F420694
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 357 | 172 | 355 | 722 |
Family's Representative Sequence
| Representative Sequence | 3300001990|JGI24737J22298_10005463|JGI24737J22298_100054633 |
| Length | 803 |
| Sequence | MPRLLGARPGLSKASVLRFDDWAIAVFRDCGGEQAAIGPRPMQRRTSWGRKGAATASLAAVIAACXXXXQAQDLNAHRAEXXXXTAESKTAPEDEVTFSAAQLDYDDNADIVTATGDVRMFRNGARLRADKVTWNRQTGEVRAIGNVAVVNANGDKAYADDIQLTDELHDGVANNMLLVLANGGRLAAMHGERKGDITTLNQAAYTPCQVEDRHGCPKRPSWQITAVRVVVDEGKHRISYRDARFALFGQTILALPAFSHPDGSESGRGNSGLLLPNLQVNKSNGVEIDLPYYLQIGPNRDLTITPHFYTAVLPALEAQYRTLTGNGAYQVSGMVTYGARLPATSNNAAGSAGTTPAESNDTFRGYLDANGTWQLGPYWTVHGALRLTTDRTFMKRYYISNDDRLRSTVKAERIDADSYLSIAGWFVQDLRPGYVEGQQPIALPAIDYRRRFHDPLLGGVVTAQLNSLALTRTDGQDTQRAFAGLRWDLRTLTPIGQEVIFTAYTRADIYHTDNSAATVTPLYRGTDGWHGRGIAALAADMRWPFIGALLGGVQQIVPRVQLVAEPKIRNLDIPDEDSRAVDLEDSNLFALNRFSGYDRWEDSSRITYGGEWNYTRPKLEIRTVIGQSYRLSSEPTILPPGTGLSDRFSDYVGRVSVRYGKWIEVTERFRLDKDNFAVRRNEIDATVGSRNTYVEVGYLKLHRNIDTSIEDLRDLSEIRLGARIRLARYWSIFGSTVVDLTTRKDDPLSLSDGYQPVRHRLGLLYENECLSLGVTWRKDYDQTGDAKRGSTFSLRLALKNLGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 3 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 86 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 134 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 135 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 136 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 137 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 138 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 141 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 142 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 143 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 144 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 145 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 146 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 147 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 148 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 149 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 150 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 151 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 159 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 160 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 162 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 163 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 164 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 165 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 166 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 167 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 168 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 169 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 170 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 171 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 172 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.44 |
| Metatranscriptomes | 0 |
| Isolates | 0.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.24 |
| Nodule | 0 |
| Rhizoplane | 1.68 |
| Rhizosphere | 91.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_424476 | 2162886007 | Bacteria | 2645 |
| 2 | JGI24736J21556_1000044 | 3300001904 | Bacteria | 20553 |
| 3 | JGI24736J21556_1000133 | 3300001904 | Bacteria | 12833 |
| 4 | JGI24752J21851_1000034 | 3300001976 | Bacteria | 16370 |
| 5 | JGI24752J21851_1000290 | 3300001976 | Bacteria | 7005 |
| 6 | JGI24739J22299_10001632 | 3300001989 | Bacteria | 8513 |
| 7 | JGI24739J22299_10001641 | 3300001989 | Bacteria | 8490 |
| 8 | JGI24737J22298_10001558 | 3300001990 | Bacteria | 8155 |
| 9 | JGI24737J22298_10005463 | 3300001990 | Bacteria | 4389 |
| 10 | JGI24735J21928_10000908 | 3300002067 | Bacteria | 10568 |
| 11 | JGI24735J21928_10001091 | 3300002067 | Bacteria | 9690 |
| 12 | JGI24735J21928_10011326 | 3300002067 | Bacteria | 2831 |
| 13 | JGI24735J21928_10014820 | 3300002067 | Bacteria | 2439 |
| 14 | JGI24748J21848_1000032 | 3300002074 | Bacteria | 79791 |
| 15 | JGI24738J21930_10000203 | 3300002075 | Bacteria | 15854 |
| 16 | JGI24749J21850_1000476 | 3300002076 | Bacteria | 5940 |
| 17 | JGI24744J21845_10002556 | 3300002077 | Bacteria | 3714 |
| 18 | JGI24034J26672_10000022 | 3300002239 | Bacteria | 116342 |
| 19 | JGI24742J22300_10000557 | 3300002244 | Bacteria | 5587 |
| 20 | JGI25165J46597_1000050 | 3300003214 | Bacteria | 242776 |
| 21 | rootH1_10002704 | 3300003323 | Bacteria | 4453 |
| 22 | Ga0065704_10074248 | 3300005289 | Bacteria | 6425 |
| 23 | Ga0065707_10086897 | 3300005295 | Bacteria | 5252 |
| 24 | Ga0070658_10000001 | 3300005327 | Bacteria | 856789 |
| 25 | Ga0070658_10000085 | 3300005327 | Bacteria | 87440 |
| 26 | Ga0070658_10000105 | 3300005327 | Bacteria | 75360 |
| 27 | Ga0070658_10001253 | 3300005327 | Bacteria | 21758 |
| 28 | Ga0070658_10005651 | 3300005327 | Bacteria | 10140 |
| 29 | Ga0070658_10023935 | 3300005327 | Bacteria | 4899 |
| 30 | Ga0070676_10000215 | 3300005328 | Bacteria | 24740 |
| 31 | Ga0070683_100048372 | 3300005329 | Bacteria | 3931 |
| 32 | Ga0070683_100054116 | 3300005329 | Bacteria | 3721 |
| 33 | Ga0070690_100000056 | 3300005330 | Bacteria | 54517 |
| 34 | Ga0070670_100000016 | 3300005331 | Bacteria | 226440 |
| 35 | Ga0070670_100033691 | 3300005331 | Bacteria | 4411 |
| 36 | Ga0068869_100014287 | 3300005334 | Bacteria | 5301 |
| 37 | Ga0070666_10000002 | 3300005335 | Bacteria | 478684 |
| 38 | Ga0070680_100012865 | 3300005336 | Bacteria | 6511 |
| 39 | Ga0068868_100000117 | 3300005338 | Bacteria | 50053 |
| 40 | Ga0070660_100000177 | 3300005339 | Bacteria | 42137 |
| 41 | Ga0070660_100006379 | 3300005339 | Bacteria | 8176 |
| 42 | Ga0070660_100006879 | 3300005339 | Bacteria | 7887 |
| 43 | Ga0070660_100007248 | 3300005339 | Bacteria | 7720 |
| 44 | Ga0070660_100009047 | 3300005339 | Bacteria | 6989 |
| 45 | Ga0070660_100009453 | 3300005339 | Bacteria | 6857 |
| 46 | Ga0070660_100019515 | 3300005339 | Bacteria | 4969 |
| 47 | Ga0070660_100065745 | 3300005339 | Bacteria | 2822 |
| 48 | Ga0070692_10002960 | 3300005345 | Bacteria | 6754 |
| 49 | Ga0070692_10010824 | 3300005345 | Bacteria | 4170 |
| 50 | Ga0070669_100000170 | 3300005353 | Bacteria | 57161 |
| 51 | Ga0070675_100001145 | 3300005354 | Bacteria | 19138 |
| 52 | Ga0070671_100000661 | 3300005355 | Bacteria | 24795 |
| 53 | Ga0070671_100004315 | 3300005355 | Bacteria | 11250 |
| 54 | Ga0070671_100007660 | 3300005355 | Bacteria | 8633 |
| 55 | Ga0070671_100009278 | 3300005355 | Bacteria | 7902 |
| 56 | Ga0070671_100033649 | 3300005355 | Bacteria | 4241 |
| 57 | Ga0070674_100008098 | 3300005356 | Bacteria | 6235 |
