F420704

General Info

Members Datasets Scaffolds Average Seq Length
357 175 714 394

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10048679|rootH2_100486792
Length 397
Sequence MKAVCWMGKENMQVHNVPDPTILNPRDAIIRITSTCICGSDLHLYNGFVPTMEQGDIMGHEFMGEVVEVGPGVSRDKLKVGDRVVVPFTIACGNCLFCKKDLWSLCDNSNPNARVAEKMMGYSPSGLFGYTHMLGGYAGGQAQYARVPFADVGPIKIPDGLPDEKVVFLSDIFPTGYMGAENCNIRPGDTVAVWGCGPVGQFAIRSCFMLGAGRVIAIDRVPERLEMARAAGAEALNFDEVDILEALREMTGNQGPDACMDVVGMEASGHGIVFAMDRAKQILHTQMDRPIVLRQAIIACKKGGTVSVPGVYASFIDKVPMGAYVNKGLTMKTGQTHMMRYMQPLLERIQRGDIDPSFVISHVLPIDQAPHAYKTFRDKQDRCTKVVLKPWESAAAA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
68 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
137 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
174 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
175 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.32
Metatranscriptomes 8.12
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 3.36
Rhizosphere 92.72
Stem 0
Stem Tuber 0
Unclassified 3.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10048679 3300003320 Bacteria 2669
2 Ga0058861_11846612 3300004800 Bacteria 1879
3 Ga0070658_10000188 3300005327 Bacteria 54572
4 Ga0070658_10022297 3300005327 Bacteria 5082
5 Ga0070683_100052864 3300005329 Bacteria 3764
6 Ga0070683_100060253 3300005329 Bacteria 3527
7 Ga0070670_100011052 3300005331 Bacteria 7712
8 Ga0070670_100110351 3300005331 Bacteria 2370
9 Ga0070680_100135032 3300005336 Bacteria 2066
10 Ga0068868_100006680 3300005338 Bacteria 8183
11 Ga0070687_100049579 3300005343 Bacteria 2164
12 Ga0070661_100020995 3300005344 Bacteria 4662
13 Ga0070661_100037241 3300005344 Bacteria 3538
14 Ga0070675_100070914 3300005354 Bacteria 2889
15 Ga0070671_100015224 3300005355 Bacteria 6211
16 Ga0070671_100212139 3300005355 Bacteria 1642
17 Ga0070673_100003614 3300005364 Bacteria 9674
18 Ga0070659_100005600 3300005366 Bacteria 9028
19 Ga0070714_100007572 3300005435 Bacteria 8456
20 Ga0070714_100053948 3300005435 Bacteria 3433
21 Ga0070714_100056852 3300005435 Bacteria 3347
22 Ga0070713_100001539 3300005436 Bacteria 14725
23 Ga0070713_100136552 3300005436 Bacteria 2168
24 Ga0070663_100019335 3300005455 Bacteria 4486
25 Ga0070678_100081958 3300005456 Bacteria 2447
26 Ga0070662_100077342 3300005457 Bacteria 2469
27 Ga0070681_10000026 3300005458 Bacteria 107615
28 Ga0070681_10013667 3300005458 Bacteria 8080
29 Ga0068867_100025157 3300005459 Unclassified 4270
30 Ga0068867_100113235 3300005459 Bacteria 2087
31 Ga0070679_100014197 3300005530 Bacteria 7644
32 Ga0070679_100079505 3300005530 Bacteria 3268
33 Ga0070684_100003393 3300005535 Bacteria 11950
34 Ga0070684_100013112 3300005535 Bacteria 6672
35 Ga0068853_100017958 3300005539 Bacteria 5846
36 Ga0068853_100061125 3300005539 Bacteria 3258
37 Ga0068853_100101458 3300005539 Bacteria 2545
38 Ga0068853_100171030 3300005539 Bacteria 1965
39 Ga0070672_100013128 3300005543 Bacteria 5838
40 Ga0070665_100020187 3300005548 Bacteria 6689
41 Ga0070665_100150536 3300005548 Bacteria 2330
42 Ga0068855_100000295 3300005563 Bacteria 61909
43 Ga0068855_100001199 3300005563 Bacteria 32207
44 Ga0068855_100007039 3300005563 Bacteria 13644
45 Ga0068855_100018648 3300005563 Bacteria 8344
46 Ga0068855_100020709 3300005563 Bacteria 7887
47 Ga0068855_100035104 3300005563 Bacteria 5973
48 Ga0068855_100382440 3300005563 Bacteria 1545
49 Ga0068855_100499640 3300005563 Bacteria 1322
50 Ga0070664_100003800 3300005564 Bacteria 12190
51 Ga0070664_100060287 3300005564 Bacteria 3230
