F420658

General Info

Members Datasets Scaffolds Average Seq Length
356 192 712 113

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_154067_c1|nmdc:mga06r32_154067_c1_843_1253
Length 136
Sequence VRHTLLLLLSLFERRAPIGKELRVATDKGDLLQGTLDMLVLKALQLEPMHGWGITERIEQWSESVLQLGQGTLYPALYRLERQGLIESEWKSTLNNRRARYYSLTRAGRRQLHDELAQWRRMSRAVNLVLDATLNR

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
127 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
128 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
129 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
130 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
131 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
132 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
133 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
134 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
135 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
136 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
139 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
140 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.53
Nodule 0
Rhizoplane 2.53
Rhizosphere 94.94
Stem 0
Stem Tuber 0
Unclassified 17.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_154067_c1 3300050510 Bacteria 2278
2 Ga0065714_10143585 3300005288 Bacteria 1154
3 Ga0065712_10000156 3300005290 Bacteria 37789
4 Ga0065712_10175379 3300005290 Bacteria 1220
5 Ga0065712_10272516 3300005290 Unclassified 912
6 Ga0065712_10591067 3300005290 Unclassified 596
7 Ga0065715_10092269 3300005293 Bacteria 5219
8 Ga0065715_10308617 3300005293 Bacteria 1025
9 Ga0065707_10515365 3300005295 Unclassified 746
10 Ga0065707_10541605 3300005295 Unclassified 727
11 Ga0070690_100073957 3300005330 Unclassified 2218
12 Ga0068869_100287453 3300005334 Bacteria 1324
13 Ga0068869_100880725 3300005334 Bacteria 774
14 Ga0068869_101284706 3300005334 Unclassified 645
15 Ga0070666_10361659 3300005335 Bacteria 1040
16 Ga0070680_100493911 3300005336 Bacteria 1047
17 Ga0070680_100801367 3300005336 Bacteria 812
18 Ga0070682_102064154 3300005337 Bacteria 502
19 Ga0070660_100415678 3300005339 Unclassified 1113
20 Ga0070687_101132224 3300005343 Bacteria 574
21 Ga0070692_11101138 3300005345 Bacteria 561
22 Ga0070668_100565410 3300005347 Bacteria 991
23 Ga0070668_101295723 3300005347 Bacteria 662
24 Ga0070669_100652023 3300005353 Unclassified 886
25 Ga0070669_100834720 3300005353 Bacteria 785
26 Ga0070675_100009445 3300005354 Bacteria 7591
27 Ga0070675_102193338 3300005354 Bacteria 509
28 Ga0070671_101182073 3300005355 Unclassified 673
29 Ga0070674_100348203 3300005356 Bacteria 1196
30 Ga0070674_100672890 3300005356 Bacteria 882
31 Ga0070673_100298465 3300005364 Bacteria 1418
32 Ga0070688_100028931 3300005365 Bacteria 3313
33 Ga0070688_100209905 3300005365 Bacteria 1367
34 Ga0070659_100028299 3300005366 Bacteria 4327
35 Ga0070667_101737515 3300005367 Bacteria 587
36 Ga0070701_11393733 3300005438 Unclassified 504
37 Ga0070700_101323338 3300005441 Unclassified 606
38 Ga0070708_100026098 3300005445 Bacteria 4998
39 Ga0070708_101786030 3300005445 Bacteria 571
40 Ga0070663_100622875 3300005455 Bacteria 910
41 Ga0070678_100058719 3300005456 Bacteria 2825
42 Ga0070678_100172342 3300005456 Bacteria 1764
43 Ga0070662_100187128 3300005457 Bacteria 1635
44 Ga0070662_100391093 3300005457 Bacteria 1146
45 Ga0070681_10226696 3300005458 Unclassified 1783
46 Ga0070685_10012803 3300005466 Bacteria 4412
47 Ga0070706_100452928 3300005467 Bacteria 1194
48 Ga0070698_100605665 3300005471 Bacteria 1036