| 58 | Ga0070673_100000007 | 3300005364 | Bacteria | 177157 |
| 59 | Ga0070659_100006185 | 3300005366 | Bacteria | 8646 |
| 60 | Ga0070659_100006731 | 3300005366 | Bacteria | 8309 |
| 61 | Ga0070659_100043937 | 3300005366 | Bacteria | 3496 |
| 62 | Ga0070667_100000528 | 3300005367 | Bacteria | 38357 |
| 63 | Ga0070667_100010510 | 3300005367 | Bacteria | 7642 |
| 64 | Ga0070667_100105529 | 3300005367 | Bacteria | 2438 |
| 65 | Ga0070663_100000399 | 3300005455 | Bacteria | 22797 |
| 66 | Ga0070663_100003932 | 3300005455 | Bacteria | 8666 |
| 67 | Ga0070663_100046004 | 3300005455 | Bacteria | 3085 |
| 68 | Ga0070678_100012801 | 3300005456 | Bacteria | 5232 |
| 69 | Ga0070662_100001894 | 3300005457 | Bacteria | 12831 |
| 70 | Ga0070662_100002782 | 3300005457 | Bacteria | 10831 |
| 71 | Ga0070662_100022965 | 3300005457 | Bacteria | 4280 |
| 72 | Ga0070681_10052462 | 3300005458 | Bacteria | 4067 |
| 73 | Ga0068867_100000010 | 3300005459 | Bacteria | 129593 |
| 74 | Ga0070685_10003957 | 3300005466 | Bacteria | 7486 |
| 75 | Ga0070679_100026979 | 3300005530 | Bacteria | 5649 |
| 76 | Ga0068853_100044220 | 3300005539 | Bacteria | 3812 |
| 77 | Ga0068853_100104581 | 3300005539 | Bacteria | 2507 |
| 78 | Ga0070686_100000335 | 3300005544 | Bacteria | 30423 |
| 79 | Ga0070665_100000036 | 3300005548 | Bacteria | 314603 |
| 80 | Ga0068855_100000586 | 3300005563 | Bacteria | 44740 |
| 81 | Ga0068855_100007701 | 3300005563 | Bacteria | 13005 |
| 82 | Ga0068855_100011711 | 3300005563 | Bacteria | 10599 |
| 83 | Ga0068855_100054675 | 3300005563 | Bacteria | 4692 |
| 84 | Ga0068855_100062702 | 3300005563 | Bacteria | 4339 |
| 85 | Ga0070664_100007628 | 3300005564 | Bacteria | 8737 |
| 86 | Ga0070664_100010862 | 3300005564 | Bacteria | 7384 |
| 87 | Ga0070664_100032808 | 3300005564 | Bacteria | 4345 |
| 88 | Ga0068857_100014813 | 3300005577 | Bacteria | 6802 |
| 89 | Ga0068854_100000961 | 3300005578 | Bacteria | 17357 |
| 90 | Ga0068854_100011403 | 3300005578 | Bacteria | 5784 |
| 91 | Ga0068854_100021058 | 3300005578 | Bacteria | 4421 |
| 92 | Ga0068856_100005986 | 3300005614 | Bacteria | 11972 |
| 93 | Ga0068856_100010054 | 3300005614 | Bacteria | 9192 |
| 94 | Ga0068856_100021442 | 3300005614 | Bacteria | 6281 |
| 95 | Ga0068856_100046021 | 3300005614 | Bacteria | 4297 |
| 96 | Ga0068852_100000283 | 3300005616 | Bacteria | 33859 |
| 97 | Ga0068852_100037570 | 3300005616 | Bacteria | 4061 |
| 98 | Ga0068859_100006121 | 3300005617 | Bacteria | 12223 |
| 99 | Ga0068859_100011388 | 3300005617 | Bacteria | 8944 |
| 100 | Ga0068864_100000017 | 3300005618 | Bacteria | 285607 |
| 101 | Ga0068864_100007304 | 3300005618 | Bacteria | 9088 |
| 102 | Ga0068864_100010218 | 3300005618 | Bacteria | 7751 |
| 103 | Ga0068864_100020652 | 3300005618 | Bacteria | 5511 |
| 104 | Ga0068863_100000018 | 3300005841 | Bacteria | 206948 |
| 105 | Ga0068863_100000095 | 3300005841 | Bacteria | 96080 |
| 106 | Ga0068863_100000196 | 3300005841 | Bacteria | 64527 |
| 107 | Ga0068863_100003907 | 3300005841 | Bacteria | 14718 |
| 108 | Ga0068858_100002740 | 3300005842 | Bacteria | 17718 |
| 109 | Ga0068860_100000001 | 3300005843 | Bacteria | 703043 |
| 110 | Ga0068862_100000010 | 3300005844 | Bacteria | 285607 |
| 111 | Ga0068862_100000350 | 3300005844 | Bacteria | 49916 |
| 112 | Ga0097621_100010271 | 3300006237 | Bacteria | 6840 |
| 113 | Ga0068871_100033122 | 3300006358 | Bacteria | 4088 |
| 114 | Ga0068865_100000008 | 3300006881 | Bacteria | 177158 |
| 115 | Ga0097620_100006121 | 3300006931 | Bacteria | 12223 |
| 116 | Ga0097620_100011389 | 3300006931 | Bacteria | 8944 |
| 117 | Ga0105251_10001597 | 3300009011 | Bacteria | 19331 |
| 118 | Ga0105240_10190880 | 3300009093 | Bacteria | 2409 |
| 119 | Ga0105245_10000146 | 3300009098 | Bacteria | 66619 |
| 120 | Ga0105247_10002227 | 3300009101 | Bacteria | 13346 |
| 121 | Ga0105243_10000080 | 3300009148 | Bacteria | 109765 |
| 122 | Ga0105248_10000105 | 3300009177 | Bacteria | 94143 |
| 123 | Ga0105248_10023493 | 3300009177 | Bacteria | 6848 |
| 124 | Ga0105248_10046967 | 3300009177 | Bacteria | 4841 |
| 125 | Ga0105249_10000026 | 3300009553 | Bacteria | 232053 |
| 126 | Ga0105249_10000207 | 3300009553 | Bacteria | 67193 |
| 127 | Ga0105239_10030202 | 3300010375 | Bacteria | 5958 |
| 128 | Ga0105246_10010334 | 3300011119 | Bacteria | 5771 |
| 129 | Ga0157373_10022902 | 3300013100 | Bacteria | 4531 |
| 130 | Ga0157373_10052285 | 3300013100 | Bacteria | 2907 |
| 131 | Ga0157373_10054135 | 3300013100 | Bacteria | 2852 |
| 132 | Ga0157371_10005025 | 3300013102 | Bacteria | 11331 |
| 133 | Ga0157371_10005987 | 3300013102 | Bacteria | 10142 |
| 134 | Ga0157371_10026571 | 3300013102 | Bacteria | 4206 |
| 135 | Ga0157370_10000063 | 3300013104 | Bacteria | 114697 |
| 136 | Ga0157370_10007551 | 3300013104 | Bacteria | 11813 |
| 137 | Ga0157370_10020226 | 3300013104 | Bacteria | 6651 |
| 138 | Ga0157370_10021081 | 3300013104 | Bacteria | 6497 |
| 139 | Ga0157369_10000833 | 3300013105 | Bacteria | 39452 |
| 140 | Ga0157369_10008366 | 3300013105 | Bacteria | 11865 |
| 141 | Ga0157369_10018048 | 3300013105 | Bacteria | 7914 |
| 142 | Ga0157369_10029888 | 3300013105 | Bacteria | 6016 |
| 143 | Ga0157369_10041256 | 3300013105 | Bacteria | 5038 |
| 144 | Ga0157369_10061950 | 3300013105 | Bacteria | 4032 |
| 145 | Ga0157369_10068869 | 3300013105 | Bacteria | 3802 |
| 146 | Ga0157369_10069148 | 3300013105 | Bacteria | 3794 |
| 147 | Ga0157374_10000464 | 3300013296 | Bacteria | 36789 |
| 148 | Ga0157374_10020551 | 3300013296 | Bacteria | 5861 |
| 149 | Ga0157374_10030626 | 3300013296 | Bacteria | 4887 |
| 150 | Ga0157378_10024244 | 3300013297 | Bacteria | 5336 |
| 151 | Ga0163162_10003602 | 3300013306 | Bacteria | 14833 |
| 152 | Ga0163162_10042267 | 3300013306 | Bacteria | 4561 |
| 153 | Ga0163162_10118669 | 3300013306 | Bacteria | 2747 |
| 154 | Ga0157372_10045825 | 3300013307 | Bacteria | 4853 |
| 155 | Ga0157375_10007237 | 3300013308 | Bacteria | 9706 |
| 156 | Ga0157375_10012796 | 3300013308 | Bacteria | 7451 |
| 157 | Ga0157380_10001342 | 3300014326 | Bacteria | 16023 |
| 158 | Ga0157379_10008804 | 3300014968 | Bacteria | 8802 |
| 159 | Ga0157376_10000087 | 3300014969 | Bacteria | 70163 |
| 160 | Ga0163161_10000008 | 3300017792 | Bacteria | 294642 |
| 161 | Ga0213876_10000596 | 3300021384 | Bacteria | 26862 |
| 162 | Ga0207427_102080 | 3300025231 | Bacteria | 5887 |
| 163 | Ga0209026_1000658 | 3300025250 | Bacteria | 21101 |
| 164 | Ga0209148_1000398 | 3300025254 | Bacteria | 50941 |
| 165 | Ga0209233_1000041 | 3300025261 | Bacteria | 515463 |