52 Ga0070664_100109982 3300005564 Bacteria 2404
53 Ga0068857_100000484 3300005577 Bacteria 28421
54 Ga0068857_100001776 3300005577 Bacteria 17343
55 Ga0068856_100000574 3300005614 Bacteria 40092
56 Ga0068856_100001552 3300005614 Bacteria 24044
57 Ga0068856_100002096 3300005614 Bacteria 20678
58 Ga0068856_100002636 3300005614 Bacteria 18418
59 Ga0068856_100008996 3300005614 Bacteria 9717
60 Ga0068856_100013849 3300005614 Bacteria 7798
61 Ga0068856_100294795 3300005614 Bacteria 1639
62 Ga0068852_100000038 3300005616 Bacteria 96977
63 Ga0068852_100001297 3300005616 Bacteria 16714
64 Ga0068852_100039975 3300005616 Bacteria 3953
65 Ga0068852_100079936 3300005616 Bacteria 2897
66 Ga0068859_100001753 3300005617 Bacteria 22082
67 Ga0068859_100007803 3300005617 Bacteria 10863
68 Ga0068859_100246258 3300005617 Bacteria 1877
69 Ga0068851_10041053 3300005834 Bacteria 2326
70 Ga0068870_10058640 3300005840 Bacteria 2061
71 Ga0068863_100091052 3300005841 Plasmid 2892
72 Ga0068863_100110647 3300005841 Bacteria 2616
73 Ga0068858_100002129 3300005842 Bacteria 20065
74 Ga0068858_100015838 3300005842 Bacteria 7087
75 Ga0068858_100036206 3300005842 Bacteria 4576
76 Ga0068860_100004061 3300005843 Bacteria 15025
77 Ga0068862_100160475 3300005844 Unclassified 2006
78 Ga0070717_10000274 3300006028 Bacteria 35206
79 Ga0070717_10000303 3300006028 Bacteria 32465
80 Ga0070712_100028885 3300006175 Bacteria 3713
81 Ga0097621_100000659 3300006237 Bacteria 24318
82 Ga0097621_100003520 3300006237 Bacteria 10817
83 Ga0097621_100023911 3300006237 Bacteria 4763
84 Ga0068871_100000288 3300006358 Bacteria 35115
85 Ga0068871_100000643 3300006358 Bacteria 24041
86 Ga0068871_100029093 3300006358 Bacteria 4338
87 Ga0068871_100069426 3300006358 Bacteria 2894
88 Ga0068871_100107467 3300006358 Bacteria 2343
89 Ga0068871_100241565 3300006358 Unclassified 1570
90 Ga0075433_10002628 3300006852 Bacteria 13712
91 Ga0075434_100005998 3300006871 Bacteria 11117
92 Ga0075434_100006002 3300006871 Bacteria 11115
93 Ga0068865_100001633 3300006881 Bacteria 13133
94 Ga0075436_100035185 3300006914 Bacteria 3455
95 Ga0097620_100001753 3300006931 Bacteria 22082
96 Ga0097620_100007803 3300006931 Bacteria 10863
97 Ga0097620_100246242 3300006931 Bacteria 1877
98 Ga0105240_10000584 3300009093 Bacteria 67629
99 Ga0105240_10000965 3300009093 Bacteria 51267
100 Ga0105240_10003382 3300009093 Bacteria 24803
101 Ga0105240_10005915 3300009093 Bacteria 18119
102 Ga0105240_10046029 3300009093 Bacteria 5530
103 Ga0105240_10051314 3300009093 Bacteria 5192
104 Ga0105245_10011973 3300009098 Bacteria 7542
105 Ga0105245_10019705 3300009098 Bacteria 5912
106 Ga0114129_10065825 3300009147 Bacteria 5057
107 Ga0105243_10139585 3300009148 Unclassified 2066
108 Ga0105241_10000082 3300009174 Bacteria 70717
109 Ga0105241_10016442 3300009174 Bacteria 5427
110 Ga0105241_10039609 3300009174 Bacteria 3555
111 Ga0105241_10125343 3300009174 Bacteria 2073
112 Ga0105248_10000541 3300009177 Bacteria 43101
113 Ga0105248_10003676 3300009177 Bacteria 16990
114 Ga0105237_10012632 3300009545 Bacteria 8893
115 Ga0105237_10022677 3300009545 Bacteria 6441
116 Ga0105237_10118138 3300009545 Bacteria 2646
117 Ga0105237_10308607 3300009545 Bacteria 1585
118 Ga0105238_10000188 3300009551 Bacteria 68217
119 Ga0105238_10002656 3300009551 Bacteria 17789
120 Ga0105238_10071452 3300009551 Bacteria 3468
121 Ga0105239_10000929 3300010375 Bacteria 41487
122 Ga0105239_10025885 3300010375 Bacteria 6462
123 Ga0105239_10259187 3300010375 Bacteria 1954
124 Ga0157370_10000102 3300013104 Bacteria 97420