49 Ga0070672_100013577 3300005543 Bacteria 5759
50 Ga0070686_100182376 3300005544 Bacteria 1493
51 Ga0070686_100457727 3300005544 Bacteria 982
52 Ga0070686_101656244 3300005544 Bacteria 542
53 Ga0070696_101383560 3300005546 Unclassified 599
54 Ga0070693_100498803 3300005547 Bacteria 863
55 Ga0070665_100055895 3300005548 Bacteria 3958
56 Ga0070665_100503690 3300005548 Unclassified 1222
57 Ga0070704_100711203 3300005549 Bacteria 892
58 Ga0070704_101290654 3300005549 Bacteria 668
59 Ga0070704_101556897 3300005549 Bacteria 609
60 Ga0070664_100159394 3300005564 Bacteria 1996
61 Ga0070702_101634108 3300005615 Unclassified 534
62 Ga0068852_100004167 3300005616 Bacteria 10185
63 Ga0068859_100680892 3300005617 Bacteria 1120
64 Ga0068864_100018370 3300005618 Bacteria 5842
65 Ga0068864_100107053 3300005618 Bacteria 2487
66 Ga0068861_100312541 3300005719 Bacteria 1366
67 Ga0068861_100746515 3300005719 Bacteria 914
68 Ga0068861_101929962 3300005719 Bacteria 588
69 Ga0068863_100421608 3300005841 Bacteria 1307
70 Ga0068863_101298096 3300005841 Bacteria 735
71 Ga0068858_100017006 3300005842 Bacteria 6828
72 Ga0068858_100624010 3300005842 Bacteria 1047
73 Ga0068858_100711126 3300005842 Bacteria 978
74 Ga0068860_100578821 3300005843 Bacteria 1127
75 Ga0068862_100084824 3300005844 Bacteria 2752
76 Ga0068862_100258448 3300005844 Bacteria 1589
77 Ga0068862_100648816 3300005844 Bacteria 1018
78 Ga0081539_10027011 3300005985 Bacteria 3644
79 Ga0075367_10201717 3300006178 Bacteria 1243
80 Ga0075367_10726009 3300006178 Bacteria 632
81 Ga0097621_100016020 3300006237 Bacteria 5654
82 Ga0097621_101257699 3300006237 Unclassified 698
83 Ga0075370_10371429 3300006353 Bacteria 856
84 Ga0068871_100376378 3300006358 Bacteria 1261
85 Ga0068871_100498433 3300006358 Bacteria 1097
86 Ga0075428_100070041 3300006844 Bacteria 3834
87 Ga0075428_100119711 3300006844 Bacteria 2866
88 Ga0075428_100288626 3300006844 Bacteria 1765
89 Ga0075428_100410243 3300006844 Bacteria 1451
90 Ga0075428_100635517 3300006844 Unclassified 1139
91 Ga0075430_100242915 3300006846 Bacteria 1492
92 Ga0075430_100627228 3300006846 Bacteria 887
93 Ga0075430_100967901 3300006846 Bacteria 701
94 Ga0075431_100001185 3300006847 Bacteria 23517
95 Ga0075431_100031682 3300006847 Bacteria 5446
96 Ga0075431_100108860 3300006847 Bacteria 2860
97 Ga0075431_100173801 3300006847 Bacteria 2213
98 Ga0075431_100379872 3300006847 Bacteria 1417
99 Ga0075431_100797611 3300006847 Bacteria 918
100 Ga0075431_100941744 3300006847 Bacteria 832
101 Ga0075431_101451336 3300006847 Unclassified 645
102 Ga0075433_10034044 3300006852 Bacteria 4373
103 Ga0075433_10054641 3300006852 Bacteria 3484
104 Ga0075433_10828733 3300006852 Bacteria 808
105 Ga0075434_100484289 3300006871 Bacteria 1258
106 Ga0075434_101025182 3300006871 Bacteria 839
107 Ga0075429_100013402 3300006880 Bacteria 7109
108 Ga0075429_100572387 3300006880 Bacteria 990
109 Ga0068865_100250816 3300006881 Bacteria 1397
110 Ga0068865_100993297 3300006881 Bacteria 735
111 Ga0075436_100002775 3300006914 Bacteria 12006
112 Ga0097620_100475725 3300006931 Bacteria 1345
113 Ga0097620_100680903 3300006931 Bacteria 1120
114 Ga0075435_100065657 3300007076 Bacteria 2950
115 Ga0111539_10109519 3300009094 Bacteria 3241
116 Ga0111539_10128509 3300009094 Bacteria 2968
117 Ga0111539_11122978 3300009094 Bacteria 913
118 Ga0111539_11924183 3300009094 Bacteria 686
119 Ga0105245_10067745 3300009098 Bacteria 3233
120 Ga0105247_10584839 3300009101 Unclassified 826