| 166 | Ga0209455_1000513 | 3300025272 | Bacteria | 27536 |
| 167 | Ga0207713_1006527 | 3300025735 | Bacteria | 7087 |
| 168 | Ga0207680_10000004 | 3300025903 | Bacteria | 827324 |
| 169 | Ga0207647_10000352 | 3300025904 | Bacteria | 37248 |
| 170 | Ga0207647_10000654 | 3300025904 | Bacteria | 27108 |
| 171 | Ga0207647_10004524 | 3300025904 | Bacteria | 10304 |
| 172 | Ga0207647_10020352 | 3300025904 | Bacteria | 4449 |
| 173 | Ga0207645_10000993 | 3300025907 | Bacteria | 23397 |
| 174 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 175 | Ga0207705_10000022 | 3300025909 | Bacteria | 302232 |
| 176 | Ga0207705_10000116 | 3300025909 | Bacteria | 89237 |
| 177 | Ga0207705_10001160 | 3300025909 | Bacteria | 21451 |
| 178 | Ga0207705_10001216 | 3300025909 | Bacteria | 20824 |
| 179 | Ga0207705_10001553 | 3300025909 | Bacteria | 18222 |
| 180 | Ga0207705_10002147 | 3300025909 | Bacteria | 15290 |
| 181 | Ga0207705_10002857 | 3300025909 | Bacteria | 13218 |
| 182 | Ga0207705_10003678 | 3300025909 | Bacteria | 11665 |
| 183 | Ga0207705_10053542 | 3300025909 | Bacteria | 2907 |
| 184 | Ga0207695_10001723 | 3300025913 | Bacteria | 34990 |
| 185 | Ga0207695_10053252 | 3300025913 | Bacteria | 4233 |
| 186 | Ga0207671_10003257 | 3300025914 | Bacteria | 16330 |
| 187 | Ga0207657_10000082 | 3300025919 | Bacteria | 89667 |
| 188 | Ga0207657_10000128 | 3300025919 | Bacteria | 76013 |
| 189 | Ga0207657_10000578 | 3300025919 | Bacteria | 38938 |
| 190 | Ga0207657_10001403 | 3300025919 | Bacteria | 25687 |
| 191 | Ga0207657_10001484 | 3300025919 | Bacteria | 25105 |
| 192 | Ga0207657_10001933 | 3300025919 | Bacteria | 22370 |
| 193 | Ga0207657_10005740 | 3300025919 | Bacteria | 12946 |
| 194 | Ga0207657_10009043 | 3300025919 | Bacteria | 10057 |
| 195 | Ga0207657_10010341 | 3300025919 | Bacteria | 9312 |
| 196 | Ga0207657_10013564 | 3300025919 | Bacteria | 7993 |
| 197 | Ga0207657_10014614 | 3300025919 | Bacteria | 7650 |
| 198 | Ga0207657_10024379 | 3300025919 | Bacteria | 5604 |
| 199 | Ga0207657_10027251 | 3300025919 | Bacteria | 5235 |
| 200 | Ga0207657_10027947 | 3300025919 | Bacteria | 5156 |
| 201 | Ga0207657_10033280 | 3300025919 | Bacteria | 4648 |
| 202 | Ga0207649_10002611 | 3300025920 | Bacteria | 10007 |
| 203 | Ga0207649_10002642 | 3300025920 | Bacteria | 9952 |
| 204 | Ga0207649_10015274 | 3300025920 | Bacteria | 4314 |
| 205 | Ga0207694_10001459 | 3300025924 | Bacteria | 20221 |
| 206 | Ga0207694_10021239 | 3300025924 | Bacteria | 4918 |
| 207 | Ga0207650_10000057 | 3300025925 | Bacteria | 156913 |
| 208 | Ga0207644_10000755 | 3300025931 | Bacteria | 20528 |
| 209 | Ga0207644_10001492 | 3300025931 | Bacteria | 15069 |
| 210 | Ga0207644_10002030 | 3300025931 | Bacteria | 13090 |
| 211 | Ga0207644_10003340 | 3300025931 | Bacteria | 10349 |
| 212 | Ga0207644_10026606 | 3300025931 | Bacteria | 3988 |
| 213 | Ga0207690_10006036 | 3300025932 | Bacteria | 7179 |
| 214 | Ga0207690_10012959 | 3300025932 | Bacteria | 4998 |
| 215 | Ga0207690_10017194 | 3300025932 | Bacteria | 4412 |
| 216 | Ga0207706_10002828 | 3300025933 | Bacteria | 16835 |
| 217 | Ga0207706_10002860 | 3300025933 | Bacteria | 16752 |
| 218 | Ga0207706_10011529 | 3300025933 | Bacteria | 8051 |
| 219 | Ga0207706_10045179 | 3300025933 | Bacteria | 3903 |
| 220 | Ga0207686_10003062 | 3300025934 | Bacteria | 8994 |
| 221 | Ga0207709_10000345 | 3300025935 | Bacteria | 47717 |
| 222 | Ga0207670_10015542 | 3300025936 | Bacteria | 4551 |
| 223 | Ga0207704_10000013 | 3300025938 | Bacteria | 170478 |
| 224 | Ga0207691_10018226 | 3300025940 | Bacteria | 6650 |
| 225 | Ga0207711_10000031 | 3300025941 | Bacteria | 203323 |
| 226 | Ga0207711_10001624 | 3300025941 | Bacteria | 20742 |
| 227 | Ga0207689_10003311 | 3300025942 | Bacteria | 14744 |
| 228 | Ga0207689_10006472 | 3300025942 | Bacteria | 10350 |
| 229 | Ga0207661_10002284 | 3300025944 | Bacteria | 13206 |
| 230 | Ga0207661_10013298 | 3300025944 | Bacteria | 6011 |
| 231 | Ga0207667_10000113 | 3300025949 | Bacteria | 131083 |
| 232 | Ga0207667_10011888 | 3300025949 | Bacteria | 10083 |
| 233 | Ga0207667_10020242 | 3300025949 | Bacteria | 7404 |
| 234 | Ga0207651_10000013 | 3300025960 | Bacteria | 177573 |
| 235 | Ga0207651_10000944 | 3300025960 | Bacteria | 12804 |
| 236 | Ga0207712_10000001 | 3300025961 | Bacteria | 750309 |
| 237 | Ga0207712_10000234 | 3300025961 | Bacteria | 54386 |
| 238 | Ga0207712_10014830 | 3300025961 | Bacteria | 5017 |
| 239 | Ga0207640_10000532 | 3300025981 | Bacteria | 22823 |
| 240 | Ga0207640_10000777 | 3300025981 | Bacteria | 18152 |
| 241 | Ga0207640_10032166 | 3300025981 | Bacteria | 3251 |
| 242 | Ga0207658_10001812 | 3300025986 | Bacteria | 15990 |
| 243 | Ga0207658_10004409 | 3300025986 | Bacteria | 9786 |
| 244 | Ga0207677_10000851 | 3300026023 | Bacteria | 17474 |
| 245 | Ga0207703_10001677 | 3300026035 | Bacteria | 19921 |
| 246 | Ga0207639_10007247 | 3300026041 | Bacteria | 7557 |
| 247 | Ga0207639_10010647 | 3300026041 | Bacteria | 6368 |
| 248 | Ga0207678_10000938 | 3300026067 | Bacteria | 26581 |
| 249 | Ga0207678_10002130 | 3300026067 | Bacteria | 17922 |
| 250 | Ga0207678_10005875 | 3300026067 | Bacteria | 10939 |
| 251 | Ga0207678_10009407 | 3300026067 | Bacteria | 8599 |
| 252 | Ga0207678_10011950 | 3300026067 | Bacteria | 7623 |
| 253 | Ga0207678_10016841 | 3300026067 | Bacteria | 6417 |
| 254 | Ga0207678_10018646 | 3300026067 | Bacteria | 6091 |
| 255 | Ga0207678_10023290 | 3300026067 | Bacteria | 5416 |
| 256 | Ga0207678_10054866 | 3300026067 | Bacteria | 3433 |
| 257 | Ga0207702_10000335 | 3300026078 | Bacteria | 53978 |
| 258 | Ga0207702_10011063 | 3300026078 | Bacteria | 7532 |
| 259 | Ga0207702_10014614 | 3300026078 | Bacteria | 6516 |
| 260 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 261 | Ga0207641_10000148 | 3300026088 | Bacteria | 99601 |
| 262 | Ga0207641_10001363 | 3300026088 | Bacteria | 24206 |
| 263 | Ga0207641_10017938 | 3300026088 | Bacteria | 5799 |
| 264 | Ga0207648_10000025 | 3300026089 | Bacteria | 131593 |
| 265 | Ga0207676_10000005 | 3300026095 | Bacteria | 698744 |
| 266 | Ga0207676_10001987 | 3300026095 | Bacteria | 14886 |
| 267 | Ga0207676_10012785 | 3300026095 | Bacteria | 6023 |
| 268 | Ga0207676_10015812 | 3300026095 | Bacteria | 5456 |
| 269 | Ga0207674_10009274 | 3300026116 | Bacteria | 11276 |
| 270 | Ga0207674_10020763 | 3300026116 | Bacteria | 7089 |
| 271 | Ga0207674_10026648 | 3300026116 | Bacteria | 6132 |
| 272 | Ga0207675_100001093 | 3300026118 | Bacteria | 26859 |
| 273 | Ga0207683_10005385 | 3300026121 | Bacteria | 10969 |