125 Ga0157370_10078705 3300013104 Bacteria 3104
126 Ga0157369_10000124 3300013105 Bacteria 110693
127 Ga0157369_10000154 3300013105 Bacteria 97000
128 Ga0157369_10002804 3300013105 Bacteria 20805
129 Ga0157369_10008241 3300013105 Bacteria 11947
130 Ga0157369_10048192 3300013105 Bacteria 4623
131 Ga0157369_10119378 3300013105 Bacteria 2798
132 Ga0157369_10154179 3300013105 Bacteria 2427
133 Ga0157374_10000705 3300013296 Bacteria 29341
134 Ga0157374_10000800 3300013296 Bacteria 27563
135 Ga0157374_10001859 3300013296 Bacteria 17773
136 Ga0157374_10002029 3300013296 Bacteria 17000
137 Ga0157374_10007183 3300013296 Bacteria 9487
138 Ga0157374_10033537 3300013296 Bacteria 4684
139 Ga0157374_10167086 3300013296 Bacteria 2145
140 Ga0157378_10000020 3300013297 Bacteria 131245
141 Ga0157378_10000684 3300013297 Bacteria 31879
142 Ga0157378_10001169 3300013297 Bacteria 23875
143 Ga0157378_10015987 3300013297 Bacteria 6573
144 Ga0157378_10019938 3300013297 Bacteria 5897
145 Ga0157378_10036069 3300013297 Bacteria 4376
146 Ga0163162_10005291 3300013306 Bacteria 12454
147 Ga0157372_10000082 3300013307 Bacteria 99224
148 Ga0157372_10000084 3300013307 Bacteria 98431
149 Ga0157372_10000328 3300013307 Bacteria 51987
150 Ga0157372_10000579 3300013307 Bacteria 39972
151 Ga0157372_10001691 3300013307 Bacteria 23865
152 Ga0157372_10004929 3300013307 Bacteria 14176
153 Ga0157372_10065463 3300013307 Bacteria 4081
154 Ga0157372_10067467 3300013307 Bacteria 4020
155 Ga0157372_10090433 3300013307 Bacteria 3480
156 Ga0157372_10093715 3300013307 Bacteria 3418
157 Ga0157375_10000152 3300013308 Bacteria 67342
158 Ga0157375_10038332 3300013308 Bacteria 4602
159 Ga0157375_10041801 3300013308 Bacteria 4430
160 Ga0157379_10046728 3300014968 Plasmid 3862
161 Ga0157376_10060283 3300014969 Bacteria 3186
162 Ga0182007_10002438 3300015262 Bacteria 9267
163 Ga0197907_10012546 3300020069 Unclassified 3642
164 Ga0206355_1077991 3300020076 Bacteria 2261
165 Ga0206351_10788492 3300020077 Bacteria 1240
166 Ga0206352_10221190 3300020078 Bacteria 1759
167 Ga0206352_10718697 3300020078 Unclassified 1971
168 Ga0206352_11311730 3300020078 Bacteria 3324
169 Ga0206350_10136907 3300020080 Unclassified 3924
170 Ga0206350_10961905 3300020080 Bacteria 2110
171 Ga0206350_10993266 3300020080 Bacteria 3114
172 Ga0206350_11018379 3300020080 Unclassified 2831
173 Ga0206350_11324039 3300020080 Bacteria 2005
174 Ga0206350_11335682 3300020080 Bacteria 2708
175 Ga0206354_11505100 3300020081 Bacteria 1373
176 Ga0213872_10040345 3300021361 Bacteria 2132
177 Ga0213876_10005750 3300021384 Bacteria 6794
178 Ga0213875_10000553 3300021388 Bacteria 30588
179 Ga0224712_10003934 3300022467 Bacteria 3941
180 Ga0224712_10009074 3300022467 Bacteria 2980
181 Ga0224712_10010433 3300022467 Bacteria 2842
182 Ga0224712_10013686 3300022467 Bacteria 2591
183 Ga0224712_10014075 3300022467 Bacteria 2565
184 Ga0224712_10014437 3300022467 Bacteria 2544
185 Ga0224712_10020162 3300022467 Bacteria 2258
186 Ga0224712_10024679 3300022467 Bacteria 2104
187 Ga0224712_10025901 3300022467 Bacteria 2067
188 Ga0207656_10092607 3300025321 Bacteria 1374
189 Ga0207647_10014912 3300025904 Bacteria 5341
190 Ga0207647_10029395 3300025904 Plasmid 3558
191 Ga0207705_10001131 3300025909 Bacteria 21691
192 Ga0207654_10000021 3300025911 Bacteria 165620
193 Ga0207654_10003685 3300025911 Bacteria 7724
194 Ga0207654_10151365 3300025911 Bacteria 1489
195 Ga0207707_10002382 3300025912 Bacteria 16945
196 Ga0207707_10045224 3300025912 Bacteria 3837