121 Ga0114129_10000818 3300009147 Bacteria 40061
122 Ga0114129_10704103 3300009147 Bacteria 1298
123 Ga0114129_10877182 3300009147 Bacteria 1139
124 Ga0114129_10935826 3300009147 Bacteria 1096
125 Ga0114129_11002067 3300009147 Unclassified 1052
126 Ga0105243_10513033 3300009148 Bacteria 1138
127 Ga0105242_10144936 3300009176 Bacteria 2065
128 Ga0105242_12467573 3300009176 Bacteria 568
129 Ga0105248_10094893 3300009177 Bacteria 3358
130 Ga0105248_10938551 3300009177 Bacteria 977
131 Ga0105248_11022489 3300009177 Unclassified 934
132 Ga0105248_11296392 3300009177 Bacteria 824
133 Ga0105238_11593473 3300009551 Bacteria 683
134 Ga0105249_10094950 3300009553 Bacteria 2795
135 Ga0105249_12826523 3300009553 Unclassified 557
136 Ga0105246_11809528 3300011119 Bacteria 584
137 Ga0105246_12176065 3300011119 Unclassified 539
138 Ga0157371_10039339 3300013102 Unclassified 3381
139 Ga0157370_11852365 3300013104 Bacteria 541
140 Ga0157374_10204059 3300013296 Bacteria 1936
141 Ga0157378_11932015 3300013297 Bacteria 639
142 Ga0163162_10029241 3300013306 Bacteria 5453
143 Ga0157375_10039438 3300013308 Bacteria 4546
144 Ga0157375_10143454 3300013308 Bacteria 2517
145 Ga0157375_12170364 3300013308 Bacteria 661
146 Ga0157380_10019851 3300014326 Bacteria 5015
147 Ga0157380_10049293 3300014326 Bacteria 3321
148 Ga0157380_10224549 3300014326 Bacteria 1683
149 Ga0157379_12500514 3300014968 Unclassified 516
150 Ga0157376_10005628 3300014969 Bacteria 8769
151 Ga0157376_10398697 3300014969 Bacteria 1330
152 Ga0163161_10022316 3300017792 Bacteria 4456
153 Ga0207710_10116746 3300025900 Bacteria 1271
154 Ga0207680_10051837 3300025903 Bacteria 2456
155 Ga0207680_10283149 3300025903 Bacteria 1152
156 Ga0207647_10356557 3300025904 Bacteria 828
157 Ga0207643_10442872 3300025908 Bacteria 826
158 Ga0207684_10413041 3300025910 Bacteria 1160
159 Ga0207657_10361941 3300025919 Unclassified 1143
160 Ga0207681_11132604 3300025923 Bacteria 657
161 Ga0207694_10745663 3300025924 Bacteria 826
162 Ga0207659_10001314 3300025926 Bacteria 14848
163 Ga0207659_10039508 3300025926 Bacteria 3292
164 Ga0207687_10630738 3300025927 Bacteria 905
165 Ga0207687_10762500 3300025927 Bacteria 824
166 Ga0207644_10355855 3300025931 Bacteria 1190
167 Ga0207690_10018085 3300025932 Bacteria 4318
168 Ga0207706_10468724 3300025933 Bacteria 1089
169 Ga0207686_10019773 3300025934 Bacteria 3837
170 Ga0207709_10263101 3300025935 Bacteria 1266
171 Ga0207669_10006518 3300025937 Bacteria 5346
172 Ga0207704_10148846 3300025938 Bacteria 1649
173 Ga0207704_10237084 3300025938 Bacteria 1360
174 Ga0207704_11697445 3300025938 Bacteria 543
175 Ga0207691_10082709 3300025940 Bacteria 2883
176 Ga0207711_10273951 3300025941 Bacteria 1553
177 Ga0207711_10602733 3300025941 Unclassified 1025
178 Ga0207689_10294739 3300025942 Bacteria 1344
179 Ga0207689_10443266 3300025942 Bacteria 1085
180 Ga0207679_10363346 3300025945 Bacteria 1265
181 Ga0207651_10006429 3300025960 Bacteria 6148
182 Ga0207651_10242543 3300025960 Unclassified 1470
183 Ga0207712_10055101 3300025961 Bacteria 2795
184 Ga0207668_10570308 3300025972 Bacteria 983
185 Ga0207703_10625024 3300026035 Unclassified 1020
186 Ga0207703_11330286 3300026035 Bacteria 691
187 Ga0207703_11746028 3300026035 Unclassified 598
188 Ga0207678_10196239 3300026067 Bacteria 1725
189 Ga0207678_10331572 3300026067 Bacteria 1310
190 Ga0207708_10166969 3300026075 Bacteria 1740
191 Ga0207641_10258727 3300026088 Bacteria 1629
192 Ga0207641_10747188 3300026088 Bacteria 965
193 Ga0207641_11317825 3300026088 Bacteria 723