| 274 | Ga0207683_10010313 | 3300026121 | Bacteria | 7968 |
| 275 | Ga0207683_10021519 | 3300026121 | Bacteria | 5523 |
| 276 | Ga0207698_10000396 | 3300026142 | Bacteria | 25123 |
| 277 | Ga0207698_10010717 | 3300026142 | Bacteria | 5913 |
| 278 | Ga0207698_10061778 | 3300026142 | Bacteria | 2922 |
| 279 | Ga0268266_10000042 | 3300028379 | Bacteria | 316826 |
| 280 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 281 | Ga0268265_10000481 | 3300028380 | Bacteria | 41838 |
| 282 | Ga0268264_10000006 | 3300028381 | Bacteria | 827324 |
| 283 | Ga0307409_100009539 | 3300031995 | Bacteria | 5971 |
| 284 | Ga0307409_100043639 | 3300031995 | Bacteria | 3369 |
| 285 | Ga0373943_0005550 | 3300035170 | Bacteria | 5665 |
| 286 | Ga0395899_0000917 | 3300037312 | Bacteria | 27698 |
| 287 | Ga0395899_0012993 | 3300037312 | Bacteria | 6371 |
| 288 | Ga0395900_0000031 | 3300037418 | Bacteria | 262393 |
| 289 | Ga0395900_0002298 | 3300037418 | Bacteria | 21230 |
| 290 | Ga0395900_0006454 | 3300037418 | Bacteria | 12224 |
| 291 | Ga0395900_0034324 | 3300037418 | Bacteria | 5223 |
| 292 | Ga0395900_0140390 | 3300037418 | Bacteria | 2474 |
| 293 | Ga0395900_0209055 | 3300037418 | Bacteria | 1971 |
| 294 | Ga0395898_0006882 | 3300037466 | Bacteria | 12096 |
| 295 | Ga0395898_0015757 | 3300037466 | Bacteria | 7747 |
| 296 | Ga0395898_0016527 | 3300037466 | Bacteria | 7546 |
| 297 | Ga0395898_0030407 | 3300037466 | Bacteria | 5404 |
| 298 | Ga0395905_0003572 | 3300037471 | Bacteria | 16555 |
| 299 | Ga0395905_0007737 | 3300037471 | Bacteria | 10661 |
| 300 | Ga0395905_0008097 | 3300037471 | Bacteria | 10382 |
| 301 | Ga0395905_0013367 | 3300037471 | Bacteria | 7865 |
| 302 | Ga0395905_0077151 | 3300037471 | Bacteria | 3122 |
| 303 | Ga0395901_0000035 | 3300038443 | Bacteria | 223888 |
| 304 | Ga0395901_0002827 | 3300038443 | Bacteria | 17529 |
| 305 | Ga0395901_0007679 | 3300038443 | Bacteria | 10879 |
| 306 | Ga0395901_0008874 | 3300038443 | Bacteria | 10179 |
| 307 | Ga0395901_0010261 | 3300038443 | Bacteria | 9488 |
| 308 | Ga0395901_0032450 | 3300038443 | Bacteria | 5388 |
| 309 | Ga0395901_0053922 | 3300038443 | Bacteria | 4178 |
| 310 | Ga0436365_0228661 | 3300039437 | Bacteria | 14347 |
| 311 | Ga0436365_1205090 | 3300039437 | Bacteria | 128002 |
| 312 | Ga0439448_0001334 | 3300042005 | Bacteria | 6315 |
| 313 | Ga0439448_0004603 | 3300042005 | Bacteria | 3901 |
| 314 | Ga0439458_0000143 | 3300042157 | Bacteria | 15350 |
| 315 | Ga0439458_0003356 | 3300042157 | Bacteria | 3762 |
| 316 | Ga0466966_0000007 | 3300044684 | Bacteria | 155702 |
| 317 | Ga0466961_0005022 | 3300044693 | Bacteria | 8319 |
| 318 | Ga0466961_0049053 | 3300044693 | Unclassified | 2699 |
| 319 | Ga0466961_0053089 | 3300044693 | Bacteria | 2587 |
| 320 | Ga0466971_0000515 | 3300044719 | Bacteria | 15258 |
| 321 | Ga0466971_0003966 | 3300044719 | Bacteria | 6363 |
| 322 | Ga0466970_0002752 | 3300044765 | Bacteria | 8490 |
| 323 | Ga0466957_0000606 | 3300044842 | Bacteria | 18172 |
| 324 | Ga0466957_0008377 | 3300044842 | Bacteria | 5881 |
| 325 | Ga0466959_0007216 | 3300045049 | Bacteria | 7785 |
| 326 | Ga0466958_0013543 | 3300045836 | Bacteria | 4645 |
| 327 | Ga0466967_0020679 | 3300045976 | Bacteria | 5327 |
| 328 | Ga0495638_0016032 | 3300046460 | Bacteria | 5022 |
| 329 | Ga0495583_0000500 | 3300046506 | Bacteria | 56753 |
| 330 | Ga0495606_0002862 | 3300046507 | Bacteria | 19095 |
| 331 | Ga0495669_0005549 | 3300046684 | Bacteria | 5262 |
| 332 | Ga0495670_0000359 | 3300046691 | Bacteria | 21740 |
| 333 | Ga0495686_0000119 | 3300047472 | Bacteria | 165244 |
| 334 | Ga0496100_0029808 | 3300048903 | Bacteria | 3379 |
| 335 | Ga0496102_0008737 | 3300048905 | Bacteria | 8692 |
| 336 | Ga0496102_0069691 | 3300048905 | Bacteria | 3228 |
| 337 | Ga0496103_0002569 | 3300048906 | Bacteria | 11380 |
| 338 | Ga0496108_0012184 | 3300048911 | Bacteria | 6992 |
| 339 | Ga0496112_0005767 | 3300048915 | Bacteria | 10770 |
| 340 | Ga0496117_0006668 | 3300048920 | Bacteria | 11569 |
| 341 | Ga0496117_0007680 | 3300048920 | Bacteria | 10443 |
| 342 | Ga0496118_0000332 | 3300048921 | Bacteria | 80480 |
| 343 | Ga0496118_0026809 | 3300048921 | Bacteria | 4897 |
| 344 | Ga0496119_0006901 | 3300048922 | Bacteria | 10366 |
| 345 | Ga0496121_0009586 | 3300048924 | Bacteria | 11093 |
| 346 | Ga0496122_0004196 | 3300048925 | Bacteria | 18127 |
| 347 | Ga0496122_0009076 | 3300048925 | Bacteria | 10550 |
| 348 | Ga0496123_0002216 | 3300048926 | Bacteria | 24673 |
| 349 | Ga0496123_0004429 | 3300048926 | Bacteria | 14773 |
| 350 | Ga0496123_0038453 | 3300048926 | Bacteria | 3363 |
| 351 | Ga0496124_0006016 | 3300048927 | Bacteria | 13378 |
| 352 | Ga0496125_0010772 | 3300048928 | Bacteria | 9208 |
| 353 | Ga0500643_000129 | 3300053087 | Bacteria | 77787 |
| 354 | Ga0500555_001130 | 3300053103 | Bacteria | 8817 |
| 355 | Ga0500611_000447 | 3300053727 | Bacteria | 4202 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_0209055 | Ga0395900_0209055_112_1953 | 613 |
| 2 | 3300005339 | Ga0070660_100006879 | Ga0070660_1000068792 | 641 |
| 3 | 3300031995 | Ga0307409_100043639 | Ga0307409_1000436392 | 642 |
| 4 | 3300038443 | Ga0395901_0032450 | Ga0395901_0032450_548_2767 | 645 |
| 5 | 3300005578 | Ga0068854_100011403 | Ga0068854_1000114032 | 647 |
| 6 | 3300005616 | Ga0068852_100037570 | Ga0068852_1000375702 | 647 |
| 7 | 3300025913 | Ga0207695_10053252 | Ga0207695_100532522 | 647 |
| 8 | 3300005563 | Ga0068855_100054675 | Ga0068855_1000546752 | 650 |
| 9 | 3300025919 | Ga0207657_10009043 | Ga0207657_100090435 | 650 |
| 10 | 3300005345 | Ga0070692_10002960 | Ga0070692_100029603 | 656 |
| 11 | 3300038443 | Ga0395901_0053922 | Ga0395901_0053922_1909_4086 | 657 |
| 12 | 3300048926 | Ga0496123_0038453 | Ga0496123_0038453_971_3145 | 658 |
| 13 | 3300005367 | Ga0070667_100105529 | Ga0070667_1001055291 | 661 |
| 14 | 3300013296 | Ga0157374_10020551 | Ga0157374_100205513 | 661 |
| 15 | 3300013306 | Ga0163162_10003602 | Ga0163162_100036025 | 661 |
| 16 | 3300013308 | Ga0157375_10007237 | Ga0157375_100072377 | 661 |
| 17 | 3300025960 | Ga0207651_10000944 | Ga0207651_100009444 | 661 |
| 18 | 3300026121 | Ga0207683_10021519 | Ga0207683_100215195 | 661 |
| 19 | 3300005614 | Ga0068856_100005986 | Ga0068856_1000059865 | 662 |
| 20 | 3300013104 | Ga0157370_10021081 | Ga0157370_100210815 | 662 |
| 21 | 3300026078 | Ga0207702_10014614 | Ga0207702_100146145 | 662 |
| 22 | 3300037418 | Ga0395900_0006454 | Ga0395900_0006454_4189_6378 | 662 |
| 23 | 3300005355 | Ga0070671_100007660 | Ga0070671_1000076602 | 663 |
