F420694

General Info

Members Datasets Scaffolds Average Seq Length
357 172 355 722

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10005463|JGI24737J22298_100054633
Length 803
Sequence MPRLLGARPGLSKASVLRFDDWAIAVFRDCGGEQAAIGPRPMQRRTSWGRKGAATASLAAVIAACXXXXQAQDLNAHRAEXXXXTAESKTAPEDEVTFSAAQLDYDDNADIVTATGDVRMFRNGARLRADKVTWNRQTGEVRAIGNVAVVNANGDKAYADDIQLTDELHDGVANNMLLVLANGGRLAAMHGERKGDITTLNQAAYTPCQVEDRHGCPKRPSWQITAVRVVVDEGKHRISYRDARFALFGQTILALPAFSHPDGSESGRGNSGLLLPNLQVNKSNGVEIDLPYYLQIGPNRDLTITPHFYTAVLPALEAQYRTLTGNGAYQVSGMVTYGARLPATSNNAAGSAGTTPAESNDTFRGYLDANGTWQLGPYWTVHGALRLTTDRTFMKRYYISNDDRLRSTVKAERIDADSYLSIAGWFVQDLRPGYVEGQQPIALPAIDYRRRFHDPLLGGVVTAQLNSLALTRTDGQDTQRAFAGLRWDLRTLTPIGQEVIFTAYTRADIYHTDNSAATVTPLYRGTDGWHGRGIAALAADMRWPFIGALLGGVQQIVPRVQLVAEPKIRNLDIPDEDSRAVDLEDSNLFALNRFSGYDRWEDSSRITYGGEWNYTRPKLEIRTVIGQSYRLSSEPTILPPGTGLSDRFSDYVGRVSVRYGKWIEVTERFRLDKDNFAVRRNEIDATVGSRNTYVEVGYLKLHRNIDTSIEDLRDLSEIRLGARIRLARYWSIFGSTVVDLTTRKDDPLSLSDGYQPVRHRLGLLYENECLSLGVTWRKDYDQTGDAKRGSTFSLRLALKNLGR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
3 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
171 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
172 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.24
Nodule 0
Rhizoplane 1.68
Rhizosphere 91.04
Stem 0
Stem Tuber 0
Unclassified 5.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_424476 2162886007 Bacteria 2645
2 JGI24736J21556_1000044 3300001904 Bacteria 20553
3 JGI24736J21556_1000133 3300001904 Bacteria 12833
4 JGI24752J21851_1000034 3300001976 Bacteria 16370
5 JGI24752J21851_1000290 3300001976 Bacteria 7005
6 JGI24739J22299_10001632 3300001989 Bacteria 8513
7 JGI24739J22299_10001641 3300001989 Bacteria 8490
8 JGI24737J22298_10001558 3300001990 Bacteria 8155
9 JGI24737J22298_10005463 3300001990 Bacteria 4389
10 JGI24735J21928_10000908 3300002067 Bacteria 10568
11 JGI24735J21928_10001091 3300002067 Bacteria 9690
12 JGI24735J21928_10011326 3300002067 Bacteria 2831
13 JGI24735J21928_10014820 3300002067 Bacteria 2439
14 JGI24748J21848_1000032 3300002074 Bacteria 79791
15 JGI24738J21930_10000203 3300002075 Bacteria 15854
16 JGI24749J21850_1000476 3300002076 Bacteria 5940
17 JGI24744J21845_10002556 3300002077 Bacteria 3714
18 JGI24034J26672_10000022 3300002239 Bacteria 116342
19 JGI24742J22300_10000557 3300002244 Bacteria 5587
20 JGI25165J46597_1000050 3300003214 Bacteria 242776
21 rootH1_10002704 3300003323 Bacteria 4453
22 Ga0065704_10074248 3300005289 Bacteria 6425
23 Ga0065707_10086897 3300005295 Bacteria 5252
24 Ga0070658_10000001 3300005327 Bacteria 856789
25 Ga0070658_10000085 3300005327 Bacteria 87440
26 Ga0070658_10000105 3300005327 Bacteria 75360
27 Ga0070658_10001253 3300005327 Bacteria 21758
28 Ga0070658_10005651 3300005327 Bacteria 10140
29 Ga0070658_10023935 3300005327 Bacteria 4899
30 Ga0070676_10000215 3300005328 Bacteria 24740
31 Ga0070683_100048372 3300005329 Bacteria 3931
32 Ga0070683_100054116 3300005329 Bacteria 3721
33 Ga0070690_100000056 3300005330 Bacteria 54517
34 Ga0070670_100000016 3300005331 Bacteria 226440
35 Ga0070670_100033691 3300005331 Bacteria 4411
36 Ga0068869_100014287 3300005334 Bacteria 5301
37 Ga0070666_10000002 3300005335 Bacteria 478684
38 Ga0070680_100012865 3300005336 Bacteria 6511
39 Ga0068868_100000117 3300005338 Bacteria 50053
40 Ga0070660_100000177 3300005339 Bacteria 42137
41 Ga0070660_100006379 3300005339 Bacteria 8176
42 Ga0070660_100006879 3300005339 Bacteria 7887
43 Ga0070660_100007248 3300005339 Bacteria 7720
44 Ga0070660_100009047 3300005339 Bacteria 6989
45 Ga0070660_100009453 3300005339 Bacteria 6857
46 Ga0070660_100019515 3300005339 Bacteria 4969
47 Ga0070660_100065745 3300005339 Bacteria 2822
48 Ga0070692_10002960 3300005345 Bacteria 6754
49 Ga0070692_10010824 3300005345 Bacteria 4170
50 Ga0070669_100000170 3300005353 Bacteria 57161
51 Ga0070675_100001145 3300005354 Bacteria 19138
52 Ga0070671_100000661 3300005355 Bacteria 24795
53 Ga0070671_100004315 3300005355 Bacteria 11250
54 Ga0070671_100007660 3300005355 Bacteria 8633
55 Ga0070671_100009278 3300005355 Bacteria 7902
56 Ga0070671_100033649 3300005355 Bacteria 4241
57 Ga0070674_100008098 3300005356 Bacteria 6235
58 Ga0070673_100000007 3300005364 Bacteria 177157
59 Ga0070659_100006185 3300005366 Bacteria 8646
60 Ga0070659_100006731 3300005366 Bacteria 8309
61 Ga0070659_100043937 3300005366 Bacteria 3496
62 Ga0070667_100000528 3300005367 Bacteria 38357
63 Ga0070667_100010510 3300005367 Bacteria 7642
64 Ga0070667_100105529 3300005367 Bacteria 2438
65 Ga0070663_100000399 3300005455 Bacteria 22797
66 Ga0070663_100003932 3300005455 Bacteria 8666
67 Ga0070663_100046004 3300005455 Bacteria 3085
68 Ga0070678_100012801 3300005456 Bacteria 5232
69 Ga0070662_100001894 3300005457 Bacteria 12831
70 Ga0070662_100002782 3300005457 Bacteria 10831
71 Ga0070662_100022965 3300005457 Bacteria 4280
72 Ga0070681_10052462 3300005458 Bacteria 4067
73 Ga0068867_100000010 3300005459 Bacteria 129593
74 Ga0070685_10003957 3300005466 Bacteria 7486
75 Ga0070679_100026979 3300005530 Bacteria 5649
76 Ga0068853_100044220 3300005539 Bacteria 3812
77 Ga0068853_100104581 3300005539 Bacteria 2507
78 Ga0070686_100000335 3300005544 Bacteria 30423
79 Ga0070665_100000036 3300005548 Bacteria 314603
80 Ga0068855_100000586 3300005563 Bacteria 44740
81 Ga0068855_100007701 3300005563 Bacteria 13005
82 Ga0068855_100011711 3300005563 Bacteria 10599
83 Ga0068855_100054675 3300005563 Bacteria 4692
84 Ga0068855_100062702 3300005563 Bacteria 4339
85 Ga0070664_100007628 3300005564 Bacteria 8737
86 Ga0070664_100010862 3300005564 Bacteria 7384
87 Ga0070664_100032808 3300005564 Bacteria 4345
88 Ga0068857_100014813 3300005577 Bacteria 6802
89 Ga0068854_100000961 3300005578 Bacteria 17357
90 Ga0068854_100011403 3300005578 Bacteria 5784
91 Ga0068854_100021058 3300005578 Bacteria 4421
92 Ga0068856_100005986 3300005614 Bacteria 11972
93 Ga0068856_100010054 3300005614 Bacteria 9192
94 Ga0068856_100021442 3300005614 Bacteria 6281
95 Ga0068856_100046021 3300005614 Bacteria 4297
96 Ga0068852_100000283 3300005616 Bacteria 33859
97 Ga0068852_100037570 3300005616 Bacteria 4061
98 Ga0068859_100006121 3300005617 Bacteria 12223
99 Ga0068859_100011388 3300005617 Bacteria 8944