194 Ga0207648_10032605 3300026089 Bacteria 4598
195 Ga0207648_10125713 3300026089 Bacteria 2256
196 Ga0207648_10400240 3300026089 Bacteria 1244
197 Ga0207676_11765122 3300026095 Bacteria 617
198 Ga0207675_100094052 3300026118 Bacteria 2819
199 Ga0207675_100157462 3300026118 Bacteria 2165
200 Ga0207675_100909023 3300026118 Bacteria 897
201 Ga0207675_102057541 3300026118 Bacteria 588
202 Ga0207683_10101025 3300026121 Bacteria 2575
203 Ga0207683_10230002 3300026121 Bacteria 1691
204 Ga0207698_10540359 3300026142 Bacteria 1140
205 Ga0207698_12616026 3300026142 Unclassified 514
206 Ga0210002_1047116 3300027617 Bacteria 739
207 Ga0207428_11165794 3300027907 Unclassified 537
208 Ga0268266_10122588 3300028379 Bacteria 2315
209 Ga0268266_10936982 3300028379 Unclassified 838
210 Ga0268265_10231803 3300028380 Bacteria 1623
211 Ga0268265_10255843 3300028380 Bacteria 1554
212 Ga0268265_10603216 3300028380 Bacteria 1049
213 Ga0268264_10094919 3300028381 Bacteria 2580
214 Ga0268264_11445997 3300028381 Bacteria 698
215 Ga0307408_100668079 3300031548 Bacteria 931
216 Ga0307406_11316768 3300031901 Bacteria 631
217 Ga0307409_101252841 3300031995 Bacteria 766
218 Ga0307416_100594065 3300032002 Bacteria 1186
219 Ga0307416_100717954 3300032002 Bacteria 1090
220 Ga0307416_101141282 3300032002 Bacteria 884
221 Ga0307416_102895940 3300032002 Unclassified 574
222 Ga0373928_0287646 3300035084 Bacteria 500
223 Ga0439453_0087006 3300041408 Unclassified 681
224 Ga0439461_0112279 3300041410 Bacteria 674
225 Ga0439431_0173194 3300041997 Unclassified 621
226 Ga0439433_0166764 3300041999 Bacteria 572
227 Ga0439445_0055712 3300042004 Bacteria 1074
228 Ga0450894_001180 3300042131 Bacteria 3887
229 Ga0450896_002751 3300042133 Bacteria 2294
230 Ga0439446_0040318 3300042156 Bacteria 1374
231 Ga0439446_0282192 3300042156 Bacteria 579
232 Ga0450908_018741 3300042184 Bacteria 1221
233 Ga0450909_010699 3300042185 Bacteria 1343
234 Ga0439434_0080837 3300042435 Bacteria 1031
235 Ga0439435_0056082 3300042436 Unclassified 1138
236 Ga0439460_0191590 3300042461 Bacteria 694
237 Ga0450918_002786 3300042531 Bacteria 3278
238 Ga0453683_0116689 3300044673 Bacteria 1680
239 Ga0466967_1357051 3300045976 Unclassified 708
240 Ga0495663_0176342 3300046525 Bacteria 739
241 Ga0495669_0011174 3300046684 Bacteria 3807
242 Ga0496101_0587014 3300048904 Bacteria 881
243 Ga0496104_0485548 3300048907 Bacteria 1147
244 Ga0496106_0767349 3300048909 Bacteria 766
245 Ga0496107_0656948 3300048910 Bacteria 773
246 Ga0496108_0394764 3300048911 Bacteria 1208
247 Ga0496108_0903208 3300048911 Bacteria 758
248 Ga0496109_0940652 3300048912 Bacteria 802
249 Ga0496110_0043227 3300048913 Bacteria 3934
250 Ga0496114_0099573 3300048917 Bacteria 2479
251 Ga0501036_0270275 3300049572 Bacteria 1423
252 Ga0501036_0384080 3300049572 Bacteria 1172
253 Ga0501036_0518166 3300049572 Unclassified 992
254 Ga0501037_0267132 3300049573 Bacteria 1195
255 Ga0501040_0006442 3300049576 Bacteria 7622
256 Ga0501040_0664712 3300049576 Unclassified 753
257 Ga0501041_0007841 3300049577 Bacteria 6273
258 Ga0501041_0045560 3300049577 Bacteria 2667
259 Ga0501041_0093687 3300049577 Unclassified 1855
260 Ga0501042_0014029 3300049578 Bacteria 5463
261 Ga0501042_0047199 3300049578 Bacteria 3071
262 Ga0501042_1069885 3300049578 Bacteria 588
263 Ga0501046_0116041 3300049580 Bacteria 2041
264 Ga0501048_0160512 3300049582 Bacteria 1591
265 Ga0501048_0346660 3300049582 Bacteria 1059
266 Ga0501068_0284119 3300049584 Bacteria 1058
267 Ga0501071_0046122 3300049587 Bacteria 3130