| 24 | 3300005457 | Ga0070662_100022965 | Ga0070662_1000229653 | 663 |
| 25 | 3300005618 | Ga0068864_100007304 | Ga0068864_1000073043 | 663 |
| 26 | 3300005841 | Ga0068863_100003907 | Ga0068863_1000039076 | 663 |
| 27 | 3300025931 | Ga0207644_10003340 | Ga0207644_100033407 | 663 |
| 28 | 3300025933 | Ga0207706_10002828 | Ga0207706_100028287 | 663 |
| 29 | 3300025940 | Ga0207691_10018226 | Ga0207691_100182261 | 663 |
| 30 | 3300025941 | Ga0207711_10001624 | Ga0207711_100016249 | 663 |
| 31 | 3300026095 | Ga0207676_10012785 | Ga0207676_100127853 | 663 |
| 32 | 3300048911 | Ga0496108_0012184 | Ga0496108_0012184_3109_5271 | 663 |
| 33 | 3300048915 | Ga0496112_0005767 | Ga0496112_0005767_8328_10490 | 663 |
| 34 | 3300013100 | Ga0157373_10022902 | Ga0157373_100229021 | 664 |
| 35 | 3300037471 | Ga0395905_0003572 | Ga0395905_0003572_2182_4356 | 664 |
| 36 | 3300046684 | Ga0495669_0005549 | Ga0495669_0005549_2432_4591 | 664 |
| 37 | 3300005578 | Ga0068854_100021058 | Ga0068854_1000210581 | 667 |
| 38 | 3300025981 | Ga0207640_10032166 | Ga0207640_100321661 | 667 |
| 39 | 3300026067 | Ga0207678_10009407 | Ga0207678_100094076 | 667 |
| 40 | 3300013297 | Ga0157378_10024244 | Ga0157378_100242443 | 670 |
| 41 | 3300005327 | Ga0070658_10001253 | Ga0070658_100012536 | 671 |
| 42 | 3300005336 | Ga0070680_100012865 | Ga0070680_1000128652 | 671 |
| 43 | 3300005339 | Ga0070660_100007248 | Ga0070660_1000072483 | 671 |
| 44 | 3300005345 | Ga0070692_10010824 | Ga0070692_100108243 | 671 |
| 45 | 3300005563 | Ga0068855_100011711 | Ga0068855_1000117115 | 671 |
| 46 | 3300013104 | Ga0157370_10007551 | Ga0157370_100075519 | 671 |
| 47 | 3300025909 | Ga0207705_10002857 | Ga0207705_100028577 | 671 |
| 48 | 3300025919 | Ga0207657_10001484 | Ga0207657_1000148414 | 671 |
| 49 | 3300026067 | Ga0207678_10000938 | Ga0207678_1000093814 | 671 |
| 50 | 3300037312 | Ga0395899_0000917 | Ga0395899_0000917_12471_14660 | 671 |
| 51 | 3300037418 | Ga0395900_0000031 | Ga0395900_0000031_146315_148504 | 671 |
| 52 | 3300037466 | Ga0395898_0030407 | Ga0395898_0030407_1969_4149 | 671 |
| 53 | 3300037471 | Ga0395905_0008097 | Ga0395905_0008097_3728_5908 | 671 |
| 54 | 3300038443 | Ga0395901_0000035 | Ga0395901_0000035_137408_139597 | 671 |
| 55 | 3300038443 | Ga0395901_0007679 | Ga0395901_0007679_875_3055 | 671 |
| 56 | 3300005339 | Ga0070660_100009453 | Ga0070660_1000094532 | 672 |
| 57 | 3300005458 | Ga0070681_10052462 | Ga0070681_100524622 | 672 |
| 58 | 3300013105 | Ga0157369_10000833 | Ga0157369_1000083331 | 672 |
| 59 | 3300025944 | Ga0207661_10002284 | Ga0207661_1000228411 | 672 |
| 60 | 3300037418 | Ga0395900_0002298 | Ga0395900_0002298_6052_8244 | 672 |
| 61 | 3300037466 | Ga0395898_0006882 | Ga0395898_0006882_5851_8043 | 672 |
| 62 | 3300037471 | Ga0395905_0007737 | Ga0395905_0007737_298_2490 | 672 |
| 63 | 3300038443 | Ga0395901_0002827 | Ga0395901_0002827_11284_13476 | 672 |
| 64 | 3300035170 | Ga0373943_0005550 | Ga0373943_0005550_280_2463 | 673 |
| 65 | 3300013105 | Ga0157369_10041256 | Ga0157369_100412562 | 674 |
| 66 | 3300026067 | Ga0207678_10002130 | Ga0207678_1000213013 | 674 |
| 67 | 3300044693 | Ga0466961_0049053 | Ga0466961_0049053_416_2524 | 676 |
| 68 | 3300044684 | Ga0466966_0000007 | Ga0466966_0000007_66736_68955 | 678 |
| 69 | 3300005355 | Ga0070671_100004315 | Ga0070671_1000043152 | 679 |
| 70 | 3300009177 | Ga0105248_10046967 | Ga0105248_100469673 | 679 |
| 71 | 3300013105 | Ga0157369_10069148 | Ga0157369_100691482 | 679 |
| 72 | 3300026121 | Ga0207683_10005385 | Ga0207683_100053859 | 679 |
| 73 | 3300038443 | Ga0395901_0010261 | Ga0395901_0010261_3075_5267 | 679 |
| 74 | 3300005841 | Ga0068863_100000196 | Ga0068863_10000019639 | 680 |
| 75 | 3300009177 | Ga0105248_10023493 | Ga0105248_100234934 | 680 |
| 76 | 3300026088 | Ga0207641_10001363 | Ga0207641_1000136319 | 680 |
| 77 | 3300044693 | Ga0466961_0053089 | Ga0466961_0053089_86_2359 | 680 |
| 78 | 3300044719 | Ga0466971_0003966 | Ga0466971_0003966_3134_5407 | 680 |
| 79 | 3300044842 | Ga0466957_0008377 | Ga0466957_0008377_3562_5835 | 680 |
| 80 | 3300045836 | Ga0466958_0013543 | Ga0466958_0013543_1647_3920 | 680 |
| 81 | 3300045976 | Ga0466967_0020679 | Ga0466967_0020679_576_2849 | 680 |
| 82 | 3300005327 | Ga0070658_10000085 | Ga0070658_1000008561 | 681 |
| 83 | 3300005339 | Ga0070660_100006379 | Ga0070660_1000063797 | 681 |
| 84 | 3300005617 | Ga0068859_100006121 | Ga0068859_1000061217 | 681 |
| 85 | 3300006931 | Ga0097620_100006121 | Ga0097620_1000061218 | 681 |
| 86 | 3300025909 | Ga0207705_10000116 | Ga0207705_1000011660 | 681 |
| 87 | 3300025919 | Ga0207657_10001933 | Ga0207657_100019334 | 681 |
| 88 | 3300005355 | Ga0070671_100033649 | Ga0070671_1000336492 | 682 |
| 89 | 3300005563 | Ga0068855_100007701 | Ga0068855_1000077013 | 682 |
| 90 | 3300013102 | Ga0157371_10005987 | Ga0157371_100059877 | 682 |
| 91 | 3300025909 | Ga0207705_10001216 | Ga0207705_1000121615 | 682 |
| 92 | 3300025919 | Ga0207657_10000128 | Ga0207657_1000012857 | 682 |
| 93 | 3300025931 | Ga0207644_10001492 | Ga0207644_100014929 | 682 |
| 94 | 3300042005 | Ga0439448_0001334 | Ga0439448_0001334_3400_5682 | 682 |
| 95 | 3300031995 | Ga0307409_100009539 | Ga0307409_1000095392 | 685 |
| 96 | 3300013105 | Ga0157369_10068869 | Ga0157369_100688692 | 686 |
| 97 | 3300037418 | Ga0395900_0140390 | Ga0395900_0140390_117_2330 | 687 |
| 98 | 3300038443 | Ga0395901_0008874 | Ga0395901_0008874_2345_4558 | 687 |
| 99 | 3300005577 | Ga0068857_100014813 | Ga0068857_1000148133 | 688 |
| 100 | 3300005614 | Ga0068856_100010054 | Ga0068856_1000100547 | 688 |
| 101 | 3300005616 | Ga0068852_100000283 | Ga0068852_10000028325 | 688 |
| 102 | 3300025933 | Ga0207706_10045179 | Ga0207706_100451792 | 688 |
| 103 | 3300026142 | Ga0207698_10000396 | Ga0207698_1000039613 | 688 |
| 104 | 3300005329 | Ga0070683_100054116 | Ga0070683_1000541162 | 689 |
| 105 | 3300005455 | Ga0070663_100003932 | Ga0070663_1000039327 | 689 |
| 106 | 3300025944 | Ga0207661_10013298 | Ga0207661_100132984 | 689 |
| 107 | 3300026067 | Ga0207678_10054866 | Ga0207678_100548662 | 689 |
| 108 | 3300037466 | Ga0395898_0016527 | Ga0395898_0016527_3701_5842 | 689 |
| 109 | 3300010375 | Ga0105239_10030202 | Ga0105239_100302021 | 690 |
| 110 | 3300046460 | Ga0495638_0016032 | Ga0495638_0016032_1277_3451 | 690 |
| 111 | 3300046506 | Ga0495583_0000500 | Ga0495583_0000500_29182_31356 | 690 |
| 112 | 3300053103 | Ga0500555_001130 | Ga0500555_001130_6040_8214 | 690 |
| 113 | 3300005455 | Ga0070663_100046004 | Ga0070663_1000460041 | 691 |
| 114 | 3300025909 | Ga0207705_10001160 | Ga0207705_1000116014 | 691 |