100 Ga0068864_100000017 3300005618 Bacteria 285607
101 Ga0068864_100007304 3300005618 Bacteria 9088
102 Ga0068864_100010218 3300005618 Bacteria 7751
103 Ga0068864_100020652 3300005618 Bacteria 5511
104 Ga0068863_100000018 3300005841 Bacteria 206948
105 Ga0068863_100000095 3300005841 Bacteria 96080
106 Ga0068863_100000196 3300005841 Bacteria 64527
107 Ga0068863_100003907 3300005841 Bacteria 14718
108 Ga0068858_100002740 3300005842 Bacteria 17718
109 Ga0068860_100000001 3300005843 Bacteria 703043
110 Ga0068862_100000010 3300005844 Bacteria 285607
111 Ga0068862_100000350 3300005844 Bacteria 49916
112 Ga0097621_100010271 3300006237 Bacteria 6840
113 Ga0068871_100033122 3300006358 Bacteria 4088
114 Ga0068865_100000008 3300006881 Bacteria 177158
115 Ga0097620_100006121 3300006931 Bacteria 12223
116 Ga0097620_100011389 3300006931 Bacteria 8944
117 Ga0105251_10001597 3300009011 Bacteria 19331
118 Ga0105240_10190880 3300009093 Bacteria 2409
119 Ga0105245_10000146 3300009098 Bacteria 66619
120 Ga0105247_10002227 3300009101 Bacteria 13346
121 Ga0105243_10000080 3300009148 Bacteria 109765
122 Ga0105248_10000105 3300009177 Bacteria 94143
123 Ga0105248_10023493 3300009177 Bacteria 6848
124 Ga0105248_10046967 3300009177 Bacteria 4841
125 Ga0105249_10000026 3300009553 Bacteria 232053
126 Ga0105249_10000207 3300009553 Bacteria 67193
127 Ga0105239_10030202 3300010375 Bacteria 5958
128 Ga0105246_10010334 3300011119 Bacteria 5771
129 Ga0157373_10022902 3300013100 Bacteria 4531
130 Ga0157373_10052285 3300013100 Bacteria 2907
131 Ga0157373_10054135 3300013100 Bacteria 2852
132 Ga0157371_10005025 3300013102 Bacteria 11331
133 Ga0157371_10005987 3300013102 Bacteria 10142
134 Ga0157371_10026571 3300013102 Bacteria 4206
135 Ga0157370_10000063 3300013104 Bacteria 114697
136 Ga0157370_10007551 3300013104 Bacteria 11813
137 Ga0157370_10020226 3300013104 Bacteria 6651
138 Ga0157370_10021081 3300013104 Bacteria 6497
139 Ga0157369_10000833 3300013105 Bacteria 39452
140 Ga0157369_10008366 3300013105 Bacteria 11865
141 Ga0157369_10018048 3300013105 Bacteria 7914
142 Ga0157369_10029888 3300013105 Bacteria 6016
143 Ga0157369_10041256 3300013105 Bacteria 5038
144 Ga0157369_10061950 3300013105 Bacteria 4032
145 Ga0157369_10068869 3300013105 Bacteria 3802
146 Ga0157369_10069148 3300013105 Bacteria 3794
147 Ga0157374_10000464 3300013296 Bacteria 36789
148 Ga0157374_10020551 3300013296 Bacteria 5861
149 Ga0157374_10030626 3300013296 Bacteria 4887
150 Ga0157378_10024244 3300013297 Bacteria 5336
151 Ga0163162_10003602 3300013306 Bacteria 14833
152 Ga0163162_10042267 3300013306 Bacteria 4561
153 Ga0163162_10118669 3300013306 Bacteria 2747
154 Ga0157372_10045825 3300013307 Bacteria 4853
155 Ga0157375_10007237 3300013308 Bacteria 9706
156 Ga0157375_10012796 3300013308 Bacteria 7451
157 Ga0157380_10001342 3300014326 Bacteria 16023
158 Ga0157379_10008804 3300014968 Bacteria 8802
159 Ga0157376_10000087 3300014969 Bacteria 70163
160 Ga0163161_10000008 3300017792 Bacteria 294642
161 Ga0213876_10000596 3300021384 Bacteria 26862
162 Ga0207427_102080 3300025231 Bacteria 5887
163 Ga0209026_1000658 3300025250 Bacteria 21101
164 Ga0209148_1000398 3300025254 Bacteria 50941
165 Ga0209233_1000041 3300025261 Bacteria 515463
166 Ga0209455_1000513 3300025272 Bacteria 27536
167 Ga0207713_1006527 3300025735 Bacteria 7087
168 Ga0207680_10000004 3300025903 Bacteria 827324
169 Ga0207647_10000352 3300025904 Bacteria 37248
170 Ga0207647_10000654 3300025904 Bacteria 27108
171 Ga0207647_10004524 3300025904 Bacteria 10304
172 Ga0207647_10020352 3300025904 Bacteria 4449
173 Ga0207645_10000993 3300025907 Bacteria 23397
174 Ga0207705_10000002 3300025909 Bacteria 2046852
175 Ga0207705_10000022 3300025909 Bacteria 302232
176 Ga0207705_10000116 3300025909 Bacteria 89237
177 Ga0207705_10001160 3300025909 Bacteria 21451
178 Ga0207705_10001216 3300025909 Bacteria 20824
179 Ga0207705_10001553 3300025909 Bacteria 18222
180 Ga0207705_10002147 3300025909 Bacteria 15290
181 Ga0207705_10002857 3300025909 Bacteria 13218
182 Ga0207705_10003678 3300025909 Bacteria 11665
183 Ga0207705_10053542 3300025909 Bacteria 2907
184 Ga0207695_10001723 3300025913 Bacteria 34990
185 Ga0207695_10053252 3300025913 Bacteria 4233
186 Ga0207671_10003257 3300025914 Bacteria 16330
187 Ga0207657_10000082 3300025919 Bacteria 89667
188 Ga0207657_10000128 3300025919 Bacteria 76013
189 Ga0207657_10000578 3300025919 Bacteria 38938
190 Ga0207657_10001403 3300025919 Bacteria 25687
191 Ga0207657_10001484 3300025919 Bacteria 25105
192 Ga0207657_10001933 3300025919 Bacteria 22370
193 Ga0207657_10005740 3300025919 Bacteria 12946
194 Ga0207657_10009043 3300025919 Bacteria 10057
195 Ga0207657_10010341 3300025919 Bacteria 9312
196 Ga0207657_10013564 3300025919 Bacteria 7993
197 Ga0207657_10014614 3300025919 Bacteria 7650
198 Ga0207657_10024379 3300025919 Bacteria 5604
199 Ga0207657_10027251 3300025919 Bacteria 5235
200 Ga0207657_10027947 3300025919 Bacteria 5156
201 Ga0207657_10033280 3300025919 Bacteria 4648
202 Ga0207649_10002611 3300025920 Bacteria 10007
203 Ga0207649_10002642 3300025920 Bacteria 9952
204 Ga0207649_10015274 3300025920 Bacteria 4314
205 Ga0207694_10001459 3300025924 Bacteria 20221
206 Ga0207694_10021239 3300025924 Bacteria 4918
207 Ga0207650_10000057 3300025925 Bacteria 156913
208 Ga0207644_10000755 3300025931 Bacteria 20528
209 Ga0207644_10001492 3300025931 Bacteria 15069
210 Ga0207644_10002030 3300025931 Bacteria 13090
211 Ga0207644_10003340 3300025931 Bacteria 10349
212 Ga0207644_10026606 3300025931 Bacteria 3988
213 Ga0207690_10006036 3300025932 Bacteria 7179
214 Ga0207690_10012959 3300025932 Bacteria 4998
215 Ga0207690_10017194 3300025932 Bacteria 4412
216 Ga0207706_10002828 3300025933 Bacteria 16835
217 Ga0207706_10002860 3300025933 Bacteria 16752
218 Ga0207706_10011529 3300025933 Bacteria 8051
219 Ga0207706_10045179 3300025933 Bacteria 3903
220 Ga0207686_10003062 3300025934 Bacteria 8994
221 Ga0207709_10000345 3300025935 Bacteria 47717
222 Ga0207670_10015542 3300025936 Bacteria 4551
223 Ga0207704_10000013 3300025938 Bacteria 170478
224 Ga0207691_10018226 3300025940 Bacteria 6650
225 Ga0207711_10000031 3300025941 Bacteria 203323
226 Ga0207711_10001624 3300025941 Bacteria 20742