197 Ga0207695_10000035 3300025913 Bacteria 486590
198 Ga0207695_10000140 3300025913 Bacteria 216271
199 Ga0207695_10004432 3300025913 Bacteria 19160
200 Ga0207695_10006754 3300025913 Bacteria 14799
201 Ga0207695_10010658 3300025913 Bacteria 11228
202 Ga0207695_10072353 3300025913 Bacteria 3518
203 Ga0207671_10191481 3300025914 Bacteria 1595
204 Ga0207671_10198980 3300025914 Bacteria 1564
205 Ga0207693_10036472 3300025915 Bacteria 3876
206 Ga0207660_10031248 3300025917 Bacteria 3665
207 Ga0207662_10065244 3300025918 Bacteria 2192
208 Ga0207657_10004768 3300025919 Bacteria 14304
209 Ga0207657_10147578 3300025919 Bacteria 1917
210 Ga0207649_10075243 3300025920 Bacteria 2169
211 Ga0207652_10025054 3300025921 Bacteria 4957
212 Ga0207652_10030958 3300025921 Bacteria 4488
213 Ga0207652_10104818 3300025921 Bacteria 2501
214 Ga0207694_10003741 3300025924 Bacteria 12056
215 Ga0207694_10016512 3300025924 Bacteria 5576
216 Ga0207694_10122941 3300025924 Bacteria 2073
217 Ga0207650_10017242 3300025925 Bacteria 5054
218 Ga0207650_10083316 3300025925 Bacteria 2429
219 Ga0207659_10089207 3300025926 Bacteria 2299
220 Ga0207687_10015996 3300025927 Bacteria 4922
221 Ga0207687_10170288 3300025927 Bacteria 1679
222 Ga0207700_10004552 3300025928 Bacteria 8195
223 Ga0207700_10082206 3300025928 Bacteria 2518
224 Ga0207700_10105091 3300025928 Bacteria 2261
225 Ga0207664_10025750 3300025929 Bacteria 4436
226 Ga0207664_10038933 3300025929 Bacteria 3688
227 Ga0207664_10047702 3300025929 Bacteria 3366
228 Ga0207664_10099937 3300025929 Bacteria 2395
229 Ga0207664_10123163 3300025929 Unclassified 2173
230 Ga0207644_10010579 3300025931 Bacteria 6082
231 Ga0207644_10170525 3300025931 Bacteria 1698
232 Ga0207644_10223289 3300025931 Bacteria 1494
233 Ga0207690_10005337 3300025932 Bacteria 7572
234 Ga0207706_10195088 3300025933 Bacteria 1776
235 Ga0207669_10074500 3300025937 Bacteria 2147
236 Ga0207704_10115011 3300025938 Unclassified 1827
237 Ga0207691_10006512 3300025940 Bacteria 11271
238 Ga0207711_10002011 3300025941 Bacteria 18396
239 Ga0207689_10002987 3300025942 Bacteria 15605
240 Ga0207689_10224300 3300025942 Bacteria 1553
241 Ga0207661_10123097 3300025944 Bacteria 2211
242 Ga0207679_10001183 3300025945 Bacteria 16595
243 Ga0207679_10037089 3300025945 Bacteria 3463
244 Ga0207679_10066716 3300025945 Bacteria 2697
245 Ga0207679_10148268 3300025945 Bacteria 1906
246 Ga0207679_10150028 3300025945 Bacteria 1896
247 Ga0207667_10000213 3300025949 Bacteria 81973
248 Ga0207667_10000959 3300025949 Bacteria 36774
249 Ga0207667_10002058 3300025949 Bacteria 25222
250 Ga0207667_10024198 3300025949 Bacteria 6673
251 Ga0207667_10033733 3300025949 Bacteria 5501
252 Ga0207667_10110060 3300025949 Bacteria 2842
253 Ga0207667_10129885 3300025949 Bacteria 2595
254 Ga0207651_10092153 3300025960 Bacteria 2221
255 Ga0207640_10141776 3300025981 Bacteria 1753
256 Ga0207677_10014971 3300026023 Plasmid 4545
257 Ga0207677_10017422 3300026023 Bacteria 4282
258 Ga0207677_10046940 3300026023 Bacteria 2896
259 Ga0207703_10003114 3300026035 Bacteria 14007
260 Ga0207703_10017729 3300026035 Bacteria 5559
261 Ga0207703_10027195 3300026035 Bacteria 4505
262 Ga0207639_10104736 3300026041 Bacteria 2294
263 Ga0207639_10262829 3300026041 Bacteria 1510
264 Ga0207678_10009199 3300026067 Bacteria 8697
265 Ga0207702_10000114 3300026078 Bacteria 93951
266 Ga0207702_10001223 3300026078 Bacteria 25973
267 Ga0207702_10003909 3300026078 Bacteria 13411
268 Ga0207702_10007411 3300026078 Bacteria 9366