| 115 | 3300025919 | Ga0207657_10000578 | Ga0207657_1000057834 | 691 |
| 116 | 3300026067 | Ga0207678_10018646 | Ga0207678_100186465 | 691 |
| 117 | 3300026142 | Ga0207698_10061778 | Ga0207698_100617782 | 691 |
| 118 | 3300037471 | Ga0395905_0077151 | Ga0395905_0077151_691_2961 | 691 |
| 119 | 3300025919 | Ga0207657_10027947 | Ga0207657_100279472 | 692 |
| 120 | 3300026067 | Ga0207678_10023290 | Ga0207678_100232902 | 692 |
| 121 | 3300046691 | Ga0495670_0000359 | Ga0495670_0000359_11522_13720 | 692 |
| 122 | 3300037418 | Ga0395900_0034324 | Ga0395900_0034324_482_2755 | 693 |
| 123 | 3300005530 | Ga0070679_100026979 | Ga0070679_1000269793 | 694 |
| 124 | 3300013105 | Ga0157369_10029888 | Ga0157369_100298882 | 694 |
| 125 | 3300025909 | Ga0207705_10001553 | Ga0207705_100015532 | 694 |
| 126 | 3300005355 | Ga0070671_100009278 | Ga0070671_1000092784 | 695 |
| 127 | 3300005356 | Ga0070674_100008098 | Ga0070674_1000080985 | 695 |
| 128 | 3300005366 | Ga0070659_100043937 | Ga0070659_1000439372 | 695 |
| 129 | 3300005564 | Ga0070664_100007628 | Ga0070664_1000076286 | 695 |
| 130 | 3300005618 | Ga0068864_100020652 | Ga0068864_1000206522 | 695 |
| 131 | 3300013100 | Ga0157373_10052285 | Ga0157373_100522851 | 695 |
| 132 | 3300013102 | Ga0157371_10026571 | Ga0157371_100265712 | 695 |
| 133 | 3300025904 | Ga0207647_10004524 | Ga0207647_100045243 | 695 |
| 134 | 3300025919 | Ga0207657_10027251 | Ga0207657_100272513 | 695 |
| 135 | 3300025931 | Ga0207644_10002030 | Ga0207644_1000203010 | 695 |
| 136 | 3300025933 | Ga0207706_10011529 | Ga0207706_100115295 | 695 |
| 137 | 3300026067 | Ga0207678_10016841 | Ga0207678_100168412 | 695 |
| 138 | 3300026088 | Ga0207641_10017938 | Ga0207641_100179382 | 695 |
| 139 | 3300026095 | Ga0207676_10015812 | Ga0207676_100158122 | 695 |
| 140 | 3300048905 | Ga0496102_0069691 | Ga0496102_0069691_717_2882 | 695 |
| 141 | 3300005564 | Ga0070664_100032808 | Ga0070664_1000328083 | 696 |
| 142 | 3300001904 | JGI24736J21556_1000133 | JGI24736J21556_100013313 | 697 |
| 143 | 3300005366 | Ga0070659_100006731 | Ga0070659_1000067316 | 697 |
| 144 | 3300005539 | Ga0068853_100044220 | Ga0068853_1000442202 | 697 |
| 145 | 3300005564 | Ga0070664_100010862 | Ga0070664_1000108622 | 697 |
| 146 | 3300013105 | Ga0157369_10061950 | Ga0157369_100619503 | 697 |
| 147 | 3300025909 | Ga0207705_10003678 | Ga0207705_100036789 | 697 |
| 148 | 3300025919 | Ga0207657_10033280 | Ga0207657_100332802 | 697 |
| 149 | 3300025920 | Ga0207649_10002611 | Ga0207649_100026118 | 697 |
| 150 | 3300025920 | Ga0207649_10002642 | Ga0207649_100026426 | 697 |
| 151 | 3300025920 | Ga0207649_10015274 | Ga0207649_100152742 | 697 |
| 152 | 3300026142 | Ga0207698_10010717 | Ga0207698_100107172 | 697 |
| 153 | 3300037466 | Ga0395898_0015757 | Ga0395898_0015757_4460_6739 | 697 |
| 154 | 3300037471 | Ga0395905_0013367 | Ga0395905_0013367_2424_4637 | 697 |
| 155 | 3300025909 | Ga0207705_10053542 | Ga0207705_100535422 | 698 |
| 156 | 3300025919 | Ga0207657_10001403 | Ga0207657_1000140310 | 698 |
| 157 | 3300025919 | Ga0207657_10010341 | Ga0207657_100103417 | 698 |
| 158 | 3300025924 | Ga0207694_10021239 | Ga0207694_100212393 | 698 |
| 159 | 3300025981 | Ga0207640_10000777 | Ga0207640_100007772 | 698 |
| 160 | 3300005329 | Ga0070683_100048372 | Ga0070683_1000483722 | 699 |
| 161 | 3300005355 | Ga0070671_100000661 | Ga0070671_10000066116 | 699 |
| 162 | 3300025919 | Ga0207657_10013564 | Ga0207657_100135642 | 699 |
| 163 | 3300025919 | Ga0207657_10024379 | Ga0207657_100243792 | 699 |
| 164 | 3300025942 | Ga0207689_10006472 | Ga0207689_100064728 | 699 |
| 165 | 3300026067 | Ga0207678_10011950 | Ga0207678_100119503 | 699 |
| 166 | 3300026116 | Ga0207674_10026648 | Ga0207674_100266484 | 699 |
| 167 | iso_pu_bacteria | 2896429255 | 2896430463 | 700 |
| 168 | 3300002067 | JGI24735J21928_10014820 | JGI24735J21928_100148201 | 701 |
| 169 | 3300001990 | JGI24737J22298_10001558 | JGI24737J22298_100015587 | 703 |
| 170 | 3300002067 | JGI24735J21928_10011326 | JGI24735J21928_100113262 | 703 |
| 171 | 3300002077 | JGI24744J21845_10002556 | JGI24744J21845_100025562 | 703 |
| 172 | 3300005327 | Ga0070658_10000105 | Ga0070658_1000010537 | 703 |
| 173 | 3300005339 | Ga0070660_100019515 | Ga0070660_1000195153 | 703 |
| 174 | 3300005354 | Ga0070675_100001145 | Ga0070675_1000011457 | 703 |
| 175 | 3300005366 | Ga0070659_100006185 | Ga0070659_1000061858 | 703 |
| 176 | 3300005455 | Ga0070663_100000399 | Ga0070663_1000003995 | 703 |
| 177 | 3300005456 | Ga0070678_100012801 | Ga0070678_1000128012 | 703 |
| 178 | 3300005539 | Ga0068853_100104581 | Ga0068853_1001045812 | 703 |
| 179 | 3300005578 | Ga0068854_100000961 | Ga0068854_1000009612 | 703 |
| 180 | 3300006237 | Ga0097621_100010271 | Ga0097621_1000102715 | 703 |
| 181 | 3300006358 | Ga0068871_100033122 | Ga0068871_1000331222 | 703 |
| 182 | 3300013296 | Ga0157374_10030626 | Ga0157374_100306264 | 703 |
| 183 | 3300025254 | Ga0209148_1000398 | Ga0209148_10003985 | 703 |
| 184 | 3300025909 | Ga0207705_10000022 | Ga0207705_1000002260 | 703 |
| 185 | 3300025919 | Ga0207657_10005740 | Ga0207657_100057404 | 703 |
| 186 | 3300025931 | Ga0207644_10026606 | Ga0207644_100266062 | 703 |
| 187 | 3300025932 | Ga0207690_10012959 | Ga0207690_100129593 | 703 |
| 188 | 3300025981 | Ga0207640_10000532 | Ga0207640_100005326 | 703 |
| 189 | 3300026067 | Ga0207678_10005875 | Ga0207678_100058756 | 703 |
| 190 | 3300026121 | Ga0207683_10010313 | Ga0207683_100103133 | 703 |
| 191 | 3300044693 | Ga0466961_0005022 | Ga0466961_0005022_5491_7761 | 703 |
| 192 | 3300044765 | Ga0466970_0002752 | Ga0466970_0002752_2791_5061 | 703 |
| 193 | 3300045049 | Ga0466959_0007216 | Ga0466959_0007216_2883_5153 | 703 |
| 194 | 3300005338 | Ga0068868_100000117 | Ga0068868_10000011716 | 704 |
| 195 | 3300009098 | Ga0105245_10000146 | Ga0105245_1000014622 | 704 |
| 196 | 3300011119 | Ga0105246_10010334 | Ga0105246_100103343 | 704 |
| 197 | 3300025961 | Ga0207712_10014830 | Ga0207712_100148302 | 704 |
| 198 | 3300026023 | Ga0207677_10000851 | Ga0207677_1000085112 | 704 |
| 199 | 3300025904 | Ga0207647_10020352 | Ga0207647_100203523 | 705 |
| 200 | 3300001989 | JGI24739J22299_10001641 | JGI24739J22299_100016414 | 707 |
| 201 | 3300001989 | JGI24739J22299_10001632 | JGI24739J22299_100016326 | 708 |
| 202 | 3300002067 | JGI24735J21928_10000908 | JGI24735J21928_100009082 | 708 |
| 203 | 3300002075 | JGI24738J21930_10000203 | JGI24738J21930_1000020316 | 708 |
| 204 | 3300005328 | Ga0070676_10000215 | Ga0070676_1000021518 | 708 |
| 205 | 3300005334 | Ga0068869_100014287 | Ga0068869_1000142872 | 708 |