227 Ga0207689_10003311 3300025942 Bacteria 14744
228 Ga0207689_10006472 3300025942 Bacteria 10350
229 Ga0207661_10002284 3300025944 Bacteria 13206
230 Ga0207661_10013298 3300025944 Bacteria 6011
231 Ga0207667_10000113 3300025949 Bacteria 131083
232 Ga0207667_10011888 3300025949 Bacteria 10083
233 Ga0207667_10020242 3300025949 Bacteria 7404
234 Ga0207651_10000013 3300025960 Bacteria 177573
235 Ga0207651_10000944 3300025960 Bacteria 12804
236 Ga0207712_10000001 3300025961 Bacteria 750309
237 Ga0207712_10000234 3300025961 Bacteria 54386
238 Ga0207712_10014830 3300025961 Bacteria 5017
239 Ga0207640_10000532 3300025981 Bacteria 22823
240 Ga0207640_10000777 3300025981 Bacteria 18152
241 Ga0207640_10032166 3300025981 Bacteria 3251
242 Ga0207658_10001812 3300025986 Bacteria 15990
243 Ga0207658_10004409 3300025986 Bacteria 9786
244 Ga0207677_10000851 3300026023 Bacteria 17474
245 Ga0207703_10001677 3300026035 Bacteria 19921
246 Ga0207639_10007247 3300026041 Bacteria 7557
247 Ga0207639_10010647 3300026041 Bacteria 6368
248 Ga0207678_10000938 3300026067 Bacteria 26581
249 Ga0207678_10002130 3300026067 Bacteria 17922
250 Ga0207678_10005875 3300026067 Bacteria 10939
251 Ga0207678_10009407 3300026067 Bacteria 8599
252 Ga0207678_10011950 3300026067 Bacteria 7623
253 Ga0207678_10016841 3300026067 Bacteria 6417
254 Ga0207678_10018646 3300026067 Bacteria 6091
255 Ga0207678_10023290 3300026067 Bacteria 5416
256 Ga0207678_10054866 3300026067 Bacteria 3433
257 Ga0207702_10000335 3300026078 Bacteria 53978
258 Ga0207702_10011063 3300026078 Bacteria 7532
259 Ga0207702_10014614 3300026078 Bacteria 6516
260 Ga0207641_10000002 3300026088 Bacteria 981004
261 Ga0207641_10000148 3300026088 Bacteria 99601
262 Ga0207641_10001363 3300026088 Bacteria 24206
263 Ga0207641_10017938 3300026088 Bacteria 5799
264 Ga0207648_10000025 3300026089 Bacteria 131593
265 Ga0207676_10000005 3300026095 Bacteria 698744
266 Ga0207676_10001987 3300026095 Bacteria 14886
267 Ga0207676_10012785 3300026095 Bacteria 6023
268 Ga0207676_10015812 3300026095 Bacteria 5456
269 Ga0207674_10009274 3300026116 Bacteria 11276
270 Ga0207674_10020763 3300026116 Bacteria 7089
271 Ga0207674_10026648 3300026116 Bacteria 6132
272 Ga0207675_100001093 3300026118 Bacteria 26859
273 Ga0207683_10005385 3300026121 Bacteria 10969
274 Ga0207683_10010313 3300026121 Bacteria 7968
275 Ga0207683_10021519 3300026121 Bacteria 5523
276 Ga0207698_10000396 3300026142 Bacteria 25123
277 Ga0207698_10010717 3300026142 Bacteria 5913
278 Ga0207698_10061778 3300026142 Bacteria 2922
279 Ga0268266_10000042 3300028379 Bacteria 316826
280 Ga0268265_10000003 3300028380 Bacteria 949201
281 Ga0268265_10000481 3300028380 Bacteria 41838
282 Ga0268264_10000006 3300028381 Bacteria 827324
283 Ga0307409_100009539 3300031995 Bacteria 5971
284 Ga0307409_100043639 3300031995 Bacteria 3369
285 Ga0373943_0005550 3300035170 Bacteria 5665
286 Ga0395899_0000917 3300037312 Bacteria 27698
287 Ga0395899_0012993 3300037312 Bacteria 6371
288 Ga0395900_0000031 3300037418 Bacteria 262393
289 Ga0395900_0002298 3300037418 Bacteria 21230
290 Ga0395900_0006454 3300037418 Bacteria 12224
291 Ga0395900_0034324 3300037418 Bacteria 5223
292 Ga0395900_0140390 3300037418 Bacteria 2474
293 Ga0395900_0209055 3300037418 Bacteria 1971
294 Ga0395898_0006882 3300037466 Bacteria 12096
295 Ga0395898_0015757 3300037466 Bacteria 7747
296 Ga0395898_0016527 3300037466 Bacteria 7546
297 Ga0395898_0030407 3300037466 Bacteria 5404
298 Ga0395905_0003572 3300037471 Bacteria 16555
299 Ga0395905_0007737 3300037471 Bacteria 10661
300 Ga0395905_0008097 3300037471 Bacteria 10382
301 Ga0395905_0013367 3300037471 Bacteria 7865
302 Ga0395905_0077151 3300037471 Bacteria 3122
303 Ga0395901_0000035 3300038443 Bacteria 223888
304 Ga0395901_0002827 3300038443 Bacteria 17529
305 Ga0395901_0007679 3300038443 Bacteria 10879
306 Ga0395901_0008874 3300038443 Bacteria 10179
307 Ga0395901_0010261 3300038443 Bacteria 9488
308 Ga0395901_0032450 3300038443 Bacteria 5388
309 Ga0395901_0053922 3300038443 Bacteria 4178
310 Ga0436365_0228661 3300039437 Bacteria 14347
311 Ga0436365_1205090 3300039437 Bacteria 128002
312 Ga0439448_0001334 3300042005 Bacteria 6315
313 Ga0439448_0004603 3300042005 Bacteria 3901
314 Ga0439458_0000143 3300042157 Bacteria 15350
315 Ga0439458_0003356 3300042157 Bacteria 3762
316 Ga0466966_0000007 3300044684 Bacteria 155702
317 Ga0466961_0005022 3300044693 Bacteria 8319
318 Ga0466961_0049053 3300044693 Unclassified 2699
319 Ga0466961_0053089 3300044693 Bacteria 2587
320 Ga0466971_0000515 3300044719 Bacteria 15258
321 Ga0466971_0003966 3300044719 Bacteria 6363
322 Ga0466970_0002752 3300044765 Bacteria 8490
323 Ga0466957_0000606 3300044842 Bacteria 18172
324 Ga0466957_0008377 3300044842 Bacteria 5881
325 Ga0466959_0007216 3300045049 Bacteria 7785
326 Ga0466958_0013543 3300045836 Bacteria 4645
327 Ga0466967_0020679 3300045976 Bacteria 5327
328 Ga0495638_0016032 3300046460 Bacteria 5022
329 Ga0495583_0000500 3300046506 Bacteria 56753
330 Ga0495606_0002862 3300046507 Bacteria 19095
331 Ga0495669_0005549 3300046684 Bacteria 5262
332 Ga0495670_0000359 3300046691 Bacteria 21740
333 Ga0495686_0000119 3300047472 Bacteria 165244
334 Ga0496100_0029808 3300048903 Bacteria 3379
335 Ga0496102_0008737 3300048905 Bacteria 8692
336 Ga0496102_0069691 3300048905 Bacteria 3228
337 Ga0496103_0002569 3300048906 Bacteria 11380
338 Ga0496108_0012184 3300048911 Bacteria 6992
339 Ga0496112_0005767 3300048915 Bacteria 10770
340 Ga0496117_0006668 3300048920 Bacteria 11569
341 Ga0496117_0007680 3300048920 Bacteria 10443
342 Ga0496118_0000332 3300048921 Bacteria 80480
343 Ga0496118_0026809 3300048921 Bacteria 4897
344 Ga0496119_0006901 3300048922 Bacteria 10366
345 Ga0496121_0009586 3300048924 Bacteria 11093
346 Ga0496122_0004196 3300048925 Bacteria 18127
347 Ga0496122_0009076 3300048925 Bacteria 10550
348 Ga0496123_0002216 3300048926 Bacteria 24673
349 Ga0496123_0004429 3300048926 Bacteria 14773
350 Ga0496123_0038453 3300048926 Bacteria 3363
351 Ga0496124_0006016 3300048927 Bacteria 13378
352 Ga0496125_0010772 3300048928 Bacteria 9208
353 Ga0500643_000129 3300053087 Bacteria 77787
354 Ga0500555_001130 3300053103 Bacteria 8817
355 Ga0500611_000447 3300053727 Bacteria 4202