269 Ga0207702_10220434 3300026078 Bacteria 1767
270 Ga0207702_10289621 3300026078 Bacteria 1551
271 Ga0207641_10041828 3300026088 Plasmid 3842
272 Ga0207641_10092677 3300026088 Bacteria 2646
273 Ga0207648_10008217 3300026089 Bacteria 10132
274 Ga0207648_10193070 3300026089 Bacteria 1805
275 Ga0207674_10000668 3300026116 Bacteria 44621
276 Ga0207674_10001882 3300026116 Bacteria 26733
277 Ga0207674_10055651 3300026116 Bacteria 4021
278 Ga0207683_10111661 3300026121 Bacteria 2448
279 Ga0207698_10000032 3300026142 Bacteria 112742
280 Ga0207698_10007237 3300026142 Bacteria 6955
281 Ga0207698_10007297 3300026142 Bacteria 6926
282 Ga0207698_10236241 3300026142 Bacteria 1663
283 Ga0268266_10026822 3300028379 Unclassified 4902
284 Ga0268265_10079328 3300028380 Unclassified 2585
285 Ga0268264_10007384 3300028381 Bacteria 9181
286 Ga0307513_10006102 3300031456 Bacteria 15816
287 Ga0307408_100214419 3300031548 Bacteria 1567
288 Ga0307410_10000735 3300031852 Bacteria 13712
289 Ga0307410_10083318 3300031852 Bacteria 2252
290 Ga0307414_10189709 3300032004 Bacteria 1662
291 Ga0373933_0014444 3300035724 Bacteria 4394
292 Ga0373937_0022585 3300036401 Bacteria 5659
293 Ga0373937_0155707 3300036401 Bacteria 2142
294 Ga0373937_0184620 3300036401 Bacteria 1959
295 Ga0395900_0290214 3300037418 Bacteria 1625
296 Ga0395898_0101288 3300037466 Bacteria 2766
297 Ga0395905_0000696 3300037471 Bacteria 44549
298 Ga0436364_0265928 3300037853 Bacteria 82453
299 Ga0436364_0379917 3300037853 Bacteria 167058
300 Ga0436364_0795225 3300037853 Bacteria 5678
301 Ga0395901_0138622 3300038443 Bacteria 2557
302 Ga0436365_0581182 3300039437 Bacteria 1691
303 Ga0436365_0749147 3300039437 Bacteria 1784
304 Ga0436365_1557356 3300039437 Bacteria 15027
305 Ga0436360_0042210 3300039438 Bacteria 2113
306 Ga0436360_1222869 3300039438 Bacteria 2329
307 Ga0436363_0212868 3300039450 Unclassified 2882
308 Ga0436362_0899458 3300039453 Bacteria 1059
309 Ga0439432_019439 3300042006 Bacteria 2262
310 Ga0439449_0040872 3300042007 Bacteria 1724
311 Ga0466963_0029980 3300044694 Bacteria 3506
312 Ga0466967_0009794 3300045976 Bacteria 7146
313 Ga0495583_0001177 3300046506 Bacteria 28254
314 Ga0495608_0107828 3300046511 Bacteria 1792
315 Ga0495620_0012499 3300046515 Bacteria 4380
316 Ga0495642_0063147 3300046528 Bacteria 1539
317 Ga0495588_0105866 3300046674 Bacteria 1480
318 Ga0495672_0006717 3300047320 Bacteria 8831
319 Ga0496100_0100917 3300048903 Bacteria 1989
320 Ga0496101_0055865 3300048904 Bacteria 2853
321 Ga0496102_0171401 3300048905 Bacteria 2043
322 Ga0496104_0108454 3300048907 Bacteria 2661
323 Ga0496104_0167379 3300048907 Bacteria 2108
324 Ga0496104_0186099 3300048907 Bacteria 1987
325 Ga0496104_0267755 3300048907 Bacteria 1621
326 Ga0496105_0175805 3300048908 Bacteria 1754
327 Ga0496110_0024480 3300048913 Bacteria 5145
328 Ga0496110_0065325 3300048913 Bacteria 3216
329 Ga0496111_0047273 3300048914 Bacteria 3099
330 Ga0496112_0006441 3300048915 Bacteria 10307
331 Ga0501039_0157103 3300049575 Bacteria 1787
332 Ga0501042_0059321 3300049578 Bacteria 2732
333 Ga0501071_0009788 3300049587 Bacteria 6398
334 Ga0501072_0049950 3300049588 Bacteria 3293
335 Ga0501075_0063086 3300049591 Bacteria 2794
336 Ga0501076_0031510 3300049592 Bacteria 4135
337 Ga0501045_0079164 3300049824 Bacteria 2423
338 Ga0501045_0134425 3300049824 Bacteria 1839
339 nmdc:mga05p37_119152_c1 3300050507 Bacteria 3243
340 nmdc:mga0n895_33619_c1 3300050512 Bacteria 4930
341 nmdc:mga0n895_8348_c1 3300050512 Bacteria 8963
342 nmdc:mga0rr50_57314_c1 3300050513 Bacteria 2914