| 206 | 3300005364 | Ga0070673_100000007 | Ga0070673_10000000784 | 708 |
| 207 | 3300005457 | Ga0070662_100001894 | Ga0070662_1000018949 | 708 |
| 208 | 3300005457 | Ga0070662_100002782 | Ga0070662_1000027829 | 708 |
| 209 | 3300005459 | Ga0068867_100000010 | Ga0068867_10000001084 | 708 |
| 210 | 3300006881 | Ga0068865_100000008 | Ga0068865_10000000877 | 708 |
| 211 | 3300009148 | Ga0105243_10000080 | Ga0105243_1000008072 | 708 |
| 212 | 3300013296 | Ga0157374_10000464 | Ga0157374_1000046429 | 708 |
| 213 | 3300013308 | Ga0157375_10012796 | Ga0157375_100127966 | 708 |
| 214 | 3300014969 | Ga0157376_10000087 | Ga0157376_1000008730 | 708 |
| 215 | 3300025904 | Ga0207647_10000654 | Ga0207647_100006547 | 708 |
| 216 | 3300025907 | Ga0207645_10000993 | Ga0207645_1000099318 | 708 |
| 217 | 3300025933 | Ga0207706_10002860 | Ga0207706_100028605 | 708 |
| 218 | 3300025934 | Ga0207686_10003062 | Ga0207686_100030625 | 708 |
| 219 | 3300025935 | Ga0207709_10000345 | Ga0207709_100003458 | 708 |
| 220 | 3300025938 | Ga0207704_10000013 | Ga0207704_1000001372 | 708 |
| 221 | 3300025942 | Ga0207689_10003311 | Ga0207689_100033112 | 708 |
| 222 | 3300025960 | Ga0207651_10000013 | Ga0207651_1000001384 | 708 |
| 223 | 3300026089 | Ga0207648_10000025 | Ga0207648_1000002534 | 708 |
| 224 | 3300042157 | Ga0439458_0000143 | Ga0439458_0000143_11242_13530 | 708 |
| 225 | 3300044719 | Ga0466971_0000515 | Ga0466971_0000515_4025_6244 | 709 |
| 226 | 3300044842 | Ga0466957_0000606 | Ga0466957_0000606_13015_15234 | 709 |
| 227 | 3300013307 | Ga0157372_10045825 | Ga0157372_100458252 | 712 |
| 228 | 3300026041 | Ga0207639_10010647 | Ga0207639_100106475 | 712 |
| 229 | iso_pu_bacteria | 2885429604 | 2885429843 | 712 |
| 230 | 3300005327 | Ga0070658_10023935 | Ga0070658_100239353 | 713 |
| 231 | 3300005339 | Ga0070660_100009047 | Ga0070660_1000090472 | 713 |
| 232 | 3300005339 | Ga0070660_100065745 | Ga0070660_1000657452 | 713 |
| 233 | 3300009093 | Ga0105240_10190880 | Ga0105240_101908801 | 713 |
| 234 | 3300013104 | Ga0157370_10020226 | Ga0157370_100202263 | 713 |
| 235 | 3300025272 | Ga0209455_1000513 | Ga0209455_100051326 | 713 |
| 236 | 3300025909 | Ga0207705_10002147 | Ga0207705_1000214711 | 713 |
| 237 | 3300025919 | Ga0207657_10014614 | Ga0207657_100146145 | 713 |
| 238 | 3300039437 | Ga0436365_0228661 | Ga0436365_0228661_11637_13850 | 713 |
| 239 | 3300046507 | Ga0495606_0002862 | Ga0495606_0002862_3348_5603 | 714 |
| 240 | 3300047472 | Ga0495686_0000119 | Ga0495686_0000119_45855_48125 | 714 |
| 241 | 3300005563 | Ga0068855_100062702 | Ga0068855_1000627022 | 715 |
| 242 | 3300005614 | Ga0068856_100021442 | Ga0068856_1000214422 | 715 |
| 243 | 3300013102 | Ga0157371_10005025 | Ga0157371_100050257 | 715 |
| 244 | 3300013105 | Ga0157369_10018048 | Ga0157369_100180482 | 715 |
| 245 | 3300025949 | Ga0207667_10011888 | Ga0207667_100118885 | 715 |
| 246 | 3300026078 | Ga0207702_10011063 | Ga0207702_100110636 | 715 |
| 247 | 3300003323 | rootH1_10002704 | rootH1_100027042 | 716 |
| 248 | 3300005563 | Ga0068855_100000586 | Ga0068855_10000058643 | 716 |
| 249 | 3300025949 | Ga0207667_10000113 | Ga0207667_1000011376 | 716 |
| 250 | 3300042005 | Ga0439448_0004603 | Ga0439448_0004603_480_2756 | 717 |
| 251 | 3300042157 | Ga0439458_0003356 | Ga0439458_0003356_1200_3476 | 717 |
| 252 | 3300048925 | Ga0496122_0004196 | Ga0496122_0004196_12295_14550 | 717 |
| 253 | 3300048926 | Ga0496123_0004429 | Ga0496123_0004429_6925_9180 | 717 |
| 254 | 3300048927 | Ga0496124_0006016 | Ga0496124_0006016_7078_9333 | 717 |
| 255 | 3300001990 | JGI24737J22298_10005463 | JGI24737J22298_100054633 | 719 |
| 256 | 3300025932 | Ga0207690_10006036 | Ga0207690_100060362 | 719 |
| 257 | 3300048920 | Ga0496117_0006668 | Ga0496117_0006668_3104_5416 | 719 |
| 258 | 3300048921 | Ga0496118_0026809 | Ga0496118_0026809_2309_4621 | 719 |
| 259 | 3300048922 | Ga0496119_0006901 | Ga0496119_0006901_1620_3932 | 719 |
| 260 | 3300048924 | Ga0496121_0009586 | Ga0496121_0009586_3039_5351 | 719 |
| 261 | 3300048925 | Ga0496122_0009076 | Ga0496122_0009076_4936_7248 | 719 |
| 262 | 3300048926 | Ga0496123_0002216 | Ga0496123_0002216_12240_14552 | 719 |
| 263 | 3300048928 | Ga0496125_0010772 | Ga0496125_0010772_1762_4074 | 719 |
| 264 | 3300005327 | Ga0070658_10000001 | Ga0070658_10000001334 | 720 |
| 265 | 3300005339 | Ga0070660_100000177 | Ga0070660_10000017724 | 720 |
| 266 | 3300021384 | Ga0213876_10000596 | Ga0213876_100005968 | 720 |
| 267 | 3300026041 | Ga0207639_10007247 | Ga0207639_100072473 | 720 |
| 268 | 3300026116 | Ga0207674_10020763 | Ga0207674_100207635 | 720 |
| 269 | 3300039437 | Ga0436365_1205090 | Ga0436365_1205090_118552_120879 | 720 |
| 270 | 3300003214 | JGI25165J46597_1000050 | JGI25165J46597_100005072 | 721 |
| 271 | 3300005614 | Ga0068856_100046021 | Ga0068856_1000460211 | 721 |
| 272 | 3300013104 | Ga0157370_10000063 | Ga0157370_1000006385 | 721 |
| 273 | 3300025231 | Ga0207427_102080 | Ga0207427_1020802 | 721 |
| 274 | 3300025250 | Ga0209026_1000658 | Ga0209026_100065813 | 721 |
| 275 | 3300025261 | Ga0209233_1000041 | Ga0209233_1000041249 | 721 |
| 276 | 3300037312 | Ga0395899_0012993 | Ga0395899_0012993_1775_4093 | 721 |
| 277 | 3300053727 | Ga0500611_000447 | Ga0500611_000447_1655_3898 | 721 |
| 278 | 3300001904 | JGI24736J21556_1000044 | JGI24736J21556_100004414 | 723 |
| 279 | 3300002067 | JGI24735J21928_10001091 | JGI24735J21928_100010918 | 723 |
| 280 | 3300005327 | Ga0070658_10005651 | Ga0070658_100056513 | 723 |
| 281 | 3300005466 | Ga0070685_10003957 | Ga0070685_100039574 | 723 |
| 282 | 3300005548 | Ga0070665_100000036 | Ga0070665_100000036324 | 723 |
| 283 | 3300013100 | Ga0157373_10054135 | Ga0157373_100541352 | 723 |
| 284 | 3300013105 | Ga0157369_10008366 | Ga0157369_100083662 | 723 |
| 285 | 3300025904 | Ga0207647_10000352 | Ga0207647_1000035211 | 723 |
| 286 | 3300025909 | Ga0207705_10000002 | Ga0207705_100000021546 | 723 |
| 287 | 3300025913 | Ga0207695_10001723 | Ga0207695_1000172312 | 723 |
| 288 | 3300025914 | Ga0207671_10003257 | Ga0207671_100032578 | 723 |
| 289 | 3300025919 | Ga0207657_10000082 | Ga0207657_1000008219 | 723 |
| 290 | 3300025924 | Ga0207694_10001459 | Ga0207694_100014593 | 723 |
| 291 | 3300025932 | Ga0207690_10017194 | Ga0207690_100171942 | 723 |
| 292 | 3300025936 | Ga0207670_10015542 | Ga0207670_100155422 | 723 |
| 293 | 3300025949 | Ga0207667_10020242 | Ga0207667_100202423 | 723 |
| 294 | 3300026078 | Ga0207702_10000335 | Ga0207702_1000033520 | 723 |
| 295 | 3300026116 | Ga0207674_10009274 | Ga0207674_100092743 | 723 |