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0209055 Ga0395900_0209055_112_1953 613
2 3300005339 Ga0070660_100006879 Ga0070660_1000068792 641
3 3300031995 Ga0307409_100043639 Ga0307409_1000436392 642
4 3300038443 Ga0395901_0032450 Ga0395901_0032450_548_2767 645
5 3300005578 Ga0068854_100011403 Ga0068854_1000114032 647
6 3300005616 Ga0068852_100037570 Ga0068852_1000375702 647
7 3300025913 Ga0207695_10053252 Ga0207695_100532522 647
8 3300005563 Ga0068855_100054675 Ga0068855_1000546752 650
9 3300025919 Ga0207657_10009043 Ga0207657_100090435 650
10 3300005345 Ga0070692_10002960 Ga0070692_100029603 656
11 3300038443 Ga0395901_0053922 Ga0395901_0053922_1909_4086 657
12 3300048926 Ga0496123_0038453 Ga0496123_0038453_971_3145 658
13 3300005367 Ga0070667_100105529 Ga0070667_1001055291 661
14 3300013296 Ga0157374_10020551 Ga0157374_100205513 661
15 3300013306 Ga0163162_10003602 Ga0163162_100036025 661
16 3300013308 Ga0157375_10007237 Ga0157375_100072377 661
17 3300025960 Ga0207651_10000944 Ga0207651_100009444 661
18 3300026121 Ga0207683_10021519 Ga0207683_100215195 661
19 3300005614 Ga0068856_100005986 Ga0068856_1000059865 662
20 3300013104 Ga0157370_10021081 Ga0157370_100210815 662
21 3300026078 Ga0207702_10014614 Ga0207702_100146145 662
22 3300037418 Ga0395900_0006454 Ga0395900_0006454_4189_6378 662
23 3300005355 Ga0070671_100007660 Ga0070671_1000076602 663
24 3300005457 Ga0070662_100022965 Ga0070662_1000229653 663
25 3300005618 Ga0068864_100007304 Ga0068864_1000073043 663
26 3300005841 Ga0068863_100003907 Ga0068863_1000039076 663
27 3300025931 Ga0207644_10003340 Ga0207644_100033407 663
28 3300025933 Ga0207706_10002828 Ga0207706_100028287 663
29 3300025940 Ga0207691_10018226 Ga0207691_100182261 663
30 3300025941 Ga0207711_10001624 Ga0207711_100016249 663
31 3300026095 Ga0207676_10012785 Ga0207676_100127853 663
32 3300048911 Ga0496108_0012184 Ga0496108_0012184_3109_5271 663
33 3300048915 Ga0496112_0005767 Ga0496112_0005767_8328_10490 663
34 3300013100 Ga0157373_10022902 Ga0157373_100229021 664
35 3300037471 Ga0395905_0003572 Ga0395905_0003572_2182_4356 664
36 3300046684 Ga0495669_0005549 Ga0495669_0005549_2432_4591 664
37 3300005578 Ga0068854_100021058 Ga0068854_1000210581 667
38 3300025981 Ga0207640_10032166 Ga0207640_100321661 667
39 3300026067 Ga0207678_10009407 Ga0207678_100094076 667
40 3300013297 Ga0157378_10024244 Ga0157378_100242443 670
41 3300005327 Ga0070658_10001253 Ga0070658_100012536 671
42 3300005336 Ga0070680_100012865 Ga0070680_1000128652 671
43 3300005339 Ga0070660_100007248 Ga0070660_1000072483 671
44 3300005345 Ga0070692_10010824 Ga0070692_100108243 671
45 3300005563 Ga0068855_100011711 Ga0068855_1000117115 671
46 3300013104 Ga0157370_10007551 Ga0157370_100075519 671
47 3300025909 Ga0207705_10002857 Ga0207705_100028577 671
48 3300025919 Ga0207657_10001484 Ga0207657_1000148414 671
49 3300026067 Ga0207678_10000938 Ga0207678_1000093814 671
50 3300037312 Ga0395899_0000917 Ga0395899_0000917_12471_14660 671
51 3300037418 Ga0395900_0000031 Ga0395900_0000031_146315_148504 671
52 3300037466 Ga0395898_0030407 Ga0395898_0030407_1969_4149 671
53 3300037471 Ga0395905_0008097 Ga0395905_0008097_3728_5908 671
54 3300038443 Ga0395901_0000035 Ga0395901_0000035_137408_139597 671
55 3300038443 Ga0395901_0007679 Ga0395901_0007679_875_3055 671
56 3300005339 Ga0070660_100009453 Ga0070660_1000094532 672
57 3300005458 Ga0070681_10052462 Ga0070681_100524622 672
58 3300013105 Ga0157369_10000833 Ga0157369_1000083331 672
59 3300025944 Ga0207661_10002284 Ga0207661_1000228411 672
60 3300037418 Ga0395900_0002298 Ga0395900_0002298_6052_8244 672
61 3300037466 Ga0395898_0006882 Ga0395898_0006882_5851_8043 672
62 3300037471 Ga0395905_0007737 Ga0395905_0007737_298_2490 672
63 3300038443 Ga0395901_0002827 Ga0395901_0002827_11284_13476 672
64 3300035170 Ga0373943_0005550 Ga0373943_0005550_280_2463 673
65 3300013105 Ga0157369_10041256 Ga0157369_100412562 674
66 3300026067 Ga0207678_10002130 Ga0207678_1000213013 674
67 3300044693 Ga0466961_0049053 Ga0466961_0049053_416_2524 676
68 3300044684 Ga0466966_0000007 Ga0466966_0000007_66736_68955 678
69 3300005355 Ga0070671_100004315 Ga0070671_1000043152 679
70 3300009177 Ga0105248_10046967 Ga0105248_100469673 679
71 3300013105 Ga0157369_10069148 Ga0157369_100691482 679
72 3300026121 Ga0207683_10005385 Ga0207683_100053859 679
73 3300038443 Ga0395901_0010261 Ga0395901_0010261_3075_5267 679
74 3300005841 Ga0068863_100000196 Ga0068863_10000019639 680
75 3300009177 Ga0105248_10023493 Ga0105248_100234934 680
76 3300026088 Ga0207641_10001363 Ga0207641_1000136319 680
77 3300044693 Ga0466961_0053089 Ga0466961_0053089_86_2359 680
78 3300044719 Ga0466971_0003966 Ga0466971_0003966_3134_5407 680
79 3300044842 Ga0466957_0008377 Ga0466957_0008377_3562_5835 680
80 3300045836 Ga0466958_0013543 Ga0466958_0013543_1647_3920 680
81 3300045976 Ga0466967_0020679 Ga0466967_0020679_576_2849 680
82 3300005327 Ga0070658_10000085 Ga0070658_1000008561 681
83 3300005339 Ga0070660_100006379 Ga0070660_1000063797 681
84 3300005617 Ga0068859_100006121 Ga0068859_1000061217 681
85 3300006931 Ga0097620_100006121 Ga0097620_1000061218 681
86 3300025909 Ga0207705_10000116 Ga0207705_1000011660 681
87 3300025919 Ga0207657_10001933 Ga0207657_100019334 681
88 3300005355 Ga0070671_100033649 Ga0070671_1000336492 682
89 3300005563 Ga0068855_100007701 Ga0068855_1000077013 682
90 3300013102 Ga0157371_10005987 Ga0157371_100059877 682
