 Ga0207652_10032556 3300025921 Bacteria 4384
72 Ga0207700_10212041 3300025928 Bacteria 1638
73 Ga0207700_11524667 3300025928 Bacteria 593
74 Ga0207664_10567339 3300025929 Bacteria 1019
75 Ga0207686_11786386 3300025934 Bacteria 509
76 Ga0207709_10108039 3300025935 Bacteria 1854
77 Ga0207665_10686984 3300025939 Bacteria 804
78 Ga0207667_11279268 3300025949 Bacteria 711
79 Ga0207712_10022270 3300025961 Bacteria 4170
80 Ga0207683_10895065 3300026121 Bacteria 824
81 Ga0209813_10047100 3300027866 Bacteria 1334
82 Ga0209813_10067719 3300027866 Bacteria 1154
83 Ga0268264_10583992 3300028381 Bacteria 1099
84 Ga0265337_1009820 3300028556 Bacteria 3391
85 Ga0265763_1002551 3300030763 Bacteria 1402
86 Ga0265760_10005992 3300031090 Bacteria 3474
87 Ga0265760_10040731 3300031090 Unclassified 1384
88 Ga0265340_10118676 3300031247 Bacteria 1218
89 Ga0265340_10430528 3300031247 Bacteria 582
90 Ga0307408_100070179 3300031548 Bacteria 2586
91 Ga0265313_10270844 3300031595 Bacteria 688
92 Ga0307406_11818323 3300031901 Bacteria 542
93 Ga0307411_12072334 3300032005 Bacteria 532
94 Ga0307411_12179108 3300032005 Bacteria 519
95 Ga0373928_0133049 3300035084 Bacteria 676
96 Ga0373934_0020106 3300035086 Bacteria 2566
97 Ga0373934_0041466 3300035086 Bacteria 1817
98 Ga0373923_0080029 3300035111 Bacteria 1416
99 Ga0373923_0449969 3300035111 Bacteria 624
100 Ga0373936_0055386 3300035113 Bacteria 1610
101 Ga0373941_0011875 3300035115 Bacteria 2262
102 Ga0373945_0128163 3300035116 Bacteria 1015
103 Ga0373953_0144228 3300035117 Bacteria 1019
104 Ga0373954_0007849 3300035118 Bacteria 4674
105 Ga0373954_0041363 3300035118 Bacteria 2149
106 Ga0373954_0242779 3300035118 Bacteria 886
107 Ga0373956_0005348 3300035119 Bacteria 5138
108 Ga0373956_0088282 3300035119 Bacteria 1428
109 Ga0373956_0435185 3300035119 Bacteria 626
110 Ga0373957_0034400 3300035120 Bacteria 1876
111 Ga0373943_0086952 3300035170 Bacteria 1613
112 Ga0373955_0008083 3300035172 Bacteria 4865
113 Ga0373924_0039127 3300035410 Bacteria 1937
114 Ga0373924_0372304 3300035410 Bacteria 637
115 Ga0373935_0591301 3300035692 Bacteria 811
116 Ga0373933_0001351 3300035724 Bacteria 14455
117 Ga0373933_0357773 3300035724 Bacteria 949
118 Ga0373933_0839827 3300035724 Bacteria 605
119 Ga0373947_0571371 3300035725 Bacteria 770
120 Ga0373937_0004518 3300036401 Bacteria 11814
121 Ga0373937_0029710 3300036401 Bacteria 4951
122 Ga0373937_0792477 3300036401 Bacteria 895
123 Ga0373925_0037613 3300037068 Bacteria 3574
124 Ga0373925_0354702 3300037068 Bacteria 1191
125 Ga0436364_1168080 3300037853 Bacteria 617
126 Ga0436365_0043358 3300039437 Bacteria 2346
127 Ga0436365_1030822 3300039437 Bacteria 618
128 Ga0436365_1745019 3300039437 Bacteria 2083