343 nmdc:mga08x19_65578_c1 3300050514 Bacteria 2358
344 nmdc:mga0a205_102984_c1 3300050515 Bacteria 2753
345 nmdc:mga0a205_2523_c1 3300050515 Bacteria 16124
346 Ga0500641_0000983 3300053096 Bacteria 10127
347 Ga0501084_0010309 3300054114 Bacteria 7730
348 Ga0587073_0003902 3300059492 Bacteria 2092
349 Ga0587073_0011322 3300059492 Bacteria 1520
350 Ga0587082_001786 3300059504 Bacteria 2310
351 Ga0587088_010048 3300059508 Bacteria 1378
352 Ga0587079_009069 3300059647 Bacteria 1538
353 Ga0587114_000906 3300059655 Bacteria 2255
354 Ga0530510_0130218 3300061734 Bacteria 1850
355 Ga0530510_0183846 3300061734 Bacteria 1550
356 2913850872 2913844669 Bacteria 8381711
357 642605151 642555144 Bacteria 9059191
358 rootH2_10048679
359 Ga0058861_11846612
360 Ga0070658_10000188
361 Ga0070658_10022297
362 Ga0070683_100052864
363 Ga0070683_100060253
364 Ga0070670_100011052
365 Ga0070670_100110351
366 Ga0070680_100135032
367 Ga0068868_100006680
368 Ga0070687_100049579
369 Ga0070661_100020995
370 Ga0070661_100037241
371 Ga0070675_100070914
372 Ga0070671_100015224
373 Ga0070671_100212139
374 Ga0070673_100003614
375 Ga0070659_100005600
376 Ga0070714_100007572
377 Ga0070714_100053948
378 Ga0070714_100056852
379 Ga0070713_100001539
380 Ga0070713_100136552
381 Ga0070663_100019335
382 Ga0070678_100081958
383 Ga0070662_100077342
384 Ga0070681_10000026
385 Ga0070681_10013667
386 Ga0068867_100025157
387 Ga0068867_100113235
388 Ga0070679_100014197
389 Ga0070679_100079505
390 Ga0070684_100003393
391 Ga0070684_100013112
392 Ga0068853_100017958
393 Ga0068853_100061125
394 Ga0068853_100101458
395 Ga0068853_100171030
396 Ga0070672_100013128
397 Ga0070665_100020187
398 Ga0070665_100150536
399 Ga0068855_100000295
400 Ga0068855_100001199
401 Ga0068855_100007039
402 Ga0068855_100018648
403 Ga0068855_100020709
404 Ga0068855_100035104
405 Ga0068855_100382440
406 Ga0068855_100499640
407 Ga0070664_100003800
408 Ga0070664_100060287
409 Ga0070664_100109982
410 Ga0068857_100000484
411 Ga0068857_100001776
412 Ga0068856_100000574
413 Ga0068856_100001552
414 Ga0068856_100002096
415 Ga0068856_100002636
416 Ga0068856_100008996
417 Ga0068856_100013849
418 Ga0068856_100294795
419 Ga0068852_100000038
420 Ga0068852_100001297
421 Ga0068852_100039975
422 Ga0068852_100079936
423 Ga0068859_100001753
424 Ga0068859_100007803
425 Ga0068859_100246258
426 Ga0068851_10041053
427 Ga0068870_10058640
428 Ga0068863_100091052
429 Ga0068863_100110647
430 Ga0068858_100002129
431 Ga0068858_100015838
432 Ga0068858_100036206
433 Ga0068860_100004061
434 Ga0068862_100160475
435 Ga0070717_10000274
436 Ga0070717_10000303
437 Ga0070712_100028885
438 Ga0097621_100000659
439 Ga0097621_100003520
440 Ga0097621_100023911
441 Ga0068871_100000288
442 Ga0068871_100000643
443 Ga0068871_100029093
444 Ga0068871_100069426
445 Ga0068871_100107467
446 Ga0068871_100241565
447 Ga0075433_10002628
448 Ga0075434_100005998
449 Ga0075434_100006002
450 Ga0068865_100001633
451 Ga0075436_100035185
452 Ga0097620_100001753
453 Ga0097620_100007803
454 Ga0097620_100246242
455 Ga0105240_10000584
456 Ga0105240_10000965
457 Ga0105240_10003382
458 Ga0105240_10005915
459 Ga0105240_10046029
460 Ga0105240_10051314
461 Ga0105245_10011973
462 Ga0105245_10019705
463 Ga0114129_10065825
464 Ga0105243_10139585
465 Ga0105241_10000082
466 Ga0105241_10016442
467 Ga0105241_10039609
468 Ga0105241_10125343
469 Ga0105248_10000541
470 Ga0105248_10003676
471 Ga0105237_10012632
472 Ga0105237_10022677
473 Ga0105237_10118138
474 Ga0105237_10308607
475 Ga0105238_10000188