91 3300025909 Ga0207705_10001216 Ga0207705_1000121615 682
92 3300025919 Ga0207657_10000128 Ga0207657_1000012857 682
93 3300025931 Ga0207644_10001492 Ga0207644_100014929 682
94 3300042005 Ga0439448_0001334 Ga0439448_0001334_3400_5682 682
95 3300031995 Ga0307409_100009539 Ga0307409_1000095392 685
96 3300013105 Ga0157369_10068869 Ga0157369_100688692 686
97 3300037418 Ga0395900_0140390 Ga0395900_0140390_117_2330 687
98 3300038443 Ga0395901_0008874 Ga0395901_0008874_2345_4558 687
99 3300005577 Ga0068857_100014813 Ga0068857_1000148133 688
100 3300005614 Ga0068856_100010054 Ga0068856_1000100547 688
101 3300005616 Ga0068852_100000283 Ga0068852_10000028325 688
102 3300025933 Ga0207706_10045179 Ga0207706_100451792 688
103 3300026142 Ga0207698_10000396 Ga0207698_1000039613 688
104 3300005329 Ga0070683_100054116 Ga0070683_1000541162 689
105 3300005455 Ga0070663_100003932 Ga0070663_1000039327 689
106 3300025944 Ga0207661_10013298 Ga0207661_100132984 689
107 3300026067 Ga0207678_10054866 Ga0207678_100548662 689
108 3300037466 Ga0395898_0016527 Ga0395898_0016527_3701_5842 689
109 3300010375 Ga0105239_10030202 Ga0105239_100302021 690
110 3300046460 Ga0495638_0016032 Ga0495638_0016032_1277_3451 690
111 3300046506 Ga0495583_0000500 Ga0495583_0000500_29182_31356 690
112 3300053103 Ga0500555_001130 Ga0500555_001130_6040_8214 690
113 3300005455 Ga0070663_100046004 Ga0070663_1000460041 691
114 3300025909 Ga0207705_10001160 Ga0207705_1000116014 691
115 3300025919 Ga0207657_10000578 Ga0207657_1000057834 691
116 3300026067 Ga0207678_10018646 Ga0207678_100186465 691
117 3300026142 Ga0207698_10061778 Ga0207698_100617782 691
118 3300037471 Ga0395905_0077151 Ga0395905_0077151_691_2961 691
119 3300025919 Ga0207657_10027947 Ga0207657_100279472 692
120 3300026067 Ga0207678_10023290 Ga0207678_100232902 692
121 3300046691 Ga0495670_0000359 Ga0495670_0000359_11522_13720 692
122 3300037418 Ga0395900_0034324 Ga0395900_0034324_482_2755 693
123 3300005530 Ga0070679_100026979 Ga0070679_1000269793 694
124 3300013105 Ga0157369_10029888 Ga0157369_100298882 694
125 3300025909 Ga0207705_10001553 Ga0207705_100015532 694
126 3300005355 Ga0070671_100009278 Ga0070671_1000092784 695
127 3300005356 Ga0070674_100008098 Ga0070674_1000080985 695
128 3300005366 Ga0070659_100043937 Ga0070659_1000439372 695
129 3300005564 Ga0070664_100007628 Ga0070664_1000076286 695
130 3300005618 Ga0068864_100020652 Ga0068864_1000206522 695
131 3300013100 Ga0157373_10052285 Ga0157373_100522851 695
132 3300013102 Ga0157371_10026571 Ga0157371_100265712 695
133 3300025904 Ga0207647_10004524 Ga0207647_100045243 695
134 3300025919 Ga0207657_10027251 Ga0207657_100272513 695
135 3300025931 Ga0207644_10002030 Ga0207644_1000203010 695
136 3300025933 Ga0207706_10011529 Ga0207706_100115295 695
137 3300026067 Ga0207678_10016841 Ga0207678_100168412 695
138 3300026088 Ga0207641_10017938 Ga0207641_100179382 695
139 3300026095 Ga0207676_10015812 Ga0207676_100158122 695
140 3300048905 Ga0496102_0069691 Ga0496102_0069691_717_2882 695
141 3300005564 Ga0070664_100032808 Ga0070664_1000328083 696
142 3300001904 JGI24736J21556_1000133 JGI24736J21556_100013313 697
143 3300005366 Ga0070659_100006731 Ga0070659_1000067316 697
144 3300005539 Ga0068853_100044220 Ga0068853_1000442202 697
145 3300005564 Ga0070664_100010862 Ga0070664_1000108622 697
146 3300013105 Ga0157369_10061950 Ga0157369_100619503 697
147 3300025909 Ga0207705_10003678 Ga0207705_100036789 697
148 3300025919 Ga0207657_10033280 Ga0207657_100332802 697
149 3300025920 Ga0207649_10002611 Ga0207649_100026118 697
150 3300025920 Ga0207649_10002642 Ga0207649_100026426 697
151 3300025920 Ga0207649_10015274 Ga0207649_100152742 697
152 3300026142 Ga0207698_10010717 Ga0207698_100107172 697
153 3300037466 Ga0395898_0015757 Ga0395898_0015757_4460_6739 697
154 3300037471 Ga0395905_0013367 Ga0395905_0013367_2424_4637 697
155 3300025909 Ga0207705_10053542 Ga0207705_100535422 698
156 3300025919 Ga0207657_10001403 Ga0207657_1000140310 698
157 3300025919 Ga0207657_10010341 Ga0207657_100103417 698
158 3300025924 Ga0207694_10021239 Ga0207694_100212393 698
159 3300025981 Ga0207640_10000777 Ga0207640_100007772 698
160 3300005329 Ga0070683_100048372 Ga0070683_1000483722 699
161 3300005355 Ga0070671_100000661 Ga0070671_10000066116 699
162 3300025919 Ga0207657_10013564 Ga0207657_100135642 699
163 3300025919 Ga0207657_10024379 Ga0207657_100243792 699
164 3300025942 Ga0207689_10006472 Ga0207689_100064728 699
165 3300026067 Ga0207678_10011950 Ga0207678_100119503 699
166 3300026116 Ga0207674_10026648 Ga0207674_100266484 699
167 iso_pu_bacteria 2896429255 2896430463 700
168 3300002067 JGI24735J21928_10014820 JGI24735J21928_100148201 701
169 3300001990 JGI24737J22298_10001558 JGI24737J22298_100015587 703
170 3300002067 JGI24735J21928_10011326 JGI24735J21928_100113262 703
171 3300002077 JGI24744J21845_10002556 JGI24744J21845_100025562 703
172 3300005327 Ga0070658_10000105 Ga0070658_1000010537 703
173 3300005339 Ga0070660_100019515 Ga0070660_1000195153 703
174 3300005354 Ga0070675_100001145 Ga0070675_1000011457 703
175 3300005366 Ga0070659_100006185 Ga0070659_1000061858 703
176 3300005455 Ga0070663_100000399 Ga0070663_1000003995 703
177 3300005456 Ga0070678_100012801 Ga0070678_1000128012 703
178 3300005539 Ga0068853_100104581 Ga0068853_1001045812 703
179 3300005578 Ga0068854_100000961 Ga0068854_1000009612 703