129 Ga0436360_0488179 3300039438 Bacteria 700
130 Ga0436361_1154916 3300039447 Bacteria 1442
131 Ga0436363_1671504 3300039450 Bacteria 1051
132 Ga0436362_0835176 3300039453 Bacteria 534
133 Ga0439439_0189852 3300041406 Bacteria 594
134 Ga0466966_0418940 3300044684 Bacteria 805
135 Ga0466963_0037383 3300044694 Bacteria 3169
136 Ga0466963_0873600 3300044694 Bacteria 634
137 Ga0466971_0530553 3300044719 Bacteria 583
138 Ga0466959_1049682 3300045049 Bacteria 542
139 Ga0466958_0167552 3300045836 Bacteria 1390
140 Ga0466967_0231005 3300045976 Bacteria 1761
141 Ga0495629_0093680 3300046459 Bacteria 2096
142 Ga0495638_0406222 3300046460 Bacteria 705
143 Ga0495651_0146608 3300046462 Bacteria 1706
144 Ga0495651_0440403 3300046462 Bacteria 844
145 Ga0495651_0745304 3300046462 Bacteria 608
146 Ga0495608_0050304 3300046511 Bacteria 2765
147 Ga0495608_0575351 3300046511 Bacteria 677
148 Ga0495608_0816544 3300046511 Bacteria 550
149 Ga0495628_0240696 3300046516 Bacteria 1354
150 Ga0495628_0432168 3300046516 Bacteria 958
151 Ga0495630_0721725 3300046517 Bacteria 762
152 Ga0495630_0832275 3300046517 Bacteria 704
153 Ga0495648_0464566 3300046524 Bacteria 550
154 Ga0495652_0354098 3300046529 Bacteria 1051
155 Ga0495652_0805091 3300046529 Bacteria 625
156 Ga0495640_0348115 3300046533 Bacteria 915
157 Ga0495640_0481830 3300046533 Bacteria 756
158 Ga0495587_0166077 3300046536 Bacteria 1255
159 Ga0495587_0341404 3300046536 Bacteria 835
160 Ga0495587_0576558 3300046536 Bacteria 620
161 Ga0495667_0148765 3300046559 Bacteria 1508
162 Ga0495634_0639470 3300046642 Bacteria 615
163 Ga0495635_0077498 3300046663 Bacteria 2277
164 Ga0495635_0125063 3300046663 Bacteria 1754
165 Ga0495635_0177818 3300046663 Bacteria 1447
166 Ga0495657_0041194 3300046675 Bacteria 3163
167 Ga0495623_0079267 3300046679 Bacteria 2035
168 Ga0495613_0089361 3300046689 Bacteria 2232
169 Ga0495600_0235773 3300046809 Bacteria 1167
170 Ga0495600_0360584 3300046809 Bacteria 909
171 Ga0495604_0872996 3300047317 Bacteria 563
172 Ga0495674_0059455 3300047319 Bacteria 3338
173 Ga0495674_0627841 3300047319 Bacteria 849
174 Ga0495672_0007287 3300047320 Bacteria 8342
175 Ga0495672_0132333 3300047320 Bacteria 1311
176 Ga0495683_0236434 3300047323 Bacteria 808
177 Ga0495675_0037936 3300047444 Bacteria 3068
178 Ga0495602_0064297 3300048088 Bacteria 3173
179 Ga0496100_0997525 3300048903 Bacteria 659
180 Ga0496101_0730224 3300048904 Bacteria 782
181 Ga0496117_0245782 3300048920 Bacteria 979
182 Ga0496118_0345850 3300048921 Bacteria 794
183 Ga0496121_0024864 3300048924 Bacteria 5710
184 Ga0496121_0436029 3300048924 Bacteria 848
185 Ga0496126_0179011 3300048929 Bacteria 1802
186 Ga0495682_0200239 3300049460 Bacteria 708