268 Ga0501071_0057509 3300049587 Unclassified 2811
269 Ga0501071_0224545 3300049587 Bacteria 1414
270 Ga0501071_0867261 3300049587 Unclassified 696
271 Ga0501072_0067126 3300049588 Unclassified 2830
272 Ga0501072_0424080 3300049588 Bacteria 1054
273 Ga0501072_0483716 3300049588 Bacteria 979
274 Ga0501072_0510755 3300049588 Unclassified 950
275 Ga0501072_0528209 3300049588 Bacteria 932
276 Ga0501072_0541052 3300049588 Bacteria 920
277 Ga0501073_0538930 3300049589 Unclassified 807
278 Ga0501073_0923489 3300049589 Unclassified 601
279 Ga0501074_0054017 3300049590 Unclassified 2897
280 Ga0501074_0174103 3300049590 Bacteria 1536
281 Ga0501075_0044774 3300049591 Unclassified 3320
282 Ga0501075_0055065 3300049591 Bacteria 2992
283 Ga0501075_0186927 3300049591 Unclassified 1580
284 Ga0501075_0780687 3300049591 Unclassified 727
285 Ga0501076_0001203 3300049592 Bacteria 17191
286 Ga0501076_0043957 3300049592 Bacteria 3522
287 Ga0501076_0132869 3300049592 Bacteria 2019
288 Ga0501076_0266907 3300049592 Bacteria 1401
289 Ga0501076_0736312 3300049592 Bacteria 814
290 Ga0501077_0160032 3300049593 Unclassified 1429
291 Ga0501077_0191033 3300049593 Bacteria 1301
292 Ga0501077_0231808 3300049593 Bacteria 1174
293 Ga0501250_067206 3300049680 Bacteria 585
294 Ga0501079_0058206 3300049741 Bacteria 2982
295 Ga0501079_0222054 3300049741 Bacteria 1476
296 Ga0501079_0350672 3300049741 Bacteria 1156
297 Ga0501079_1388694 3300049741 Bacteria 553
298 Ga0501080_0775043 3300049742 Unclassified 842
299 Ga0501080_1826768 3300049742 Bacteria 510
300 Ga0501081_0179792 3300049743 Bacteria 1530
301 Ga0501081_0263669 3300049743 Bacteria 1259
302 Ga0501081_0667630 3300049743 Unclassified 780
303 Ga0501083_0484305 3300049744 Bacteria 805
304 Ga0501083_0882207 3300049744 Bacteria 582
305 Ga0501083_1174177 3300049744 Unclassified 500
306 Ga0501045_0053433 3300049824 Bacteria 2952
307 Ga0501045_0104614 3300049824 Bacteria 2097
308 Ga0501045_1104817 3300049824 Unclassified 580
309 nmdc:mga06z11_298495_c1 3300050494 Bacteria 957
310 nmdc:mga06z11_612943_c1 3300050494 Bacteria 662
311 nmdc:mga06z11_963956_c1 3300050494 Bacteria 520
312 nmdc:mga05p37_2115571_c1 3300050507 Bacteria 527
313 nmdc:mga05p37_864415_c1 3300050507 Bacteria 980
314 nmdc:mga05p37_898_c2 3300050507 Bacteria 32310
315 nmdc:mga05p37_929214_c1 3300050507 Unclassified 934
316 nmdc:mga09592_6975_c1 3300050508 Bacteria 9187
317 nmdc:mga0qj67_2712_c1 3300050509 Bacteria 12700
318 nmdc:mga0qj67_492172_c1 3300050509 Bacteria 986
319 nmdc:mga0qj67_743199_c1 3300050509 Bacteria 779
320 nmdc:mga0qj67_894163_c1 3300050509 Bacteria 700
321 nmdc:mga0qj67_955003_c1 3300050509 Bacteria 674
322 nmdc:mga06r32_1048702_c1 3300050510 Bacteria 766
323 nmdc:mga06r32_1367699_c1 3300050510 Unclassified 650
324 nmdc:mga06r32_21893_c1 3300050510 Bacteria 5903
325 nmdc:mga06r32_245401_c1 3300050510 Bacteria 1778
326 nmdc:mga06r32_37125_c1 3300050510 Bacteria 4608
327 nmdc:mga06r32_71594_c1 3300050510 Unclassified 3355
328 nmdc:mga06r32_874172_c1 3300050510 Unclassified 856
329 nmdc:mga08y16_693304_c1 3300050511 Bacteria 1019
330 nmdc:mga08y16_93245_c1 3300050511 Bacteria 3137
331 nmdc:mga0n895_554176_c1 3300050512 Bacteria 1155
332 nmdc:mga0n895_668820_c1 3300050512 Bacteria 1036
333 nmdc:mga0rr50_8939_c1 3300050513 Bacteria 6261
334 nmdc:mga08x19_713_c1 3300050514 Bacteria 21268
335 nmdc:mga0a205_400148_c1 3300050515 Bacteria 1237
336 nmdc:mga0a205_49663_c1 3300050515 Bacteria 4050
337 Ga0500641_0004687 3300053096 Bacteria 4832
338 Ga0500555_001205 3300053103 Bacteria 8399
339 Ga0500616_0000135 3300053153 Bacteria 126795
340 Ga0501084_0113692 3300054114 Bacteria 2276
341 Ga0501084_0303767 3300054114 Bacteria 1348
342 Ga0501084_0835129 3300054114 Bacteria 775
343 Ga0501084_0989220 3300054114 Unclassified 707
344 Ga0590071_000057 3300059421 Bacteria 29887
345 Ga0590071_035677 3300059421 Unclassified 1191
346 Ga0590071_042891 3300059421 Bacteria 1090
347 Ga0590071_114428 3300059421 Bacteria 686
348 Ga0590074_003972 3300059423 Unclassified 2445
349 Ga0590075_000596 3300059424 Bacteria 9700
350 Ga0590077_000072 3300059426 Bacteria 25348
351 Ga0501082_0076822 3300060353 Bacteria 2879
352 Ga0501082_0265656 3300060353 Bacteria 1493
353 Ga0501082_0689181 3300060353 Bacteria 894
354 Ga0501082_2022039 3300060353 Unclassified 502
355 Ga0530510_0153838 3300061734 Bacteria 1699
356 Ga0530510_0441974 3300061734 Bacteria 983
357 nmdc:mga06r32_154067_c1
358 Ga0065714_10143585
359 Ga0065712_10000156
360 Ga0065712_10175379
361 Ga0065712_10272516
362 Ga0065712_10591067
363 Ga0065715_10092269
364 Ga0065715_10308617
365 Ga0065707_10515365
366 Ga0065707_10541605
367 Ga0070690_100073957
368 Ga0068869_100287453
369 Ga0068869_100880725
370 Ga0068869_101284706
371 Ga0070666_10361659
372 Ga0070680_100493911
373 Ga0070680_100801367
374 Ga0070682_102064154
375 Ga0070660_100415678
376 Ga0070687_101132224
377 Ga0070692_11101138
378 Ga0070668_100565410
379 Ga0070668_101295723
380 Ga0070669_100652023
381 Ga0070669_100834720
382 Ga0070675_100009445
383 Ga0070675_102193338
384 Ga0070671_101182073
385 Ga0070674_100348203
386 Ga0070674_100672890
387 Ga0070673_100298465
388 Ga0070688_100028931
389 Ga0070688_100209905
390 Ga0070659_100028299
391 Ga0070667_101737515
392 Ga0070701_11393733
393 Ga0070700_101323338
394 Ga0070708_100026098
395 Ga0070708_101786030
396 Ga0070663_100622875
397 Ga0070678_100058719
398 Ga0070678_100172342
399 Ga0070662_100187128
400 Ga0070662_100391093
401 Ga0070681_10226696
402 Ga0070685_10012803
403 Ga0070706_100452928
404 Ga0070698_100605665
405 Ga0070672_100013577
406 Ga0070686_100182376
407 Ga0070686_100457727
408 Ga0070686_101656244
409 Ga0070696_101383560
410 Ga0070693_100498803
411 Ga0070665_100055895
412 Ga0070665_100503690
413 Ga0070704_100711203
414 Ga0070704_101290654
415 Ga0070704_101556897
416 Ga0070664_100159394
417 Ga0070702_101634108
418 Ga0068852_100004167
419 Ga0068859_100680892
420 Ga0068864_100018370
421 Ga0068864_100107053
422 Ga0068861_100312541
423 Ga0068861_100746515
424 Ga0068861_101929962
425 Ga0068863_100421608
426 Ga0068863_101298096
427 Ga0068858_100017006
428 Ga0068858_100624010
429 Ga0068858_100711126
430 Ga0068860_100578821
431 Ga0068862_100084824
432 Ga0068862_100258448
433 Ga0068862_100648816
434 Ga0081539_10027011
435 Ga0075367_10201717
436 Ga0075367_10726009
437 Ga0097621_100016020
438 Ga0097621_101257699
439 Ga0075370_10371429
440 Ga0068871_100376378
441 Ga0068871_100498433
442 Ga0075428_100070041
443 Ga0075428_100119711
444 Ga0075428_100288626
445 Ga0075428_100410243
446 Ga0075428_100635517
447 Ga0075430_100242915
448 Ga0075430_100627228
449 Ga0075430_100967901
450 Ga0075431_100001185
451 Ga0075431_100031682
452 Ga0075431_100108860
453 Ga0075431_100173801
454 Ga0075431_100379872
455 Ga0075431_100797611
456 Ga0075431_100941744
457 Ga0075431_101451336
458 Ga0075433_10034044
459 Ga0075433_10054641
460 Ga0075433_10828733
461 Ga0075434_100484289
462 Ga0075434_101025182
463 Ga0075429_100013402
464 Ga0075429_100572387
465 Ga0068865_100250816
466 Ga0068865_100993297
467 Ga0075436_100002775
468 Ga0097620_100475725
469 Ga0097620_100680903
470 Ga0075435_100065657
471 Ga0111539_10109519
472 Ga0111539_10128509
473 Ga0111539_11122978
474 Ga0111539_11924183
475 Ga0105245_10067745
476 Ga0105247_10584839
477 Ga0114129_10000818
478 Ga0114129_10704103
479 Ga0114129_10877182
480 Ga0114129_10935826
481 Ga0114129_11002067
482 Ga0105243_10513033
483 Ga0105242_10144936
484 Ga0105242_12467573
485 Ga0105248_10094893
486 Ga0105248_10938551
487 Ga0105248_11022489
488 Ga0105248_11296392
489 Ga0105238_11593473
490 Ga0105249_10094950
491 Ga0105249_12826523
492 Ga0105246_11809528
493 Ga0105246_12176065
494 Ga0157371_10039339
495 Ga0157370_11852365
496 Ga0157374_10204059
497 Ga0157378_11932015
498 Ga0163162_10029241
499 Ga0157375_10039438
500 Ga0157375_10143454
501 Ga0157375_12170364
502 Ga0157380_10019851
503 Ga0157380_10049293
504 Ga0157380_10224549
505 Ga0157379_12500514
506 Ga0157376_10005628
507 Ga0157376_10398697
508 Ga0163161_10022316
509 Ga0207710_10116746
510 Ga0207680_10051837
511 Ga0207680_10283149
512 Ga0207647_10356557
513 Ga0207643_10442872
514 Ga0207684_10413041
515 Ga0207657_10361941
516 Ga0207681_11132604
517 Ga0207694_10745663
518 Ga0207659_10001314
519 Ga0207659_10039508
520 Ga0207687_10630738
521 Ga0207687_10762500
522 Ga0207644_10355855
523 Ga0207690_10018085
524 Ga0207706_10468724
525 Ga0207686_10019773
526 Ga0207709_10263101
527 Ga0207669_10006518
528 Ga0207704_10148846
529 Ga0207704_10237084
530 Ga0207704_11697445
531 Ga0207691_10082709
532 Ga0207711_10273951
533 Ga0207711_10602733
534 Ga0207689_10294739
535 Ga0207689_10443266
536 Ga0207679_10363346
537 Ga0207651_10006429
538 Ga0207651_10242543
539 Ga0207712_10055101
540 Ga0207668_10570308
541 Ga0207703_10625024
542 Ga0207703_11330286
543 Ga0207703_11746028
544 Ga0207678_10196239
545 Ga0207678_10331572
546 Ga0207708_10166969
547 Ga0207641_10258727
548 Ga0207641_10747188
549 Ga0207641_11317825
550 Ga0207648_10032605
551 Ga0207648_10125713
552 Ga0207648_10400240
553 Ga0207676_11765122
554 Ga0207675_100094052
555 Ga0207675_100157462
556 Ga0207675_100909023
557 Ga0207675_102057541
558 Ga0207683_10101025
559 Ga0207683_10230002
560 Ga0207698_10540359
561 Ga0207698_12616026
562 Ga0210002_1047116
563 Ga0207428_11165794
564 Ga0268266_10122588
565 Ga0268266_10936982
566 Ga0268265_10231803
567 Ga0268265_10255843
568 Ga0268265_10603216
569 Ga0268264_10094919
570 Ga0268264_11445997
571 Ga0307408_100668079
572 Ga0307406_11316768
573 Ga0307409_101252841
574 Ga0307416_100594065
575 Ga0307416_100717954
576 Ga0307416_101141282
577 Ga0307416_102895940
578 Ga0373928_0287646
579 Ga0439453_0087006
580 Ga0439461_0112279
581 Ga0439431_0173194
582 Ga0439433_0166764
583 Ga0439445_0055712
584 Ga0450894_001180
585 Ga0450896_002751
586 Ga0439446_0040318
587 Ga0439446_0282192
588 Ga0450908_018741
589 Ga0450909_010699
590 Ga0439434_0080837
591 Ga0439435_0056082
592 Ga0439460_0191590
593 Ga0450918_002786
594 Ga0453683_0116689
595 Ga0466967_1357051
596 Ga0495663_0176342
597 Ga0495669_0011174
598 Ga0496101_0587014
599 Ga0496104_0485548
600 Ga0496106_0767349
601 Ga0496107_0656948
602 Ga0496108_0394764
603 Ga0496108_0903208
604 Ga0496109_0940652
605 Ga0496110_0043227
606 Ga0496114_0099573
607 Ga0501036_0270275
608 Ga0501036_0384080
609 Ga0501036_0518166
610 Ga0501037_0267132
611 Ga0501040_0006442
612 Ga0501040_0664712
613 Ga0501041_0007841
614 Ga0501041_0045560
615 Ga0501041_0093687
616 Ga0501042_0014029
617 Ga0501042_0047199
618 Ga0501042_1069885
619 Ga0501046_0116041
620 Ga0501048_0160512
621 Ga0501048_0346660
622 Ga0501068_0284119
623 Ga0501071_0046122
624 Ga0501071_0057509
625 Ga0501071_0224545
626 Ga0501071_0867261
627 Ga0501072_0067126
628 Ga0501072_0424080
629 Ga0501072_0483716
630 Ga0501072_0510755
631 Ga0501072_0528209
632 Ga0501072_0541052
633 Ga0501073_0538930
634 Ga0501073_0923489
635 Ga0501074_0054017
636 Ga0501074_0174103
637 Ga0501075_0044774
638 Ga0501075_0055065
639 Ga0501075_0186927
640 Ga0501075_0780687
641 Ga0501076_0001203
642 Ga0501076_0043957
643 Ga0501076_0132869
644 Ga0501076_0266907
645 Ga0501076_0736312
646 Ga0501077_0160032
647 Ga0501077_0191033
648 Ga0501077_0231808
649 Ga0501250_067206
650 Ga0501079_0058206
651 Ga0501079_0222054
652 Ga0501079_0350672
653 Ga0501079_1388694
654 Ga0501080_0775043
655 Ga0501080_1826768
656 Ga0501081_0179792
657 Ga0501081_0263669
658 Ga0501081_0667630
659 Ga0501083_0484305
660 Ga0501083_0882207
661 Ga0501083_1174177
662 Ga0501045_0053433
663 Ga0501045_0104614
664 Ga0501045_1104817
665 nmdc:mga06z11_298495_c1
666 nmdc:mga06z11_612943_c1
667 nmdc:mga06z11_963956_c1
668 nmdc:mga05p37_2115571_c1
669 nmdc:mga05p37_864415_c1
670 nmdc:mga05p37_898_c2
671 nmdc:mga05p37_929214_c1
672 nmdc:mga09592_6975_c1
673 nmdc:mga0qj67_2712_c1
674 nmdc:mga0qj67_492172_c1
675 nmdc:mga0qj67_743199_c1
676 nmdc:mga0qj67_894163_c1
677 nmdc:mga0qj67_955003_c1
678 nmdc:mga06r32_1048702_c1
679 nmdc:mga06r32_1367699_c1
680 nmdc:mga06r32_21893_c1
681 nmdc:mga06r32_245401_c1
682 nmdc:mga06r32_37125_c1
683 nmdc:mga06r32_71594_c1
684 nmdc:mga06r32_874172_c1
685 nmdc:mga08y16_693304_c1
686 nmdc:mga08y16_93245_c1
687 nmdc:mga0n895_554176_c1
688 nmdc:mga0n895_668820_c1
689 nmdc:mga0rr50_8939_c1
690 nmdc:mga08x19_713_c1
691 nmdc:mga0a205_400148_c1
692 nmdc:mga0a205_49663_c1
693 Ga0500641_0004687
694 Ga0500555_001205
695 Ga0500616_0000135
696 Ga0501084_0113692
697 Ga0501084_0303767
698 Ga0501084_0835129
699 Ga0501084_0989220
700 Ga0590071_000057
701 Ga0590071_035677
702 Ga0590071_042891
703 Ga0590071_114428
704 Ga0590074_003972
705 Ga0590075_000596
706 Ga0590077_000072
707 Ga0501082_0076822
708 Ga0501082_0265656
709 Ga0501082_0689181
710 Ga0501082_2022039
711 Ga0530510_0153838
712 Ga0530510_0441974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

40

114

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9288 6 105
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9209 6 108
6abq-assembly1.cif.gz_B crystal structure of transcription factor from listeria monocytogenes 0.9163 6 107
7wjp-assembly1.cif.gz_A-2 structure of padr-like protein from listeria monocytogenes 0.9155 9 109
4ejo-assembly2.cif.gz_B-3 crystal structure of padr family transcriptional regulator from eggerthella lenta dsm 2243 0.9049 9 106
ID Description Score Start End Superfamily
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9323 9 108 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9009 6 107 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8965 12 93 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8963 5 103 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8932 12 107 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1E3Y7L6-F1-model_v4 PadR family transcriptional regulator 0.9853 7 111
AF-A0A416EI77-F1-model_v4 PadR family transcriptional regulator 0.9806 9 108
AF-A0A6J4MA01-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9798 9 109
AF-A0A7G9P0E6-F1-model_v4 PadR family transcriptional regulator 0.9796 8 107
AF-A0A0K2GYX4-F1-model_v4 ParR family transcriptional regulator 0.9794 13 93

Map