180 3300006237 Ga0097621_100010271 Ga0097621_1000102715 703
181 3300006358 Ga0068871_100033122 Ga0068871_1000331222 703
182 3300013296 Ga0157374_10030626 Ga0157374_100306264 703
183 3300025254 Ga0209148_1000398 Ga0209148_10003985 703
184 3300025909 Ga0207705_10000022 Ga0207705_1000002260 703
185 3300025919 Ga0207657_10005740 Ga0207657_100057404 703
186 3300025931 Ga0207644_10026606 Ga0207644_100266062 703
187 3300025932 Ga0207690_10012959 Ga0207690_100129593 703
188 3300025981 Ga0207640_10000532 Ga0207640_100005326 703
189 3300026067 Ga0207678_10005875 Ga0207678_100058756 703
190 3300026121 Ga0207683_10010313 Ga0207683_100103133 703
191 3300044693 Ga0466961_0005022 Ga0466961_0005022_5491_7761 703
192 3300044765 Ga0466970_0002752 Ga0466970_0002752_2791_5061 703
193 3300045049 Ga0466959_0007216 Ga0466959_0007216_2883_5153 703
194 3300005338 Ga0068868_100000117 Ga0068868_10000011716 704
195 3300009098 Ga0105245_10000146 Ga0105245_1000014622 704
196 3300011119 Ga0105246_10010334 Ga0105246_100103343 704
197 3300025961 Ga0207712_10014830 Ga0207712_100148302 704
198 3300026023 Ga0207677_10000851 Ga0207677_1000085112 704
199 3300025904 Ga0207647_10020352 Ga0207647_100203523 705
200 3300001989 JGI24739J22299_10001641 JGI24739J22299_100016414 707
201 3300001989 JGI24739J22299_10001632 JGI24739J22299_100016326 708
202 3300002067 JGI24735J21928_10000908 JGI24735J21928_100009082 708
203 3300002075 JGI24738J21930_10000203 JGI24738J21930_1000020316 708
204 3300005328 Ga0070676_10000215 Ga0070676_1000021518 708
205 3300005334 Ga0068869_100014287 Ga0068869_1000142872 708
206 3300005364 Ga0070673_100000007 Ga0070673_10000000784 708
207 3300005457 Ga0070662_100001894 Ga0070662_1000018949 708
208 3300005457 Ga0070662_100002782 Ga0070662_1000027829 708
209 3300005459 Ga0068867_100000010 Ga0068867_10000001084 708
210 3300006881 Ga0068865_100000008 Ga0068865_10000000877 708
211 3300009148 Ga0105243_10000080 Ga0105243_1000008072 708
212 3300013296 Ga0157374_10000464 Ga0157374_1000046429 708
213 3300013308 Ga0157375_10012796 Ga0157375_100127966 708
214 3300014969 Ga0157376_10000087 Ga0157376_1000008730 708
215 3300025904 Ga0207647_10000654 Ga0207647_100006547 708
216 3300025907 Ga0207645_10000993 Ga0207645_1000099318 708
217 3300025933 Ga0207706_10002860 Ga0207706_100028605 708
218 3300025934 Ga0207686_10003062 Ga0207686_100030625 708
219 3300025935 Ga0207709_10000345 Ga0207709_100003458 708
220 3300025938 Ga0207704_10000013 Ga0207704_1000001372 708
221 3300025942 Ga0207689_10003311 Ga0207689_100033112 708
222 3300025960 Ga0207651_10000013 Ga0207651_1000001384 708
223 3300026089 Ga0207648_10000025 Ga0207648_1000002534 708
224 3300042157 Ga0439458_0000143 Ga0439458_0000143_11242_13530 708
225 3300044719 Ga0466971_0000515 Ga0466971_0000515_4025_6244 709
226 3300044842 Ga0466957_0000606 Ga0466957_0000606_13015_15234 709
227 3300013307 Ga0157372_10045825 Ga0157372_100458252 712
228 3300026041 Ga0207639_10010647 Ga0207639_100106475 712
229 iso_pu_bacteria 2885429604 2885429843 712
230 3300005327 Ga0070658_10023935 Ga0070658_100239353 713
231 3300005339 Ga0070660_100009047 Ga0070660_1000090472 713
232 3300005339 Ga0070660_100065745 Ga0070660_1000657452 713
233 3300009093 Ga0105240_10190880 Ga0105240_101908801 713
234 3300013104 Ga0157370_10020226 Ga0157370_100202263 713
235 3300025272 Ga0209455_1000513 Ga0209455_100051326 713
236 3300025909 Ga0207705_10002147 Ga0207705_1000214711 713
237 3300025919 Ga0207657_10014614 Ga0207657_100146145 713
238 3300039437 Ga0436365_0228661 Ga0436365_0228661_11637_13850 713
239 3300046507 Ga0495606_0002862 Ga0495606_0002862_3348_5603 714
240 3300047472 Ga0495686_0000119 Ga0495686_0000119_45855_48125 714
241 3300005563 Ga0068855_100062702 Ga0068855_1000627022 715
242 3300005614 Ga0068856_100021442 Ga0068856_1000214422 715
243 3300013102 Ga0157371_10005025 Ga0157371_100050257 715
244 3300013105 Ga0157369_10018048 Ga0157369_100180482 715
245 3300025949 Ga0207667_10011888 Ga0207667_100118885 715
246 3300026078 Ga0207702_10011063 Ga0207702_100110636 715
247 3300003323 rootH1_10002704 rootH1_100027042 716
248 3300005563 Ga0068855_100000586 Ga0068855_10000058643 716
249 3300025949 Ga0207667_10000113 Ga0207667_1000011376 716
250 3300042005 Ga0439448_0004603 Ga0439448_0004603_480_2756 717
251 3300042157 Ga0439458_0003356 Ga0439458_0003356_1200_3476 717
252 3300048925 Ga0496122_0004196 Ga0496122_0004196_12295_14550 717
253 3300048926 Ga0496123_0004429 Ga0496123_0004429_6925_9180 717
254 3300048927 Ga0496124_0006016 Ga0496124_0006016_7078_9333 717
255 3300001990 JGI24737J22298_10005463 JGI24737J22298_100054633 719
256 3300025932 Ga0207690_10006036 Ga0207690_100060362 719
257 3300048920 Ga0496117_0006668 Ga0496117_0006668_3104_5416 719
258 3300048921 Ga0496118_0026809 Ga0496118_0026809_2309_4621 719
259 3300048922 Ga0496119_0006901 Ga0496119_0006901_1620_3932 719
260 3300048924 Ga0496121_0009586 Ga0496121_0009586_3039_5351 719
261 3300048925 Ga0496122_0009076 Ga0496122_0009076_4936_7248 719
262 3300048926 Ga0496123_0002216 Ga0496123_0002216_12240_14552 719
263 3300048928 Ga0496125_0010772 Ga0496125_0010772_1762_4074 719
264 3300005327 Ga0070658_10000001 Ga0070658_10000001334 720
265 3300005339 Ga0070660_100000177 Ga0070660_10000017724 720
266 3300021384 Ga0213876_10000596 Ga0213876_100005968 720
267 3300026041 Ga0207639_10007247 Ga0207639_100072473 720
268 3300026116 Ga0207674_10020763 Ga0207674_100207635 720