187 Ga0501031_0181326 3300049568 Bacteria 1375
188 Ga0501032_0021256 3300049569 Bacteria 4512
189 Ga0501032_0053693 3300049569 Bacteria 2713
190 Ga0501032_0170713 3300049569 Bacteria 1426
191 Ga0501033_0016948 3300049570 Bacteria 5507
192 Ga0501033_0219875 3300049570 Bacteria 1352
193 Ga0501033_0260856 3300049570 Bacteria 1226
194 Ga0501034_0014223 3300049571 Bacteria 8203
195 Ga0501034_0080289 3300049571 Bacteria 3265
196 Ga0501034_0267708 3300049571 Bacteria 1650
197 Ga0501034_0306810 3300049571 Bacteria 1523
198 Ga0501034_0311913 3300049571 Bacteria 1507
199 Ga0501034_0521078 3300049571 Bacteria 1100
200 Ga0501034_0730822 3300049571 Bacteria 886
201 Ga0501034_1228750 3300049571 Bacteria 627
202 Ga0501036_0024915 3300049572 Bacteria 5046
203 Ga0501036_0043358 3300049572 Bacteria 3809
204 Ga0501036_0211714 3300049572 Bacteria 1629
205 Ga0501036_0322081 3300049572 Bacteria 1292
206 Ga0501036_0899577 3300049572 Bacteria 726
207 Ga0501037_0009677 3300049573 Bacteria 7074
208 Ga0501037_0021839 3300049573 Bacteria 4736
209 Ga0501037_0023898 3300049573 Bacteria 4520
210 Ga0501037_0034118 3300049573 Bacteria 3756
211 Ga0501037_0562611 3300049573 Bacteria 768
212 Ga0501038_0083619 3300049574 Bacteria 2686
213 Ga0501038_0116269 3300049574 Bacteria 2210
214 Ga0501038_0153447 3300049574 Bacteria 1876
215 Ga0501038_0325972 3300049574 Bacteria 1200
216 Ga0501039_0012374 3300049575 Bacteria 6511
217 Ga0501039_0263934 3300049575 Bacteria 1353
218 Ga0501039_1168860 3300049575 Bacteria 595
219 Ga0501040_0281903 3300049576 Bacteria 1187
220 Ga0501040_1033731 3300049576 Bacteria 596
221 Ga0501041_0108405 3300049577 Bacteria 1722
222 Ga0501042_0039879 3300049578 Bacteria 3338
223 Ga0501042_0051282 3300049578 Bacteria 2943
224 Ga0501043_0001791 3300049579 Bacteria 18452
225 Ga0501043_0412225 3300049579 Bacteria 1019
226 Ga0501043_0669720 3300049579 Bacteria 760
227 Ga0501046_0069371 3300049580 Bacteria 2742
228 Ga0501046_0153622 3300049580 Bacteria 1735
229 Ga0501046_0156464 3300049580 Bacteria 1716
230 Ga0501046_0651856 3300049580 Bacteria 744
231 Ga0501046_0896149 3300049580 Bacteria 619
232 Ga0501047_0051814 3300049581 Bacteria 3966
233 Ga0501047_0133900 3300049581 Bacteria 2358
234 Ga0501048_0018826 3300049582 Bacteria 5075
235 Ga0501067_0041609 3300049583 Bacteria 2551
236 Ga0501067_0059042 3300049583 Bacteria 2124
237 Ga0501068_0091851 3300049584 Bacteria 1873
238 Ga0501068_0126712 3300049584 Bacteria 1595
239 Ga0501068_0349865 3300049584 Bacteria 949
240 Ga0501068_0371309 3300049584 Bacteria 920
241 Ga0501068_0679710 3300049584 Bacteria 673
242 Ga0501068_0795443 3300049584 Bacteria 620
243 Ga0501069_0029732 3300049585 Bacteria 2999
244 Ga0501069_0058802 3300049585 Bacteria 2145