476 Ga0105238_10002656
477 Ga0105238_10071452
478 Ga0105239_10000929
479 Ga0105239_10025885
480 Ga0105239_10259187
481 Ga0157370_10000102
482 Ga0157370_10078705
483 Ga0157369_10000124
484 Ga0157369_10000154
485 Ga0157369_10002804
486 Ga0157369_10008241
487 Ga0157369_10048192
488 Ga0157369_10119378
489 Ga0157369_10154179
490 Ga0157374_10000705
491 Ga0157374_10000800
492 Ga0157374_10001859
493 Ga0157374_10002029
494 Ga0157374_10007183
495 Ga0157374_10033537
496 Ga0157374_10167086
497 Ga0157378_10000020
498 Ga0157378_10000684
499 Ga0157378_10001169
500 Ga0157378_10015987
501 Ga0157378_10019938
502 Ga0157378_10036069
503 Ga0163162_10005291
504 Ga0157372_10000082
505 Ga0157372_10000084
506 Ga0157372_10000328
507 Ga0157372_10000579
508 Ga0157372_10001691
509 Ga0157372_10004929
510 Ga0157372_10065463
511 Ga0157372_10067467
512 Ga0157372_10090433
513 Ga0157372_10093715
514 Ga0157375_10000152
515 Ga0157375_10038332
516 Ga0157375_10041801
517 Ga0157379_10046728
518 Ga0157376_10060283
519 Ga0182007_10002438
520 Ga0197907_10012546
521 Ga0206355_1077991
522 Ga0206351_10788492
523 Ga0206352_10221190
524 Ga0206352_10718697
525 Ga0206352_11311730
526 Ga0206350_10136907
527 Ga0206350_10961905
528 Ga0206350_10993266
529 Ga0206350_11018379
530 Ga0206350_11324039
531 Ga0206350_11335682
532 Ga0206354_11505100
533 Ga0213872_10040345
534 Ga0213876_10005750
535 Ga0213875_10000553
536 Ga0224712_10003934
537 Ga0224712_10009074
538 Ga0224712_10010433
539 Ga0224712_10013686
540 Ga0224712_10014075
541 Ga0224712_10014437
542 Ga0224712_10020162
543 Ga0224712_10024679
544 Ga0224712_10025901
545 Ga0207656_10092607
546 Ga0207647_10014912
547 Ga0207647_10029395
548 Ga0207705_10001131
549 Ga0207654_10000021
550 Ga0207654_10003685
551 Ga0207654_10151365
552 Ga0207707_10002382
553 Ga0207707_10045224
554 Ga0207695_10000035
555 Ga0207695_10000140
556 Ga0207695_10004432
557 Ga0207695_10006754
558 Ga0207695_10010658
559 Ga0207695_10072353
560 Ga0207671_10191481
561 Ga0207671_10198980
562 Ga0207693_10036472
563 Ga0207660_10031248
564 Ga0207662_10065244
565 Ga0207657_10004768
566 Ga0207657_10147578
567 Ga0207649_10075243
568 Ga0207652_10025054
569 Ga0207652_10030958
570 Ga0207652_10104818
571 Ga0207694_10003741
572 Ga0207694_10016512
573 Ga0207694_10122941
574 Ga0207650_10017242
575 Ga0207650_10083316
576 Ga0207659_10089207
577 Ga0207687_10015996
578 Ga0207687_10170288
579 Ga0207700_10004552
580 Ga0207700_10082206
581 Ga0207700_10105091
582 Ga0207664_10025750
583 Ga0207664_10038933
584 Ga0207664_10047702
585 Ga0207664_10099937
586 Ga0207664_10123163
587 Ga0207644_10010579
588 Ga0207644_10170525
589 Ga0207644_10223289
590 Ga0207690_10005337
591 Ga0207706_10195088
592 Ga0207669_10074500
593 Ga0207704_10115011
594 Ga0207691_10006512
595 Ga0207711_10002011
596 Ga0207689_10002987
597 Ga0207689_10224300
598 Ga0207661_10123097
599 Ga0207679_10001183
600 Ga0207679_10037089
601 Ga0207679_10066716
602 Ga0207679_10148268
603 Ga0207679_10150028
604 Ga0207667_10000213
605 Ga0207667_10000959
606 Ga0207667_10002058
607 Ga0207667_10024198
608 Ga0207667_10033733
609 Ga0207667_10110060
610 Ga0207667_10129885
611 Ga0207651_10092153
612 Ga0207640_10141776
613 Ga0207677_10014971
614 Ga0207677_10017422
615 Ga0207677_10046940
616 Ga0207703_10003114
617 Ga0207703_10017729
618 Ga0207703_10027195
619 Ga0207639_10104736
620 Ga0207639_10262829
621 Ga0207678_10009199
622 Ga0207702_10000114
623 Ga0207702_10001223
624 Ga0207702_10003909
625 Ga0207702_10007411
626 Ga0207702_10220434
627 Ga0207702_10289621