269 3300039437 Ga0436365_1205090 Ga0436365_1205090_118552_120879 720
270 3300003214 JGI25165J46597_1000050 JGI25165J46597_100005072 721
271 3300005614 Ga0068856_100046021 Ga0068856_1000460211 721
272 3300013104 Ga0157370_10000063 Ga0157370_1000006385 721
273 3300025231 Ga0207427_102080 Ga0207427_1020802 721
274 3300025250 Ga0209026_1000658 Ga0209026_100065813 721
275 3300025261 Ga0209233_1000041 Ga0209233_1000041249 721
276 3300037312 Ga0395899_0012993 Ga0395899_0012993_1775_4093 721
277 3300053727 Ga0500611_000447 Ga0500611_000447_1655_3898 721
278 3300001904 JGI24736J21556_1000044 JGI24736J21556_100004414 723
279 3300002067 JGI24735J21928_10001091 JGI24735J21928_100010918 723
280 3300005327 Ga0070658_10005651 Ga0070658_100056513 723
281 3300005466 Ga0070685_10003957 Ga0070685_100039574 723
282 3300005548 Ga0070665_100000036 Ga0070665_100000036324 723
283 3300013100 Ga0157373_10054135 Ga0157373_100541352 723
284 3300013105 Ga0157369_10008366 Ga0157369_100083662 723
285 3300025904 Ga0207647_10000352 Ga0207647_1000035211 723
286 3300025909 Ga0207705_10000002 Ga0207705_100000021546 723
287 3300025913 Ga0207695_10001723 Ga0207695_1000172312 723
288 3300025914 Ga0207671_10003257 Ga0207671_100032578 723
289 3300025919 Ga0207657_10000082 Ga0207657_1000008219 723
290 3300025924 Ga0207694_10001459 Ga0207694_100014593 723
291 3300025932 Ga0207690_10017194 Ga0207690_100171942 723
292 3300025936 Ga0207670_10015542 Ga0207670_100155422 723
293 3300025949 Ga0207667_10020242 Ga0207667_100202423 723
294 3300026078 Ga0207702_10000335 Ga0207702_1000033520 723
295 3300026116 Ga0207674_10009274 Ga0207674_100092743 723
296 3300028379 Ga0268266_10000042 Ga0268266_1000004217 723
297 3300001976 JGI24752J21851_1000034 JGI24752J21851_10000343 724
298 3300002074 JGI24748J21848_1000032 JGI24748J21848_100003262 724
299 3300002076 JGI24749J21850_1000476 JGI24749J21850_10004762 724
300 3300002239 JGI24034J26672_10000022 JGI24034J26672_10000022103 724
301 3300002244 JGI24742J22300_10000557 JGI24742J22300_100005574 724
302 3300005330 Ga0070690_100000056 Ga0070690_10000005612 724
303 3300005331 Ga0070670_100033691 Ga0070670_1000336912 724
304 3300005335 Ga0070666_10000002 Ga0070666_1000000217 724
305 3300005353 Ga0070669_100000170 Ga0070669_10000017016 724
306 3300005367 Ga0070667_100010510 Ga0070667_1000105102 724
307 3300005544 Ga0070686_100000335 Ga0070686_10000033517 724
308 3300005617 Ga0068859_100011388 Ga0068859_1000113888 724
309 3300005618 Ga0068864_100010218 Ga0068864_1000102182 724
310 3300005841 Ga0068863_100000095 Ga0068863_10000009582 724
311 3300005842 Ga0068858_100002740 Ga0068858_1000027409 724
312 3300005843 Ga0068860_100000001 Ga0068860_10000000117 724
313 3300005844 Ga0068862_100000350 Ga0068862_10000035032 724
314 3300006931 Ga0097620_100011389 Ga0097620_1000113898 724
315 3300009553 Ga0105249_10000026 Ga0105249_1000002616 724
316 3300013306 Ga0163162_10118669 Ga0163162_101186691 724
317 3300014326 Ga0157380_10001342 Ga0157380_1000134212 724
318 3300017792 Ga0163161_10000008 Ga0163161_10000008291 724
319 3300025903 Ga0207680_10000004 Ga0207680_10000004843 724
320 3300025931 Ga0207644_10000755 Ga0207644_1000075512 724
321 3300025961 Ga0207712_10000001 Ga0207712_10000001717 724
322 3300025986 Ga0207658_10004409 Ga0207658_100044095 724
323 3300026035 Ga0207703_10001677 Ga0207703_100016777 724
324 3300026088 Ga0207641_10000148 Ga0207641_1000014881 724
325 3300026095 Ga0207676_10001987 Ga0207676_100019874 724
326 3300026118 Ga0207675_100001093 Ga0207675_10000109316 724
327 3300028380 Ga0268265_10000481 Ga0268265_100004818 724
328 3300028381 Ga0268264_10000006 Ga0268264_10000006843 724
329 3300048903 Ga0496100_0029808 Ga0496100_0029808_159_2405 724
330 3300048905 Ga0496102_0008737 Ga0496102_0008737_5294_7540 724
331 3300048906 Ga0496103_0002569 Ga0496103_0002569_2857_5103 724
332 3300048920 Ga0496117_0007680 Ga0496117_0007680_6701_8947 724
333 3300053087 Ga0500643_000129 Ga0500643_000129_5390_7636 724
334 2162886007 SwRhRL2b_contig_424476 SwRhRL2b_0486.00000910 725
335 3300001976 JGI24752J21851_1000290 JGI24752J21851_10002905 725
336 3300005289 Ga0065704_10074248 Ga0065704_100742485 725
337 3300005295 Ga0065707_10086897 Ga0065707_100868973 725
338 3300005331 Ga0070670_100000016 Ga0070670_100000016105 725
339 3300005367 Ga0070667_100000528 Ga0070667_10000052812 725
340 3300005618 Ga0068864_100000017 Ga0068864_100000017184 725
341 3300005841 Ga0068863_100000018 Ga0068863_100000018104 725
342 3300005844 Ga0068862_100000010 Ga0068862_100000010127 725
343 3300009011 Ga0105251_10001597 Ga0105251_100015974 725
344 3300009101 Ga0105247_10002227 Ga0105247_100022277 725
345 3300009177 Ga0105248_10000105 Ga0105248_1000010532 725
346 3300009553 Ga0105249_10000207 Ga0105249_1000020744 725
347 3300013306 Ga0163162_10042267 Ga0163162_100422672 725
348 3300014968 Ga0157379_10008804 Ga0157379_100088043 725
349 3300025735 Ga0207713_1006527 Ga0207713_10065273 725
350 3300025925 Ga0207650_10000057 Ga0207650_10000057106 725
351 3300025941 Ga0207711_10000031 Ga0207711_10000031127 725
352 3300025961 Ga0207712_10000234 Ga0207712_1000023423 725
353 3300025986 Ga0207658_10001812 Ga0207658_1000181212 725
354 3300026088 Ga0207641_10000002 Ga0207641_10000002359 725
355 3300026095 Ga0207676_10000005 Ga0207676_10000005449 725
356 3300028380 Ga0268265_10000003 Ga0268265_10000003631 725
357 3300048921 Ga0496118_0000332 Ga0496118_0000332_45629_47878 725

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04453

LptD

LPS transport system D

362

730

0.98

PF03968

LptD_N

LptA/(LptD N-terminal domain) LPS transport protein

97

193

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7omm-assembly1.cif.gz_A cryo-em structure of n. gonorhoeae lptde in complex with promacrobodies (mbps have not been built de novo) 0.7694 54 720
4rhb-assembly1.cif.gz_A crystal structure of the lipopolysaccharide assembly complex lptd-lpte from the escherichia coli outer membrane 0.7632 205 720
4n4r-assembly1.cif.gz_A structure basis of lipopolysaccharide biogenesis 0.759 201 714
4q35-assembly1.cif.gz_A structure of a membrane protein 0.7472 51 725
5iv9-assembly1.cif.gz_A the lps transporter lptde from klebsiella pneumoniae, full-length 0.7465 42 725
ID Description Score Start End Superfamily
af_Q4E1S3_6_80_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.7688 153 196 2.30.30.100
2r1aH00 Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain 0.649 51 185 2.60.450.10
2r1aH00 Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain 0.6149 51 185 2.60.450.10
af_P31554_308_697_2.40.160.50 Mainly Beta;Beta Barrel;Porin;membrane protein fhac: a member of the omp85/tpsb transporter family 0.5738 286 720 2.40.160.50
af_Q8I3T2_91_272_3.90.1150.210 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;F-actin capping protein, beta subunit 0.5683 367 459 3.90.1150.210
ID Description Score Start End GO Terms
AF-A0A0Q7TPX9-F1-model_v4 LPS-assembly protein LptD 0.857 51 724 GO:0009279
GO:0015920
GO:0043165
GO:1990351
AF-A0A6N8UUJ9-F1-model_v4 LPS-assembly protein LptD 0.8561 201 725 GO:0009279
GO:0061024
GO:1990351
AF-A0A7C3VM34-F1-model_v4 LPS-assembly protein LptD 0.8467 50 725 GO:0009279
GO:0015920
GO:0043165
GO:1990351
AF-A0A1W6BE85-F1-model_v4 LPS-assembly protein LptD 0.8446 54 725 GO:0009279
GO:0015920
GO:0043165
GO:1990351
AF-A0A527CVJ0-F1-model_v4 LPS-assembly protein LptD 0.8397 97 218 GO:0009279
GO:1990351

Feature Viewer

pLDDT pTM Quality
73.2 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map