245 Ga0501069_0068348 3300049585 Bacteria 1988
246 Ga0501069_0387949 3300049585 Bacteria 825
247 Ga0501069_0819432 3300049585 Bacteria 564
248 Ga0501070_0075813 3300049586 Bacteria 2784
249 Ga0501070_0109416 3300049586 Bacteria 2283
250 Ga0501070_0125475 3300049586 Bacteria 2121
251 Ga0501070_0568114 3300049586 Bacteria 906
252 Ga0501070_0624893 3300049586 Bacteria 857
253 Ga0501070_1063041 3300049586 Bacteria 625
254 Ga0501071_0168658 3300049587 Bacteria 1638
255 Ga0501071_0615062 3300049587 Bacteria 835
256 Ga0501071_0869283 3300049587 Bacteria 695
257 Ga0501071_1290441 3300049587 Bacteria 564
258 Ga0501072_0174523 3300049588 Bacteria 1715
259 Ga0501072_0255026 3300049588 Bacteria 1397
260 Ga0501072_0296408 3300049588 Bacteria 1285
261 Ga0501072_0469359 3300049588 Bacteria 996
262 Ga0501072_1149677 3300049588 Bacteria 603
263 Ga0501073_0005090 3300049589 Bacteria 9859
264 Ga0501073_0038850 3300049589 Bacteria 3374
265 Ga0501073_0128849 3300049589 Bacteria 1754
266 Ga0501073_0551818 3300049589 Bacteria 796
267 Ga0501073_0745215 3300049589 Bacteria 675
268 Ga0501073_1217348 3300049589 Bacteria 517
269 Ga0501074_0035056 3300049590 Bacteria 3636
270 Ga0501074_0093124 3300049590 Bacteria 2158
271 Ga0501074_0197148 3300049590 Bacteria 1435
272 Ga0501074_0556981 3300049590 Bacteria 811
273 Ga0501074_0701217 3300049590 Bacteria 714
274 Ga0501075_0005049 3300049591 Bacteria 9017
275 Ga0501075_0271540 3300049591 Bacteria 1292
276 Ga0501075_0532290 3300049591 Bacteria 897
277 Ga0501075_0692801 3300049591 Bacteria 776
278 Ga0501076_0009314 3300049592 Bacteria 7247
279 Ga0501077_0002177 3300049593 Bacteria 11842
280 Ga0501079_0058877 3300049741 Bacteria 2964
281 Ga0501079_0104936 3300049741 Bacteria 2193
282 Ga0501079_0791559 3300049741 Bacteria 746
283 Ga0501079_1211951 3300049741 Bacteria 595
284 Ga0501079_1223826 3300049741 Bacteria 591
285 Ga0501080_0012989 3300049742 Bacteria 7647
286 Ga0501080_0107108 3300049742 Bacteria 2591
287 Ga0501080_0151329 3300049742 Bacteria 2144
288 Ga0501080_0170788 3300049742 Bacteria 2005
289 Ga0501080_0482880 3300049742 Bacteria 1108
290 Ga0501080_0661676 3300049742 Bacteria 923
291 Ga0501080_0745169 3300049742 Bacteria 862
292 Ga0501080_0840287 3300049742 Bacteria 803
293 Ga0501080_0979306 3300049742 Bacteria 734
294 Ga0501081_0037000 3300049743 Bacteria 3330
295 Ga0501081_0133260 3300049743 Bacteria 1777
296 Ga0501081_0228335 3300049743 Bacteria 1355
297 Ga0501081_0801311 3300049743 Bacteria 709
298 Ga0501083_0136146 3300049744 Bacteria 1609
299 Ga0501083_0672241 3300049744 Bacteria 673
300 Ga0501083_0776146 3300049744 Bacteria 623
301 Ga0501083_1050897 3300049744 Bacteria 530
302 Ga0501035_0002286 3300049822 Bacteria 18944
