F420638

General Info

Members Datasets Scaffolds Average Seq Length
356 199 712 262

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0096582|Ga0501032_0096582_979_1842
Length 287
Sequence MNRREFVSGAIAAGGTVLAGSGMSAARLQRAKNKLTETLMQSGTVGAGAEPAREYYELRRYHLRRGPKQALMDAHLRDAEIPAITRAGAGPVGVFNVMIGPESPTLHVLIVHKTLDTFATLGDRLAADAEYQRAGAEYLNAPATDPVFVRVDTWLMRAFTGQPTLHLPFGGGEAGKGRRIFELRTYESHSERAALKKIEMFNTGEMAIFHRAALEPVFFGQKLAGSDMPNLTYMLVYEDMAAHDKQWAAFGSDPEWRKLSTTPGYTDPEIVFNITNLFLRPTAYSQI

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
132 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
133 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 4.78
Rhizosphere 92.42
Stem 0
Stem Tuber 0
Unclassified 13.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0096582 3300049569 Bacteria 1958
2 rootH2_10152104 3300003320 Bacteria 5586
3 rootH2_10177657 3300003320 Bacteria 3344
4 Ga0065712_10000476 3300005290 Bacteria 13252
5 Ga0065712_10171028 3300005290 Bacteria 1244
6 Ga0065715_10000209 3300005293 Bacteria 33013
7 Ga0065715_10091890 3300005293 Bacteria 5482
8 Ga0065715_10122143 3300005293 Bacteria 2212
9 Ga0070676_10038552 3300005328 Bacteria 2760
10 Ga0070690_100013215 3300005330 Bacteria 4874
11 Ga0070690_100315610 3300005330 Bacteria 1125
12 Ga0070670_100018825 3300005331 Bacteria 5921
13 Ga0070670_100081170 3300005331 Bacteria 2787
14 Ga0070670_100142809 3300005331 Bacteria 2070
15 Ga0070670_100158495 3300005331 Bacteria 1961
16 Ga0070666_10135382 3300005335 Bacteria 1714
17 Ga0070682_100003795 3300005337 Bacteria 8402
18 Ga0070682_100100074 3300005337 Bacteria 1912
19 Ga0070660_100320242 3300005339 Bacteria 1274
20 Ga0070689_100122131 3300005340 Bacteria 2081
21 Ga0070689_100366774 3300005340 Bacteria 1211
22 Ga0070692_10088368 3300005345 Unclassified 1681
23 Ga0070692_10093833 3300005345 Unclassified 1635
24 Ga0070668_100179839 3300005347 Bacteria 1727
25 Ga0070675_100006357 3300005354 Bacteria 9073
26 Ga0070675_100065785 3300005354 Bacteria 2998
27 Ga0070675_100297207 3300005354 Bacteria 1422
28 Ga0070674_100006393 3300005356 Bacteria 6871
29 Ga0070674_100194744 3300005356 Bacteria 1561
30 Ga0070673_100011115 3300005364 Bacteria 6137
31 Ga0070688_100003127 3300005365 Bacteria 8464
32 Ga0070667_100266628 3300005367 Bacteria 1534
33 Ga0070714_100602526 3300005435 Unclassified 1055
34 Ga0070713_100174618 3300005436 Bacteria 1927
35 Ga0070700_100069253 3300005441 Bacteria 2246
36 Ga0070700_100073670 3300005441 Bacteria 2186
37 Ga0070700_100112693 3300005441 Bacteria 1811
38 Ga0070694_100030710 3300005444 Bacteria 3517
39 Ga0070694_100310286 3300005444 Unclassified 1211
40 Ga0070678_100027586 3300005456 Bacteria 3858
41 Ga0070662_100051557 3300005457 Bacteria 2972
42 Ga0070662_100151432 3300005457 Bacteria 1806
43 Ga0070681_10016626 3300005458 Bacteria 7345
44 Ga0068867_100148450 3300005459 Unclassified 1840
45 Ga0068867_100291459 3300005459 Bacteria 1342
46 Ga0068867_100382910 3300005459 Bacteria 1182
47 Ga0070685_10026272 3300005466 Bacteria 3208
48 Ga0070685_10338199 3300005466 Bacteria 1026
49 Ga0070706_100133602 3300005467 Bacteria 2316
50 Ga0070706_100218053 3300005467 Unclassified 1781
51 Ga0070698_100290022 3300005471 Bacteria 1567
52 Ga0070679_100043967 3300005530 Bacteria 4448
53 Ga0070679_100201307 3300005530 Bacteria 1957
54 Ga0070684_100257854 3300005535 Unclassified 1595
55 Ga0068853_100017224 3300005539 Bacteria 5964
56 Ga0070672_100077186 3300005543 Bacteria 2663
57 Ga0070686_100049225 3300005544 Bacteria 2673
58 Ga0070686_100287023 3300005544 Bacteria 1216
59 Ga0070695_100007022 3300005545 Bacteria 6673
60 Ga0070695_100007731 3300005545 Bacteria 6366
61 Ga0070704_100069708 3300005549 Bacteria 2549
62 Ga0068855_100001637 3300005563 Bacteria 28084
63 Ga0068855_100002663 3300005563 Bacteria 22004
64 Ga0068855_100028572 3300005563 Bacteria 6672
65 Ga0068855_100061935 3300005563 Unclassified 4369
66 Ga0070664_100044802 3300005564 Bacteria 3736
67 Ga0070664_100079766 3300005564 Bacteria 2818
68 Ga0070664_100203106 3300005564 Bacteria 1769
69 Ga0068857_100132073 3300005577 Bacteria 2252
70 Ga0068854_100230360 3300005578 Bacteria 1470
71 Ga0068852_100112455 3300005616 Bacteria 2478
72 Ga0068859_100070742 3300005617 Unclassified 3524
73 Ga0068859_100134614 3300005617 Bacteria 2543
74 Ga0068864_100008108 3300005618 Bacteria 8661
75 Ga0068864_100032757 3300005618 Bacteria 4417
76 Ga0068861_100735866 3300005719 Unclassified 920
77 Ga0068851_10063954 3300005834 Bacteria 1890
78 Ga0068863_100063178 3300005841 Bacteria 3502
79 Ga0068862_100375456 3300005844 Bacteria 1325
80 Ga0081455_10070210 3300005937 Bacteria 2909
81 Ga0075367_10059746 3300006178 Bacteria 2271
82 Ga0097621_100060443 3300006237 Bacteria 3106
83 Ga0075434_100093831 3300006871 Bacteria 3005
84 Ga0075434_100492769 3300006871 Unclassified 1246
85 Ga0075429_100321335 3300006880 Bacteria 1355
86 Ga0068865_100348533 3300006881 Bacteria 1199
87 Ga0097620_100070744 3300006931 Unclassified 3524
88 Ga0097620_100134612 3300006931 Bacteria 2543
89 Ga0105240_10000001 3300009093 Bacteria 2887840
90 Ga0105240_10014740 3300009093 Bacteria 10662
91 Ga0105240_10197962 3300009093 Bacteria 2357
92 Ga0105240_10750136 3300009093 Bacteria 1061
93 Ga0111539_10610237 3300009094 Unclassified 1271
94 Ga0105245_10105321 3300009098 Bacteria 2616
95 Ga0105245_10209747 3300009098 Bacteria 1874
96 Ga0114129_10570206 3300009147 Bacteria 1470
97 Ga0105243_10115460 3300009148 Bacteria 2254
98 Ga0105242_10118170 3300009176 Bacteria 2271
99 Ga0105248_10003966 3300009177 Bacteria 16370
100 Ga0105248_10118467 3300009177 Bacteria 2987
101 Ga0105248_10160697 3300009177 Bacteria 2534
102 Ga0105238_10161868 3300009551 Unclassified 2213
103 Ga0105238_10381624 3300009551 Bacteria 1401
104 Ga0105249_10005040 3300009553 Bacteria 11383
105 Ga0105249_10293792 3300009553 Bacteria 1627
106 Ga0105239_10025829 3300010375 Bacteria 6469
107 Ga0105246_10084268 3300011119 Bacteria 2273
108 Ga0157370_10007470 3300013104 Bacteria 11878
109 Ga0157370_10227102 3300013104 Bacteria 1728
110 Ga0157369_10012558 3300013105 Bacteria 9609
111 Ga0157374_10674827 3300013296 Unclassified 1046
112 Ga0157378_10140553 3300013297 Bacteria 2242
113 Ga0163162_10381670 3300013306 Bacteria 1542
114 Ga0157375_10067930 3300013308 Bacteria 3564
115 Ga0163163_10128176 3300014325 Unclassified 2576
116 Ga0157376_10093457 3300014969 Bacteria 2611
117 Ga0157376_10168131 3300014969 Bacteria 1994
118 Ga0163161_10228589 3300017792 Bacteria 1443
119 Ga0206352_10213608 3300020078 Bacteria 2069
120 Ga0213876_10004246 3300021384 Bacteria 8040
121 Ga0213875_10000020 3300021388 Bacteria 218266
122 Ga0207666_1007154 3300025271 Bacteria 1463
123 Ga0207697_10025941 3300025315 Bacteria 2395
124 Ga0207688_10102122 3300025901 Bacteria 1657
125 Ga0207680_10252010 3300025903 Unclassified 1220
126 Ga0207643_10022741 3300025908 Bacteria 3454
127 Ga0207707_10037168 3300025912 Bacteria 4254
128 Ga0207695_10000254 3300025913 Bacteria 137177
129 Ga0207695_10120905 3300025913 Bacteria 2587
130 Ga0207662_10005063 3300025918 Bacteria 6983
131 Ga0207649_10131265 3300025920 Bacteria 1702
132 Ga0207652_10069734 3300025921 Bacteria 3052
133 Ga0207650_10019661 3300025925 Bacteria 4748
134 Ga0207650_10063800 3300025925 Bacteria 2755
135 Ga0207659_10010150 3300025926 Bacteria 5906
136 Ga0207659_10084850 3300025926 Bacteria 2351
137 Ga0207664_10479178 3300025929 Unclassified 1113
138 Ga0207644_10218519 3300025931 Bacteria 1510
139 Ga0207706_10069228 3300025933 Bacteria 3104
140 Ga0207706_10112816 3300025933 Bacteria 2391
141 Ga0207706_10381454 3300025933 Unclassified 1223
142 Ga0207670_10422639 3300025936 Bacteria 1069
143 Ga0207669_10003249 3300025937 Bacteria 7023
144 Ga0207704_10031366 3300025938 Bacteria 2993
145 Ga0207704_10260872 3300025938 Bacteria 1306
146 Ga0207691_10084377 3300025940 Bacteria 2851
147 Ga0207711_10068004 3300025941 Bacteria 3085
148 Ga0207711_10090641 3300025941 Unclassified 2688
149 Ga0207711_10125238 3300025941 Bacteria 2298
150 Ga0207679_10105624 3300025945 Bacteria 2212
151 Ga0207679_10338003 3300025945 Bacteria 1309
152 Ga0207679_10452783 3300025945 Bacteria 1138
153 Ga0207667_10011749 3300025949 Bacteria 10153
154 Ga0207667_10065721 3300025949 Unclassified 3782
155 Ga0207667_10414286 3300025949 Bacteria 1371
156 Ga0207712_10013113 3300025961 Bacteria 5310
157 Ga0207712_10063704 3300025961 Bacteria 2625
158 Ga0207712_10284709 3300025961 Bacteria 1350
159 Ga0207658_10158034 3300025986 Bacteria 1855
160 Ga0207658_10339541 3300025986 Unclassified 1305
161 Ga0207677_10255319 3300026023 Bacteria 1426
162 Ga0207677_10366442 3300026023 Bacteria 1212
163 Ga0207678_10047535 3300026067 Bacteria 3711
164 Ga0207708_10103668 3300026075 Bacteria 2203
165 Ga0207648_10044390 3300026089 Bacteria 3899
166 Ga0207648_10049438 3300026089 Bacteria 3679
167 Ga0207648_10608663 3300026089 Bacteria 1007
168 Ga0207676_10012963 3300026095 Bacteria 5987
169 Ga0207676_10373117 3300026095 Unclassified 1326
170 Ga0207675_100076621 3300026118 Bacteria 3132
171 Ga0207683_10008526 3300026121 Bacteria 8773
172 Ga0207683_10395442 3300026121 Unclassified 1271
173 Ga0207698_10012399 3300026142 Bacteria 5575
174 Ga0207698_10096025 3300026142 Bacteria 2442
175 Ga0268266_10012269 3300028379 Bacteria 7413
176 Ga0265319_1024889 3300028563 Bacteria 2148
177 Ga0265338_10014943 3300028800 Bacteria 8581
178 Ga0265338_10038444 3300028800 Bacteria 4535
179 Ga0265332_10010014 3300031238 Unclassified 4223
180 Ga0265328_10024732 3300031239 Bacteria 2266
181 Ga0265320_10007624 3300031240 Bacteria 6701
182 Ga0265320_10030199 3300031240 Bacteria 2797
183 Ga0265329_10002552 3300031242 Bacteria 8219
184 Ga0265339_10037481 3300031249 Unclassified 2709
185 Ga0265331_10120279 3300031250 Unclassified 1201
186 Ga0265327_10025533 3300031251 Bacteria 3442
187 Ga0265316_10206860 3300031344 Bacteria 1453
188 Ga0265316_10309186 3300031344 Bacteria 1150
189 Ga0307408_100074929 3300031548 Bacteria 2513
190 Ga0265314_10000042 3300031711 Bacteria 215775
191 Ga0307409_100027312 3300031995 Bacteria 4043
192 Ga0307416_100413298 3300032002 Bacteria 1391
193 Ga0307411_10067645 3300032005 Bacteria 2405
194 Ga0307415_100021119 3300032126 Bacteria 3994
195 Ga0316583_10024233 3300032133 Unclassified 2167
196 Ga0373937_0264683 3300036401 Bacteria 1622
197 Ga0436364_0070103 3300037853 Bacteria 509097
198 Ga0436364_0573816 3300037853 Bacteria 6844
199 Ga0436365_0262116 3300039437 Bacteria 1689
200 Ga0436365_1763167 3300039437 Bacteria 50607
201 Ga0451798_0933680 3300041458 Unclassified 1144
202 Ga0439433_0072615 3300041999 Unclassified 830
203 Ga0439464_0112100 3300042439 Bacteria 836
204 Ga0451577_0120398 3300042876 Bacteria 2351
205 Ga0451577_0195385 3300042876 Bacteria 1826
206 Ga0453683_0005521 3300044673 Bacteria 8815
207 Ga0453683_0039333 3300044673 Bacteria 2973
208 Ga0453683_0045563 3300044673 Unclassified 2750
209 Ga0453684_0046981 3300044712 Bacteria 5732
210 Ga0451576_0112066 3300045051 Bacteria 2839
211 Ga0451576_0358807 3300045051 Unclassified 1526
212 Ga0495590_0057502 3300046457 Bacteria 1360
213 Ga0495618_0196655 3300046514 Unclassified 1277
214 Ga0495630_0000364 3300046517 Bacteria 35933
215 Ga0495666_0025095 3300046526 Unclassified 2945
216 Ga0495640_0060215 3300046533 Unclassified 2583
217 Ga0495586_0000245 3300046535 Bacteria 36159
218 Ga0495586_0255191 3300046535 Bacteria 1001
219 Ga0495621_0010845 3300046539 Bacteria 2803
220 Ga0495634_0004771 3300046642 Bacteria 10539
221 Ga0495635_0071842 3300046663 Bacteria 2372
222 Ga0495613_0245728 3300046689 Bacteria 1250
223 Ga0495624_0164434 3300046690 Unclassified 1355
224 Ga0495600_0125153 3300046809 Bacteria 1672
225 Ga0495674_0000908 3300047319 Bacteria 28294
226 Ga0495676_0025126 3300047321 Bacteria 5146
227 Ga0495675_0069218 3300047444 Bacteria 2229
228 Ga0495614_0190810 3300048089 Unclassified 924
229 Ga0496100_0061062 3300048903 Bacteria 2483
230 Ga0496100_0164935 3300048903 Bacteria 1591
231 Ga0496101_0049233 3300048904 Bacteria 3031
232 Ga0496104_0003760 3300048907 Bacteria 13119
233 Ga0496104_0060059 3300048907 Bacteria 3601
234 Ga0496105_0023711 3300048908 Bacteria 4981
235 Ga0496108_0092453 3300048911 Bacteria 2572
236 Ga0496109_0000931 3300048912 Bacteria 24259
237 Ga0496109_0164545 3300048912 Bacteria 2079
238 Ga0496110_0096207 3300048913 Bacteria 2653
239 Ga0496112_0001144 3300048915 Bacteria 19782
240 Ga0496112_0210120 3300048915 Unclassified 1904
241 Ga0496114_0044149 3300048917 Bacteria 3697
242 Ga0496114_0307832 3300048917 Bacteria 1399
243 Ga0496114_0835776 3300048917 Unclassified 801
244 Ga0496115_0091271 3300048918 Bacteria 2489
245 Ga0501031_0008571 3300049568 Bacteria 6652
246 Ga0501032_0026509 3300049569 Bacteria 3984
247 Ga0501033_0003157 3300049570 Bacteria 13688
248 Ga0501033_0005063 3300049570 Bacteria 10494
249 Ga0501034_0001012 3300049571 Bacteria 40282
250 Ga0501034_0043936 3300049571 Bacteria 4520
251 Ga0501034_0161371 3300049571 Bacteria 2212
252 Ga0501034_0310204 3300049571 Bacteria 1512
253 Ga0501034_0364177 3300049571 Bacteria 1372
254 Ga0501036_0010490 3300049572 Bacteria 7654
255 Ga0501036_0046056 3300049572 Bacteria 3693
256 Ga0501036_0052205 3300049572 Bacteria 3462
257 Ga0501036_0125305 3300049572 Bacteria 2169
258 Ga0501036_0140851 3300049572 Bacteria 2035
259 Ga0501036_0142082 3300049572 Bacteria 2025
260 Ga0501037_0007126 3300049573 Bacteria 8171
261 Ga0501037_0059404 3300049573 Bacteria 2789
262 Ga0501037_0066791 3300049573 Unclassified 2619
263 Ga0501037_0143907 3300049573 Bacteria 1705
264 Ga0501037_0427033 3300049573 Unclassified 906
265 Ga0501038_0021557 3300049574 Bacteria 5781
266 Ga0501038_0025123 3300049574 Bacteria 5311
267 Ga0501038_0051318 3300049574 Bacteria 3560
268 Ga0501039_0009896 3300049575 Bacteria 7269
269 Ga0501039_0032662 3300049575 Bacteria 4013
270 Ga0501040_0113967 3300049576 Bacteria 1892
271 Ga0501042_0012810 3300049578 Bacteria 5693
272 Ga0501042_0097869 3300049578 Bacteria 2109
273 Ga0501042_0442908 3300049578 Bacteria 942
274 Ga0501043_0000717 3300049579 Bacteria 29385
275 Ga0501043_0012735 3300049579 Bacteria 6573
276 Ga0501043_0051043 3300049579 Unclassified 3251
277 Ga0501043_0075443 3300049579 Bacteria 2648
278 Ga0501043_0079607 3300049579 Unclassified 2574
279 Ga0501046_0067686 3300049580 Bacteria 2780
280 Ga0501046_0080853 3300049580 Bacteria 2510
281 Ga0501046_0141648 3300049580 Bacteria 1819
282 Ga0501046_0164611 3300049580 Bacteria 1666
283 Ga0501046_0233360 3300049580 Bacteria 1358
284 Ga0501047_0005715 3300049581 Bacteria 11705
285 Ga0501047_0010475 3300049581 Bacteria 8773
286 Ga0501047_0014928 3300049581 Bacteria 7391
287 Ga0501047_0079238 3300049581 Bacteria 3158
288 Ga0501047_0095848 3300049581 Bacteria 2845
289 Ga0501047_0186958 3300049581 Bacteria 1936
290 Ga0501047_0358787 3300049581 Bacteria 1293
291 Ga0501048_0030676 3300049582 Bacteria 3889
292 Ga0501048_0043976 3300049582 Bacteria 3195
293 Ga0501048_0251540 3300049582 Bacteria 1254
294 Ga0501048_0300506 3300049582 Bacteria 1142
295 Ga0501067_0000563 3300049583 Bacteria 20070
296 Ga0501067_0130051 3300049583 Bacteria 1401
297 Ga0501067_0139819 3300049583 Bacteria 1348
298 Ga0501068_0006368 3300049584 Bacteria 6506
299 Ga0501068_0006477 3300049584 Bacteria 6456
300 Ga0501068_0009200 3300049584 Bacteria 5520
301 Ga0501068_0047017 3300049584 Bacteria 2602
302 Ga0501068_0198503 3300049584 Bacteria 1272
303 Ga0501069_0059208 3300049585 Bacteria 2138
304 Ga0501069_0218683 3300049585 Bacteria 1106
305 Ga0501069_0306227 3300049585 Bacteria 932
306 Ga0501070_0313650 3300049586 Bacteria 1276
307 Ga0501070_0571877 3300049586 Unclassified 903
308 Ga0501071_0003144 3300049587 Bacteria 10261
309 Ga0501072_0010533 3300049588 Bacteria 7039
310 Ga0501072_0058276 3300049588 Bacteria 3044
311 Ga0501072_0149044 3300049588 Bacteria 1865
312 Ga0501073_0022914 3300049589 Bacteria 4491
313 Ga0501073_0023312 3300049589 Bacteria 4444
314 Ga0501073_0032389 3300049589 Bacteria 3726
315 Ga0501073_0035193 3300049589 Bacteria 3560
316 Ga0501073_0056048 3300049589 Bacteria 2757
317 Ga0501073_0103496 3300049589 Bacteria 1976
318 Ga0501073_0203857 3300049589 Bacteria 1367
319 Ga0501074_0120381 3300049590 Bacteria 1877
320 Ga0501074_0309772 3300049590 Bacteria 1121
321 Ga0501076_0392636 3300049592 Unclassified 1141
322 Ga0501076_0416820 3300049592 Bacteria 1105
323 Ga0501079_0005448 3300049741 Bacteria 9483
324 Ga0501079_0013504 3300049741 Bacteria 6227
325 Ga0501079_0517271 3300049741 Bacteria 938
326 Ga0501080_0011716 3300049742 Bacteria 8035
327 Ga0501080_0080346 3300049742 Bacteria 3030
328 Ga0501080_0087259 3300049742 Bacteria 2898
329 Ga0501080_0221003 3300049742 Bacteria 1733
330 Ga0501080_0476845 3300049742 Bacteria 1116
331 Ga0501081_0114968 3300049743 Bacteria 1912
332 Ga0501083_0010908 3300049744 Bacteria 6391
333 Ga0501035_0033540 3300049822 Bacteria 4669
334 Ga0501035_0092803 3300049822 Bacteria 2656
335 Ga0501035_0106628 3300049822 Bacteria 2456
336 Ga0501035_0267231 3300049822 Bacteria 1448
337 Ga0501044_0002281 3300049823 Bacteria 21863
338 Ga0501044_0013571 3300049823 Bacteria 8804
339 Ga0501044_0103789 3300049823 Bacteria 2857
340 Ga0501045_0006930 3300049824 Bacteria 7854
341 Ga0501045_0008172 3300049824 Bacteria 7289
342 nmdc:mga06z11_103413_c1 3300050494 Bacteria 1566
343 nmdc:mga09592_282883_c1 3300050508 Bacteria 1438
344 nmdc:mga09592_313178_c1 3300050508 Bacteria 1360
345 nmdc:mga08y16_233232_c1 3300050511 Unclassified 1903
346 nmdc:mga0n895_148495_c1 3300050512 Bacteria 2373
347 nmdc:mga0n895_488683_c1 3300050512 Unclassified 1241
348 Ga0495619_0028292 3300053085 Bacteria 3615
349 Ga0501084_0024991 3300054114 Bacteria 4984
350 Ga0501084_0037839 3300054114 Bacteria 4032
351 Ga0501084_0183137 3300054114 Bacteria 1768
352 Ga0501082_0015130 3300060353 Bacteria 6647
353 Ga0501082_0016997 3300060353 Bacteria 6264
354 Ga0501082_0046251 3300060353 Bacteria 3751
355 Ga0501082_0260805 3300060353 Bacteria 1507
356 Ga0501082_0795423 3300060353 Bacteria 827
357 Ga0501032_0096582
358 rootH2_10152104
359 rootH2_10177657
360 Ga0065712_10000476
361 Ga0065712_10171028
362 Ga0065715_10000209
363 Ga0065715_10091890
364 Ga0065715_10122143
365 Ga0070676_10038552
366 Ga0070690_100013215
367 Ga0070690_100315610
368 Ga0070670_100018825
369 Ga0070670_100081170
370 Ga0070670_100142809
371 Ga0070670_100158495
372 Ga0070666_10135382
373 Ga0070682_100003795
374 Ga0070682_100100074
375 Ga0070660_100320242
376 Ga0070689_100122131
377 Ga0070689_100366774
378 Ga0070692_10088368
379 Ga0070692_10093833
380 Ga0070668_100179839
381 Ga0070675_100006357
382 Ga0070675_100065785
383 Ga0070675_100297207
384 Ga0070674_100006393
385 Ga0070674_100194744
386 Ga0070673_100011115
387 Ga0070688_100003127
388 Ga0070667_100266628
389 Ga0070714_100602526
390 Ga0070713_100174618
391 Ga0070700_100069253
392 Ga0070700_100073670
393 Ga0070700_100112693
394 Ga0070694_100030710
395 Ga0070694_100310286
396 Ga0070678_100027586
397 Ga0070662_100051557
398 Ga0070662_100151432
399 Ga0070681_10016626
400 Ga0068867_100148450
401 Ga0068867_100291459
402 Ga0068867_100382910
403 Ga0070685_10026272
404 Ga0070685_10338199
405 Ga0070706_100133602
406 Ga0070706_100218053
407 Ga0070698_100290022
408 Ga0070679_100043967
409 Ga0070679_100201307
410 Ga0070684_100257854
411 Ga0068853_100017224
412 Ga0070672_100077186
413 Ga0070686_100049225
414 Ga0070686_100287023
415 Ga0070695_100007022
416 Ga0070695_100007731
417 Ga0070704_100069708
418 Ga0068855_100001637
419 Ga0068855_100002663
420 Ga0068855_100028572
421 Ga0068855_100061935
422 Ga0070664_100044802
423 Ga0070664_100079766
424 Ga0070664_100203106
425 Ga0068857_100132073
426 Ga0068854_100230360
427 Ga0068852_100112455
428 Ga0068859_100070742
429 Ga0068859_100134614
430 Ga0068864_100008108
431 Ga0068864_100032757
432 Ga0068861_100735866
433 Ga0068851_10063954
434 Ga0068863_100063178
435 Ga0068862_100375456
436 Ga0081455_10070210
437 Ga0075367_10059746
438 Ga0097621_100060443
439 Ga0075434_100093831
440 Ga0075434_100492769
441 Ga0075429_100321335
442 Ga0068865_100348533
443 Ga0097620_100070744
444 Ga0097620_100134612
445 Ga0105240_10000001
446 Ga0105240_10014740
447 Ga0105240_10197962
448 Ga0105240_10750136
449 Ga0111539_10610237
450 Ga0105245_10105321
451 Ga0105245_10209747
452 Ga0114129_10570206
453 Ga0105243_10115460
454 Ga0105242_10118170
455 Ga0105248_10003966
456 Ga0105248_10118467
457 Ga0105248_10160697
458 Ga0105238_10161868
459 Ga0105238_10381624
460 Ga0105249_10005040
461 Ga0105249_10293792
462 Ga0105239_10025829
463 Ga0105246_10084268
464 Ga0157370_10007470
465 Ga0157370_10227102
466 Ga0157369_10012558
467 Ga0157374_10674827
468 Ga0157378_10140553
469 Ga0163162_10381670
470 Ga0157375_10067930
471 Ga0163163_10128176
472 Ga0157376_10093457
473 Ga0157376_10168131
474 Ga0163161_10228589
475 Ga0206352_10213608
476 Ga0213876_10004246
477 Ga0213875_10000020
478 Ga0207666_1007154
479 Ga0207697_10025941
480 Ga0207688_10102122
481 Ga0207680_10252010
482 Ga0207643_10022741
483 Ga0207707_10037168
484 Ga0207695_10000254
485 Ga0207695_10120905
486 Ga0207662_10005063
487 Ga0207649_10131265
488 Ga0207652_10069734
489 Ga0207650_10019661
490 Ga0207650_10063800
491 Ga0207659_10010150
492 Ga0207659_10084850
493 Ga0207664_10479178
494 Ga0207644_10218519
495 Ga0207706_10069228
496 Ga0207706_10112816
497 Ga0207706_10381454
498 Ga0207670_10422639
499 Ga0207669_10003249
500 Ga0207704_10031366
501 Ga0207704_10260872
502 Ga0207691_10084377
503 Ga0207711_10068004
504 Ga0207711_10090641
505 Ga0207711_10125238
506 Ga0207679_10105624
507 Ga0207679_10338003
508 Ga0207679_10452783
509 Ga0207667_10011749
510 Ga0207667_10065721
511 Ga0207667_10414286
512 Ga0207712_10013113
513 Ga0207712_10063704
514 Ga0207712_10284709
515 Ga0207658_10158034
516 Ga0207658_10339541
517 Ga0207677_10255319
518 Ga0207677_10366442
519 Ga0207678_10047535
520 Ga0207708_10103668
521 Ga0207648_10044390
522 Ga0207648_10049438
523 Ga0207648_10608663
524 Ga0207676_10012963
525 Ga0207676_10373117
526 Ga0207675_100076621
527 Ga0207683_10008526
528 Ga0207683_10395442
529 Ga0207698_10012399
530 Ga0207698_10096025
531 Ga0268266_10012269
532 Ga0265319_1024889
533 Ga0265338_10014943
534 Ga0265338_10038444
535 Ga0265332_10010014
536 Ga0265328_10024732
537 Ga0265320_10007624
538 Ga0265320_10030199
539 Ga0265329_10002552
540 Ga0265339_10037481
541 Ga0265331_10120279
542 Ga0265327_10025533
543 Ga0265316_10206860
544 Ga0265316_10309186
545 Ga0307408_100074929
546 Ga0265314_10000042
547 Ga0307409_100027312
548 Ga0307416_100413298
549 Ga0307411_10067645
550 Ga0307415_100021119
551 Ga0316583_10024233
552 Ga0373937_0264683
553 Ga0436364_0070103
554 Ga0436364_0573816
555 Ga0436365_0262116
556 Ga0436365_1763167
557 Ga0451798_0933680
558 Ga0439433_0072615
559 Ga0439464_0112100
560 Ga0451577_0120398
561 Ga0451577_0195385
562 Ga0453683_0005521
563 Ga0453683_0039333
564 Ga0453683_0045563
565 Ga0453684_0046981
566 Ga0451576_0112066
567 Ga0451576_0358807
568 Ga0495590_0057502
569 Ga0495618_0196655
570 Ga0495630_0000364
571 Ga0495666_0025095
572 Ga0495640_0060215
573 Ga0495586_0000245
574 Ga0495586_0255191
575 Ga0495621_0010845
576 Ga0495634_0004771
577 Ga0495635_0071842
578 Ga0495613_0245728
579 Ga0495624_0164434
580 Ga0495600_0125153
581 Ga0495674_0000908
582 Ga0495676_0025126
583 Ga0495675_0069218
584 Ga0495614_0190810
585 Ga0496100_0061062
586 Ga0496100_0164935
587 Ga0496101_0049233
588 Ga0496104_0003760
589 Ga0496104_0060059
590 Ga0496105_0023711
591 Ga0496108_0092453
592 Ga0496109_0000931
593 Ga0496109_0164545
594 Ga0496110_0096207
595 Ga0496112_0001144
596 Ga0496112_0210120
597 Ga0496114_0044149
598 Ga0496114_0307832
599 Ga0496114_0835776
600 Ga0496115_0091271
601 Ga0501031_0008571
602 Ga0501032_0026509
603 Ga0501033_0003157
604 Ga0501033_0005063
605 Ga0501034_0001012
606 Ga0501034_0043936
607 Ga0501034_0161371
608 Ga0501034_0310204
609 Ga0501034_0364177
610 Ga0501036_0010490
611 Ga0501036_0046056
612 Ga0501036_0052205
613 Ga0501036_0125305
614 Ga0501036_0140851
615 Ga0501036_0142082
616 Ga0501037_0007126
617 Ga0501037_0059404
618 Ga0501037_0066791
619 Ga0501037_0143907
620 Ga0501037_0427033
621 Ga0501038_0021557
622 Ga0501038_0025123
623 Ga0501038_0051318
624 Ga0501039_0009896
625 Ga0501039_0032662
626 Ga0501040_0113967
627 Ga0501042_0012810
628 Ga0501042_0097869
629 Ga0501042_0442908
630 Ga0501043_0000717
631 Ga0501043_0012735
632 Ga0501043_0051043
633 Ga0501043_0075443
634 Ga0501043_0079607
635 Ga0501046_0067686
636 Ga0501046_0080853
637 Ga0501046_0141648
638 Ga0501046_0164611
639 Ga0501046_0233360
640 Ga0501047_0005715
641 Ga0501047_0010475
642 Ga0501047_0014928
643 Ga0501047_0079238
644 Ga0501047_0095848
645 Ga0501047_0186958
646 Ga0501047_0358787
647 Ga0501048_0030676
648 Ga0501048_0043976
649 Ga0501048_0251540
650 Ga0501048_0300506
651 Ga0501067_0000563
652 Ga0501067_0130051
653 Ga0501067_0139819
654 Ga0501068_0006368
655 Ga0501068_0006477
656 Ga0501068_0009200
657 Ga0501068_0047017
658 Ga0501068_0198503
659 Ga0501069_0059208
660 Ga0501069_0218683
661 Ga0501069_0306227
662 Ga0501070_0313650
663 Ga0501070_0571877
664 Ga0501071_0003144
665 Ga0501072_0010533
666 Ga0501072_0058276
667 Ga0501072_0149044
668 Ga0501073_0022914
669 Ga0501073_0023312
670 Ga0501073_0032389
671 Ga0501073_0035193
672 Ga0501073_0056048
673 Ga0501073_0103496
674 Ga0501073_0203857
675 Ga0501074_0120381
676 Ga0501074_0309772
677 Ga0501076_0392636
678 Ga0501076_0416820
679 Ga0501079_0005448
680 Ga0501079_0013504
681 Ga0501079_0517271
682 Ga0501080_0011716
683 Ga0501080_0080346
684 Ga0501080_0087259
685 Ga0501080_0221003
686 Ga0501080_0476845
687 Ga0501081_0114968
688 Ga0501083_0010908
689 Ga0501035_0033540
690 Ga0501035_0092803
691 Ga0501035_0106628
692 Ga0501035_0267231
693 Ga0501044_0002281
694 Ga0501044_0013571
695 Ga0501044_0103789
696 Ga0501045_0006930
697 Ga0501045_0008172
698 nmdc:mga06z11_103413_c1
699 nmdc:mga09592_282883_c1
700 nmdc:mga09592_313178_c1
701 nmdc:mga08y16_233232_c1
702 nmdc:mga0n895_148495_c1
703 nmdc:mga0n895_488683_c1
704 Ga0495619_0028292
705 Ga0501084_0024991
706 Ga0501084_0037839
707 Ga0501084_0183137
708 Ga0501082_0015130
709 Ga0501082_0016997
710 Ga0501082_0046251
711 Ga0501082_0260805
712 Ga0501082_0795423

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07978

NIPSNAP

NIPSNAP

181

286

0.92

PF07978

NIPSNAP

NIPSNAP

56

144

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k9f-assembly1.cif.gz_A crystal structure of a nipsnap domain protein from burkholderia xenovorans 0.8909 156 263
5k9f-assembly1.cif.gz_A crystal structure of a nipsnap domain protein from burkholderia xenovorans 0.8752 156 263
5ixu-assembly1.cif.gz_A crystal structure of an uncharacterized nipsnap domain protein from burkholderia xenovorans 0.8738 156 259
5kak-assembly1.cif.gz_E crystal structure of an uncharacterized nipsnap-like domain protein from burkholderia xenovorans 0.8716 154 259
5ixu-assembly1.cif.gz_A crystal structure of an uncharacterized nipsnap domain protein from burkholderia xenovorans 0.8279 156 259
ID Description Score Start End Superfamily
5k9fA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8908 156 263 3.30.70.100
af_F6NVH9_176_279_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8835 153 259 3.30.70.100
5k9fA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8752 156 263 3.30.70.100
5ixuA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8739 156 259 3.30.70.100
5kakE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8716 154 259 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A1H6C719-F1-model_v4 NIPSNAP protein 0.9808 31 263
AF-A0A1H6C719-F1-model_v4 NIPSNAP protein 0.9724 31 263
AF-A0A3N5KV10-F1-model_v4 NIPSNAP family containing protein 0.9672 26 263
AF-A0A7Y9NIE8-F1-model_v4 NIPSNAP domain-containing protein 0.9646 65 263
AF-A0A7Y9NIE8-F1-model_v4 NIPSNAP domain-containing protein 0.9598 65 263

Map