628 Ga0207641_10041828
629 Ga0207641_10092677
630 Ga0207648_10008217
631 Ga0207648_10193070
632 Ga0207674_10000668
633 Ga0207674_10001882
634 Ga0207674_10055651
635 Ga0207683_10111661
636 Ga0207698_10000032
637 Ga0207698_10007237
638 Ga0207698_10007297
639 Ga0207698_10236241
640 Ga0268266_10026822
641 Ga0268265_10079328
642 Ga0268264_10007384
643 Ga0307513_10006102
644 Ga0307408_100214419
645 Ga0307410_10000735
646 Ga0307410_10083318
647 Ga0307414_10189709
648 Ga0373933_0014444
649 Ga0373937_0022585
650 Ga0373937_0155707
651 Ga0373937_0184620
652 Ga0395900_0290214
653 Ga0395898_0101288
654 Ga0395905_0000696
655 Ga0436364_0265928
656 Ga0436364_0379917
657 Ga0436364_0795225
658 Ga0395901_0138622
659 Ga0436365_0581182
660 Ga0436365_0749147
661 Ga0436365_1557356
662 Ga0436360_0042210
663 Ga0436360_1222869
664 Ga0436363_0212868
665 Ga0436362_0899458
666 Ga0439432_019439
667 Ga0439449_0040872
668 Ga0466963_0029980
669 Ga0466967_0009794
670 Ga0495583_0001177
671 Ga0495608_0107828
672 Ga0495620_0012499
673 Ga0495642_0063147
674 Ga0495588_0105866
675 Ga0495672_0006717
676 Ga0496100_0100917
677 Ga0496101_0055865
678 Ga0496102_0171401
679 Ga0496104_0108454
680 Ga0496104_0167379
681 Ga0496104_0186099
682 Ga0496104_0267755
683 Ga0496105_0175805
684 Ga0496110_0024480
685 Ga0496110_0065325
686 Ga0496111_0047273
687 Ga0496112_0006441
688 Ga0501039_0157103
689 Ga0501042_0059321
690 Ga0501071_0009788
691 Ga0501072_0049950
692 Ga0501075_0063086
693 Ga0501076_0031510
694 Ga0501045_0079164
695 Ga0501045_0134425
696 nmdc:mga05p37_119152_c1
697 nmdc:mga0n895_33619_c1
698 nmdc:mga0n895_8348_c1
699 nmdc:mga0rr50_57314_c1
700 nmdc:mga08x19_65578_c1
701 nmdc:mga0a205_102984_c1
702 nmdc:mga0a205_2523_c1
703 Ga0500641_0000983
704 Ga0501084_0010309
705 Ga0587073_0003902
706 Ga0587073_0011322
707 Ga0587082_001786
708 Ga0587088_010048
709 Ga0587079_009069
710 Ga0587114_000906
711 Ga0530510_0130218
712 Ga0530510_0183846
713 2913850872
714 642605151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

198

277

0.91

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

24

159

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cpd-assembly2.cif.gz_C alcohol dehydrogenase tadh from thermus sp. atn1 0.963 1 389
4cpd-assembly1.cif.gz_D alcohol dehydrogenase tadh from thermus sp. atn1 0.9595 1 389
4cpd-assembly2.cif.gz_C alcohol dehydrogenase tadh from thermus sp. atn1 0.9549 1 389
4cpd-assembly1.cif.gz_D alcohol dehydrogenase tadh from thermus sp. atn1 0.9512 1 389
4cpd-assembly2.cif.gz_B alcohol dehydrogenase tadh from thermus sp. atn1 0.9444 1 389
ID Description Score Start End Superfamily
af_Q9P6I8_35_189_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.966 1 155 3.90.180.10
af_P77316_1_168_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9524 1 168 3.90.180.10
af_Q9P6I8_35_189_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9478 1 155 3.90.180.10
af_P77316_175_332_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9465 177 334 3.40.50.720
4cpdD01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9452 1 389 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A6N8NGZ3-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9946 1 98 GO:0008270
GO:0016491
AF-A0A350KGB0-F1-model_v4 deleted 0.9938 1 214
AF-M5EN42-F1-model_v4 Putative oxidoreductase, Zn-dependent and NAD(P)-binding 0.9922 1 111 GO:0008270
GO:0016491
AF-A0A7W1KQS8-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9902 1 237 GO:0008270
GO:0016491
AF-A0A350KGB0-F1-model_v4 deleted 0.9892 1 214

Map