303 Ga0501035_0007147 3300049822 Bacteria 10442
304 Ga0501035_0050687 3300049822 Bacteria 3719
305 Ga0501035_0414772 3300049822 Bacteria 1118
306 Ga0501035_0633263 3300049822 Bacteria 868
307 Ga0501044_0039324 3300049823 Bacteria 4935
308 Ga0501044_0101856 3300049823 Bacteria 2888
309 Ga0501044_0272696 3300049823 Bacteria 1627
310 Ga0501044_0564017 3300049823 Bacteria 1034
311 Ga0501044_0609183 3300049823 Bacteria 984
312 Ga0501044_1073991 3300049823 Bacteria 675
313 Ga0501045_0284568 3300049824 Bacteria 1231
314 Ga0501045_0354878 3300049824 Bacteria 1091
315 Ga0501045_0366554 3300049824 Bacteria 1072
316 nmdc:mga03683_19526_c1 3300050489 Bacteria 2588
317 nmdc:mga03n38_217414_c1 3300050490 Bacteria 996
318 nmdc:mga00v17_431940_c1 3300050491 Bacteria 855
319 nmdc:mga00v17_6540_c1 3300050491 Bacteria 6187
320 nmdc:mga0yw44_139243_c1 3300050492 Bacteria 1576
321 nmdc:mga0yw44_14557_c1 3300050492 Bacteria 4181
322 nmdc:mga0k408_436507_c1 3300050493 Bacteria 778
323 nmdc:mga06z11_20716_c1 3300050494 Bacteria 3043
324 nmdc:mga04h51_127080_c1 3300050495 Bacteria 955
325 nmdc:mga04h51_7388_c1 3300050495 Bacteria 2897
326 nmdc:mga04h51_80924_c1 3300050495 Bacteria 1152
327 nmdc:mga0rr50_1371355_c1 3300050513 Bacteria 599
328 nmdc:mga08x19_23_c1 3300050514 Bacteria 288286
329 Ga0495601_0169702 3300053077 Bacteria 1426
330 Ga0495601_0267484 3300053077 Bacteria 1115
331 Ga0495612_0077288 3300053078 Bacteria 1395
332 Ga0495595_0008241 3300053084 Bacteria 4280
333 Ga0500651_0019389 3300053093 Bacteria 4226
334 Ga0500651_0133507 3300053093 Bacteria 1500
335 Ga0500641_0014864 3300053096 Bacteria 2878
336 Ga0500641_0168575 3300053096 Bacteria 943
337 Ga0500641_0331086 3300053096 Bacteria 617
338 Ga0500556_0253947 3300053104 Bacteria 692
339 Ga0500593_001223 3300053117 Bacteria 9291
340 Ga0500593_008749 3300053117 Bacteria 4171
341 Ga0500595_004526 3300053119 Bacteria 6223
342 Ga0500595_017764 3300053119 Bacteria 2617
343 Ga0500642_0047129 3300053130 Bacteria 1887
344 Ga0500568_0000002 3300053139 Bacteria 880601
345 Ga0500604_0189532 3300053151 Bacteria 706
346 Ga0500622_0301046 3300053156 Bacteria 683
347 Ga0501084_0248604 3300054114 Bacteria 1501
348 Ga0501084_0640618 3300054114 Bacteria 897
349 Ga0501084_0927633 3300054114 Bacteria 732
350 Ga0501084_1299771 3300054114 Bacteria 610
351 Ga0501084_1873984 3300054114 Bacteria 500
352 Ga0590075_117726 3300059424 Bacteria 695
353 Ga0501082_0036920 3300060353 Bacteria 4209
354 Ga0501082_0049324 3300060353 Bacteria 3630
355 Ga0501082_0459759 3300060353 Bacteria 1112
356 Ga0501082_0466837 3300060353 Bacteria 1103
357 Ga0530510_0221243 3300061734 Bacteria 1407
358 Ga0070680_100153911
359 Ga0070658_10395543
360 Ga0070676_11338568
361 Ga0070680_100065287
362 Ga0070660_100144027
363 Ga0070687_101113927
364 Ga0070668_100346437
365 Ga0070688_101031524
366 Ga0070709_10121510
367 Ga0070709_11497533
368 Ga0070714_100364137
369 Ga0070713_100428837
370 Ga0070713_102106155
371 Ga0070710_10447418
372 Ga0070705_100076239
373 Ga0070694_100663399
374 Ga0070708_100583647
375 Ga0070681_10043386
376 Ga0070681_10048667
377 Ga0070679_100216342
378 Ga0070697_100002804
379 Ga0070686_100559418
380 Ga0070695_100001945
381 Ga0070695_100188462
382 Ga0070695_101768717
383 Ga0070696_100012209
384 Ga0070696_100849556
385 Ga0070665_100973487
386 Ga0070665_102261502
387 Ga0070704_100053993
388 Ga0070704_100198237
389 Ga0068855_101460627
390 Ga0081538_10035073
391 Ga0081540_1000068
392 Ga0081539_10060752
393 Ga0070717_10088016
394 Ga0070717_10178537
395 Ga0075365_10002786
396 Ga0075365_10323600
397 Ga0075368_10494205
398 Ga0075364_10020609
399 Ga0070716_101042438
400 Ga0070712_100418076
401 Ga0075362_10023130
402 Ga0075362_10186649
403 Ga0075367_10211405
404 Ga0075366_10390703
405 Ga0075436_100005213
406 Ga0075435_100391715
407 Ga0105243_10155014
408 Ga0105243_11045757
409 Ga0105242_11758912
410 Ga0105249_10006997
411 Ga0157378_10157910
412 Ga0157372_13308871
413 Ga0157379_11482327
414 Ga0163161_10681346
415 Ga0213873_10292353
416 Ga0213874_10088145
417 Ga0213876_10317428
418 Ga0224572_1009661
419 Ga0224572_1011463
420 Ga0228598_1053270
421 Ga0207685_10210361
422 Ga0207699_10103008
423 Ga0207705_10462398
424 Ga0207707_10065647
425 Ga0207707_10169201
426 Ga0207660_10209944
427 Ga0207657_10420746
428 Ga0207652_10032556
429 Ga0207700_10212041
430 Ga0207700_11524667
431 Ga0207664_10567339
432 Ga0207686_11786386
433 Ga0207709_10108039
434 Ga0207665_10686984
435 Ga0207667_11279268
436 Ga0207712_10022270
437 Ga0207683_10895065
438 Ga0209813_10047100
439 Ga0209813_10067719
440 Ga0268264_10583992
441 Ga0265337_1009820
442 Ga0265763_1002551
443 Ga0265760_10005992
444 Ga0265760_10040731
445 Ga0265340_10118676
446 Ga0265340_10430528
447 Ga0307408_100070179
448 Ga0265313_10270844
449 Ga0307406_11818323
450 Ga0307411_12072334
451 Ga0307411_12179108
452 Ga0373928_0133049
453 Ga0373934_0020106
454 Ga0373934_0041466
455 Ga0373923_0080029
456 Ga0373923_0449969
457 Ga0373936_0055386
458 Ga0373941_0011875
459 Ga0373945_0128163
460 Ga0373953_0144228
461 Ga0373954_0007849
462 Ga0373954_0041363
463 Ga0373954_0242779
464 Ga0373956_0005348
465 Ga0373956_0088282
466 Ga0373956_0435185
467 Ga0373957_0034400
468 Ga0373943_0086952
469 Ga0373955_0008083
470 Ga0373924_0039127
471 Ga0373924_0372304
472 Ga0373935_0591301
473 Ga0373933_0001351
474 Ga0373933_0357773
475 Ga0373933_0839827
476 Ga0373947_0571371
477 Ga0373937_0004518
478 Ga0373937_0029710
479 Ga0373937_0792477
480 Ga0373925_0037613
481 Ga0373925_0354702
482 Ga0436364_1168080
483 Ga0436365_0043358
484 Ga0436365_1030822
485 Ga0436365_1745019
486 Ga0436360_0488179
487 Ga0436361_1154916
488 Ga0436363_1671504
489 Ga0436362_0835176
490 Ga0439439_0189852
491 Ga0466966_0418940
492 Ga0466963_0037383
493 Ga0466963_0873600
494 Ga0466971_0530553
495 Ga0466959_1049682
496 Ga0466958_0167552
497 Ga0466967_0231005
498 Ga0495629_0093680
499 Ga0495638_0406222
500 Ga0495651_0146608
501 Ga0495651_0440403
502 Ga0495651_0745304
503 Ga0495608_0050304
504 Ga0495608_0575351
505 Ga0495608_0816544
506 Ga0495628_0240696
507 Ga0495628_0432168
508 Ga0495630_0721725
509 Ga0495630_0832275
510 Ga0495648_0464566
511 Ga0495652_0354098
512 Ga0495652_0805091
513 Ga0495640_0348115
514 Ga0495640_0481830
515 Ga0495587_0166077
516 Ga0495587_0341404
517 Ga0495587_0576558
518 Ga0495667_0148765
519 Ga0495634_0639470
520 Ga0495635_0077498
521 Ga0495635_0125063
522 Ga0495635_0177818
523 Ga0495657_0041194
524 Ga0495623_0079267
525 Ga0495613_0089361
526 Ga0495600_0235773
527 Ga0495600_0360584
528 Ga0495604_0872996
529 Ga0495674_0059455
530 Ga0495674_0627841
531 Ga0495672_0007287
532 Ga0495672_0132333
533 Ga0495683_0236434
534 Ga0495675_0037936
535 Ga0495602_0064297
536 Ga0496100_0997525
537 Ga0496101_0730224
538 Ga0496117_0245782
539 Ga0496118_0345850
540 Ga0496121_0024864
541 Ga0496121_0436029
542 Ga0496126_0179011
543 Ga0495682_0200239
544 Ga0501031_0181326
545 Ga0501032_0021256
546 Ga0501032_0053693
547 Ga0501032_0170713
548 Ga0501033_0016948
549 Ga0501033_0219875
550 Ga0501033_0260856
551 Ga0501034_0014223
552 Ga0501034_0080289
553 Ga0501034_0267708
554 Ga0501034_0306810
555 Ga0501034_0311913
556 Ga0501034_0521078
557 Ga0501034_0730822
558 Ga0501034_1228750
559 Ga0501036_0024915
560 Ga0501036_0043358
561 Ga0501036_0211714
562 Ga0501036_0322081
563 Ga0501036_0899577
564 Ga0501037_0009677
565 Ga0501037_0021839
566 Ga0501037_0023898
567 Ga0501037_0034118
568 Ga0501037_0562611
569 Ga0501038_0083619
570 Ga0501038_0116269
571 Ga0501038_0153447
572 Ga0501038_0325972
573 Ga0501039_0012374
574 Ga0501039_0263934
575 Ga0501039_1168860
576 Ga0501040_0281903
577 Ga0501040_1033731
578 Ga0501041_0108405
579 Ga0501042_0039879
580 Ga0501042_0051282
581 Ga0501043_0001791
582 Ga0501043_0412225
583 Ga0501043_0669720
584 Ga0501046_0069371
585 Ga0501046_0153622
586 Ga0501046_0156464
587 Ga0501046_0651856
588 Ga0501046_0896149
589 Ga0501047_0051814
590 Ga0501047_0133900
591 Ga0501048_0018826
592 Ga0501067_0041609
593 Ga0501067_0059042
594 Ga0501068_0091851
595 Ga0501068_0126712
596 Ga0501068_0349865
597 Ga0501068_0371309
598 Ga0501068_0679710
599 Ga0501068_0795443
600 Ga0501069_0029732
601 Ga0501069_0058802
602 Ga0501069_0068348
603 Ga0501069_0387949
604 Ga0501069_0819432
605 Ga0501070_0075813
606 Ga0501070_0109416
607 Ga0501070_0125475
608 Ga0501070_0568114
609 Ga0501070_0624893
610 Ga0501070_1063041
611 Ga0501071_0168658
612 Ga0501071_0615062
613 Ga0501071_0869283
614 Ga0501071_1290441
615 Ga0501072_0174523
616 Ga0501072_0255026
617 Ga0501072_0296408
618 Ga0501072_0469359
619 Ga0501072_1149677
620 Ga0501073_0005090
621 Ga0501073_0038850
622 Ga0501073_0128849
623 Ga0501073_0551818
624 Ga0501073_0745215
625 Ga0501073_1217348
626 Ga0501074_0035056
627 Ga0501074_0093124
628 Ga0501074_0197148
629 Ga0501074_0556981
630 Ga0501074_0701217
631 Ga0501075_0005049
632 Ga0501075_0271540
633 Ga0501075_0532290
634 Ga0501075_0692801
635 Ga0501076_0009314
636 Ga0501077_0002177
637 Ga0501079_0058877
638 Ga0501079_0104936
639 Ga0501079_0791559
640 Ga0501079_1211951
641 Ga0501079_1223826
642 Ga0501080_0012989
643 Ga0501080_0107108
644 Ga0501080_0151329
645 Ga0501080_0170788
646 Ga0501080_0482880
647 Ga0501080_0661676
648 Ga0501080_0745169
649 Ga0501080_0840287
650 Ga0501080_0979306
651 Ga0501081_0037000
652 Ga0501081_0133260
653 Ga0501081_0228335
654 Ga0501081_0801311
655 Ga0501083_0136146
656 Ga0501083_0672241
657 Ga0501083_0776146
658 Ga0501083_1050897
659 Ga0501035_0002286
660 Ga0501035_0007147
661 Ga0501035_0050687
662 Ga0501035_0414772
663 Ga0501035_0633263
664 Ga0501044_0039324
665 Ga0501044_0101856
666 Ga0501044_0272696
667 Ga0501044_0564017
668 Ga0501044_0609183
669 Ga0501044_1073991
670 Ga0501045_0284568
671 Ga0501045_0354878
672 Ga0501045_0366554
673 nmdc:mga03683_19526_c1
674 nmdc:mga03n38_217414_c1
675 nmdc:mga00v17_431940_c1
676 nmdc:mga00v17_6540_c1
677 nmdc:mga0yw44_139243_c1
678 nmdc:mga0yw44_14557_c1
679 nmdc:mga0k408_436507_c1
680 nmdc:mga06z11_20716_c1
681 nmdc:mga04h51_127080_c1
682 nmdc:mga04h51_7388_c1
683 nmdc:mga04h51_80924_c1
684 nmdc:mga0rr50_1371355_c1
685 nmdc:mga08x19_23_c1
686 Ga0495601_0169702
687 Ga0495601_0267484
688 Ga0495612_0077288
689 Ga0495595_0008241
690 Ga0500651_0019389
691 Ga0500651_0133507
692 Ga0500641_0014864
693 Ga0500641_0168575
694 Ga0500641_0331086
695 Ga0500556_0253947
696 Ga0500593_001223
697 Ga0500593_008749
698 Ga0500595_004526
699 Ga0500595_017764
700 Ga0500642_0047129
701 Ga0500568_0000002
702 Ga0500604_0189532
703 Ga0500622_0301046
704 Ga0501084_0248604
705 Ga0501084_0640618
706 Ga0501084_0927633
707 Ga0501084_1299771
708 Ga0501084_1873984
709 Ga0590075_117726
710 Ga0501082_0036920
711 Ga0501082_0049324
712 Ga0501082_0459759
713 Ga0501082_0466837
714 Ga0530510_0221243

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02049

FliE

Flagellar hook-basal body complex protein FliE

23

112

0.93

Map