| 296 | 3300028379 | Ga0268266_10000042 | Ga0268266_1000004217 | 723 |
| 297 | 3300001976 | JGI24752J21851_1000034 | JGI24752J21851_10000343 | 724 |
| 298 | 3300002074 | JGI24748J21848_1000032 | JGI24748J21848_100003262 | 724 |
| 299 | 3300002076 | JGI24749J21850_1000476 | JGI24749J21850_10004762 | 724 |
| 300 | 3300002239 | JGI24034J26672_10000022 | JGI24034J26672_10000022103 | 724 |
| 301 | 3300002244 | JGI24742J22300_10000557 | JGI24742J22300_100005574 | 724 |
| 302 | 3300005330 | Ga0070690_100000056 | Ga0070690_10000005612 | 724 |
| 303 | 3300005331 | Ga0070670_100033691 | Ga0070670_1000336912 | 724 |
| 304 | 3300005335 | Ga0070666_10000002 | Ga0070666_1000000217 | 724 |
| 305 | 3300005353 | Ga0070669_100000170 | Ga0070669_10000017016 | 724 |
| 306 | 3300005367 | Ga0070667_100010510 | Ga0070667_1000105102 | 724 |
| 307 | 3300005544 | Ga0070686_100000335 | Ga0070686_10000033517 | 724 |
| 308 | 3300005617 | Ga0068859_100011388 | Ga0068859_1000113888 | 724 |
| 309 | 3300005618 | Ga0068864_100010218 | Ga0068864_1000102182 | 724 |
| 310 | 3300005841 | Ga0068863_100000095 | Ga0068863_10000009582 | 724 |
| 311 | 3300005842 | Ga0068858_100002740 | Ga0068858_1000027409 | 724 |
| 312 | 3300005843 | Ga0068860_100000001 | Ga0068860_10000000117 | 724 |
| 313 | 3300005844 | Ga0068862_100000350 | Ga0068862_10000035032 | 724 |
| 314 | 3300006931 | Ga0097620_100011389 | Ga0097620_1000113898 | 724 |
| 315 | 3300009553 | Ga0105249_10000026 | Ga0105249_1000002616 | 724 |
| 316 | 3300013306 | Ga0163162_10118669 | Ga0163162_101186691 | 724 |
| 317 | 3300014326 | Ga0157380_10001342 | Ga0157380_1000134212 | 724 |
| 318 | 3300017792 | Ga0163161_10000008 | Ga0163161_10000008291 | 724 |
| 319 | 3300025903 | Ga0207680_10000004 | Ga0207680_10000004843 | 724 |
| 320 | 3300025931 | Ga0207644_10000755 | Ga0207644_1000075512 | 724 |
| 321 | 3300025961 | Ga0207712_10000001 | Ga0207712_10000001717 | 724 |
| 322 | 3300025986 | Ga0207658_10004409 | Ga0207658_100044095 | 724 |
| 323 | 3300026035 | Ga0207703_10001677 | Ga0207703_100016777 | 724 |
| 324 | 3300026088 | Ga0207641_10000148 | Ga0207641_1000014881 | 724 |
| 325 | 3300026095 | Ga0207676_10001987 | Ga0207676_100019874 | 724 |
| 326 | 3300026118 | Ga0207675_100001093 | Ga0207675_10000109316 | 724 |
| 327 | 3300028380 | Ga0268265_10000481 | Ga0268265_100004818 | 724 |
| 328 | 3300028381 | Ga0268264_10000006 | Ga0268264_10000006843 | 724 |
| 329 | 3300048903 | Ga0496100_0029808 | Ga0496100_0029808_159_2405 | 724 |
| 330 | 3300048905 | Ga0496102_0008737 | Ga0496102_0008737_5294_7540 | 724 |
| 331 | 3300048906 | Ga0496103_0002569 | Ga0496103_0002569_2857_5103 | 724 |
| 332 | 3300048920 | Ga0496117_0007680 | Ga0496117_0007680_6701_8947 | 724 |
| 333 | 3300053087 | Ga0500643_000129 | Ga0500643_000129_5390_7636 | 724 |
| 334 | 2162886007 | SwRhRL2b_contig_424476 | SwRhRL2b_0486.00000910 | 725 |
| 335 | 3300001976 | JGI24752J21851_1000290 | JGI24752J21851_10002905 | 725 |
| 336 | 3300005289 | Ga0065704_10074248 | Ga0065704_100742485 | 725 |
| 337 | 3300005295 | Ga0065707_10086897 | Ga0065707_100868973 | 725 |
| 338 | 3300005331 | Ga0070670_100000016 | Ga0070670_100000016105 | 725 |
| 339 | 3300005367 | Ga0070667_100000528 | Ga0070667_10000052812 | 725 |
| 340 | 3300005618 | Ga0068864_100000017 | Ga0068864_100000017184 | 725 |
| 341 | 3300005841 | Ga0068863_100000018 | Ga0068863_100000018104 | 725 |
| 342 | 3300005844 | Ga0068862_100000010 | Ga0068862_100000010127 | 725 |
| 343 | 3300009011 | Ga0105251_10001597 | Ga0105251_100015974 | 725 |
| 344 | 3300009101 | Ga0105247_10002227 | Ga0105247_100022277 | 725 |
| 345 | 3300009177 | Ga0105248_10000105 | Ga0105248_1000010532 | 725 |
| 346 | 3300009553 | Ga0105249_10000207 | Ga0105249_1000020744 | 725 |
| 347 | 3300013306 | Ga0163162_10042267 | Ga0163162_100422672 | 725 |
| 348 | 3300014968 | Ga0157379_10008804 | Ga0157379_100088043 | 725 |
| 349 | 3300025735 | Ga0207713_1006527 | Ga0207713_10065273 | 725 |
| 350 | 3300025925 | Ga0207650_10000057 | Ga0207650_10000057106 | 725 |
| 351 | 3300025941 | Ga0207711_10000031 | Ga0207711_10000031127 | 725 |
| 352 | 3300025961 | Ga0207712_10000234 | Ga0207712_1000023423 | 725 |
| 353 | 3300025986 | Ga0207658_10001812 | Ga0207658_1000181212 | 725 |
| 354 | 3300026088 | Ga0207641_10000002 | Ga0207641_10000002359 | 725 |
| 355 | 3300026095 | Ga0207676_10000005 | Ga0207676_10000005449 | 725 |
| 356 | 3300028380 | Ga0268265_10000003 | Ga0268265_10000003631 | 725 |
| 357 | 3300048921 | Ga0496118_0000332 | Ga0496118_0000332_45629_47878 | 725 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7omm-assembly1.cif.gz_A | cryo-em structure of n. gonorhoeae lptde in complex with promacrobodies (mbps have not been built de novo) | 0.7694 | 54 | 720 |
| 4rhb-assembly1.cif.gz_A | crystal structure of the lipopolysaccharide assembly complex lptd-lpte from the escherichia coli outer membrane | 0.7632 | 205 | 720 |
| 4n4r-assembly1.cif.gz_A | structure basis of lipopolysaccharide biogenesis | 0.759 | 201 | 714 |
| 4q35-assembly1.cif.gz_A | structure of a membrane protein | 0.7472 | 51 | 725 |
| 5iv9-assembly1.cif.gz_A | the lps transporter lptde from klebsiella pneumoniae, full-length | 0.7465 | 42 | 725 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4E1S3_6_80_2.30.30.100 | Mainly Beta;Roll;SH3 type barrels.; | 0.7688 | 153 | 196 | 2.30.30.100 |
| 2r1aH00 | Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain | 0.649 | 51 | 185 | 2.60.450.10 |
| 2r1aH00 | Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain | 0.6149 | 51 | 185 | 2.60.450.10 |
| af_P31554_308_697_2.40.160.50 | Mainly Beta;Beta Barrel;Porin;membrane protein fhac: a member of the omp85/tpsb transporter family | 0.5738 | 286 | 720 | 2.40.160.50 |
| af_Q8I3T2_91_272_3.90.1150.210 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;F-actin capping protein, beta subunit | 0.5683 | 367 | 459 | 3.90.1150.210 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q7TPX9-F1-model_v4 | LPS-assembly protein LptD | 0.857 | 51 | 724 |
GO:0009279
GO:0015920 GO:0043165 GO:1990351 |
| AF-A0A6N8UUJ9-F1-model_v4 | LPS-assembly protein LptD | 0.8561 | 201 | 725 |
GO:0009279
GO:0061024 GO:1990351 |
| AF-A0A7C3VM34-F1-model_v4 | LPS-assembly protein LptD | 0.8467 | 50 | 725 |
GO:0009279
GO:0015920 GO:0043165 GO:1990351 |
| AF-A0A1W6BE85-F1-model_v4 | LPS-assembly protein LptD | 0.8446 | 54 | 725 |
GO:0009279
GO:0015920 GO:0043165 GO:1990351 |
| AF-A0A527CVJ0-F1-model_v4 | LPS-assembly protein LptD | 0.8397 | 97 | 218 |
GO:0009279
GO:1990351 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar