F420504

General Info

Members Datasets Scaffolds Average Seq Length
356 202 712 99

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_12196914|Ga0157379_121969141
Length 114
Sequence MSAEPDLRGRWRLDPQVALRPERFGALAYHFGTRRLSFLKSRRLLQVVEGLEGAADPAAACRAAGVAEAELPSYRRALATLAETGMIVPAPREAPGCGAFPPHRTGKAPQEVVA

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
104 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
105 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
195 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
199 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
200 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.25
Nodule 0
Rhizoplane 10.67
Rhizosphere 80.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_12196914 3300014968 Bacteria 548
2 Ga0070670_100287707 3300005331 Bacteria 1436
3 Ga0070666_10003880 3300005335 Bacteria 9079
4 Ga0070680_100288448 3300005336 Bacteria 1391
5 Ga0070689_100138440 3300005340 Bacteria 1956
6 Ga0070692_10054540 3300005345 Bacteria 2087
7 Ga0070668_100908211 3300005347 Bacteria 787
8 Ga0070668_101594825 3300005347 Bacteria 598
9 Ga0070669_101521211 3300005353 Bacteria 582
10 Ga0070675_100670873 3300005354 Bacteria 943
11 Ga0070659_100030960 3300005366 Bacteria 4142
12 Ga0070659_100612086 3300005366 Bacteria 937
13 Ga0070659_101465007 3300005366 Bacteria 608
14 Ga0070667_100004761 3300005367 Bacteria 11369
15 Ga0070667_100500695 3300005367 Bacteria 1114
16 Ga0070709_10433011 3300005434 Bacteria 988
17 Ga0070709_11132077 3300005434 Bacteria 627
18 Ga0070714_100018701 3300005435 Bacteria 5635
19 Ga0070714_100133743 3300005435 Bacteria 2218
20 Ga0070714_101575870 3300005435 Bacteria 642
21 Ga0070713_100098013 3300005436 Bacteria 2534
22 Ga0070713_100133854 3300005436 Bacteria 2188
23 Ga0070710_10027942 3300005437 Bacteria 3013
24 Ga0070710_10989831 3300005437 Bacteria 612
25 Ga0070711_100207128 3300005439 Bacteria 1516
26 Ga0070681_10742613 3300005458 Bacteria 898
27 Ga0068853_100384805 3300005539 Bacteria 1311
28 Ga0070696_100317745 3300005546 Bacteria 1198
29 Ga0070665_100003634 3300005548 Bacteria 16344
30 Ga0068854_101379246 3300005578 Bacteria 637
31 Ga0068856_100873661 3300005614 Bacteria 918
32 Ga0070702_100094358 3300005615 Bacteria 1822
33 Ga0068852_100413169 3300005616 Bacteria 1330
34 Ga0068859_100632247 3300005617 Bacteria 1163
35 Ga0068864_100441170 3300005618 Bacteria 1243
36 Ga0068864_102211875 3300005618 Bacteria 556
37 Ga0068861_102259445 3300005719 Bacteria 545
38 Ga0068851_10537978 3300005834 Bacteria 705
39 Ga0068870_10084333 3300005840 Bacteria 1763
40 Ga0068860_100752989 3300005843 Bacteria 986
41 Ga0068862_102675807 3300005844 Bacteria 510
42 Ga0081455_10002091 3300005937 Bacteria 23830
43 Ga0081455_10029108 3300005937 Bacteria 5038
44 Ga0081455_10795151 3300005937 Bacteria 594
45 Ga0081539_10001862 3300005985 Bacteria 33219
46 Ga0081539_10006571 3300005985 Bacteria 11071
47 Ga0081539_10214090 3300005985 Bacteria 881
48 Ga0070717_10419097 3300006028 Bacteria 1204
49 Ga0070717_10441910 3300006028 Bacteria 1171
50 Ga0070717_11061718 3300006028 Bacteria 738
51 Ga0075365_10935673 3300006038 Bacteria 611
52 Ga0075364_10135715 3300006051 Bacteria 1653
53 Ga0070715_10465032 3300006163 Bacteria 717
54 Ga0070716_100274109 3300006173 Bacteria 1161
55 Ga0070716_101179562 3300006173 Bacteria 614
56 Ga0070712_100040342 3300006175 Bacteria 3200
57 Ga0070712_100157927 3300006175 Bacteria 1748
58 Ga0070712_100202074 3300006175 Bacteria 1562
59 Ga0075428_100157782 3300006844 Bacteria 2464
60 Ga0068865_100637113 3300006881 Bacteria 905
61 Ga0097620_100632302 3300006931 Bacteria 1163
62 Ga0105245_10052659 3300009098 Bacteria 3650
63 Ga0105245_10172929 3300009098 Bacteria 2058
64 Ga0105245_10766000 3300009098 Bacteria 1002
65 Ga0105247_10820159 3300009101 Bacteria 711
66 Ga0105243_10804076 3300009148 Bacteria 927
67 Ga0105243_11211708 3300009148 Bacteria 768
68 Ga0105242_11289635 3300009176 Bacteria 754
69 Ga0105242_13057120 3300009176 Bacteria 518
70 Ga0105248_10336982 3300009177 Bacteria 1698
71 Ga0105248_12454730 3300009177 Bacteria 594
72 Ga0105238_11942466 3300009551 Bacteria 622
73 Ga0105249_10156276 3300009553 Bacteria 2200
74 Ga0105239_10050847 3300010375 Bacteria 4544
75 Ga0105246_10184097 3300011119 Bacteria 1611
76 Ga0157371_10457373 3300013102 Bacteria 939
77 Ga0157369_10581091 3300013105 Bacteria 1157
78 Ga0163162_13133474 3300013306 Bacteria 531
79 Ga0157375_10587242 3300013308 Bacteria 1274
80 Ga0163163_10162213 3300014325 Bacteria 2281
81 Ga0163163_10551100 3300014325 Bacteria 1216
82 Ga0163163_11132435 3300014325 Bacteria 845
83 Ga0157380_12868558 3300014326 Bacteria 548
84 Ga0157379_10004036 3300014968 Bacteria 12512
85 Ga0157379_10926892 3300014968 Bacteria 827
86 Ga0157376_10101598 3300014969 Bacteria 2513
87 Ga0163161_10479033 3300017792 Bacteria 1010
88 Ga0206351_10686533 3300020077 Bacteria 502
89 Ga0224572_1006928 3300024225 Bacteria 2063
90 Ga0207692_10095593 3300025898 Bacteria 1620
91 Ga0207692_10781707 3300025898 Bacteria 623
92 Ga0207642_10152522 3300025899 Bacteria 1232
93 Ga0207680_10007189 3300025903 Bacteria 5413
94 Ga0207685_10576573 3300025905 Bacteria 601
95 Ga0207699_10140904 3300025906 Bacteria 1585
96 Ga0207645_10154961 3300025907 Bacteria 1497
97 Ga0207693_10025348 3300025915 Bacteria 4702
98 Ga0207693_10169340 3300025915 Bacteria 1720
99 Ga0207693_10508625 3300025915 Bacteria 940
100 Ga0207663_10034003 3300025916 Bacteria 3043
101 Ga0207663_10665133 3300025916 Bacteria 823
102 Ga0207663_11740059 3300025916 Bacteria 501
103 Ga0207650_10362901 3300025925 Bacteria 1194
104 Ga0207687_10072370 3300025927 Bacteria 2466
105 Ga0207700_10083683 3300025928 Bacteria 2498
106 Ga0207700_10497998 3300025928 Bacteria 1078
107 Ga0207700_11375413 3300025928 Bacteria 628
108 Ga0207664_10325022 3300025929 Bacteria 1358
109 Ga0207690_10562414 3300025932 Bacteria 928
110 Ga0207686_11131724 3300025934 Bacteria 639
111 Ga0207709_10167054 3300025935 Bacteria 1541
112 Ga0207670_10841273 3300025936 Bacteria 766
113 Ga0207704_10016527 3300025938 Bacteria 3794
114 Ga0207665_10376209 3300025939 Bacteria 1077
115 Ga0207689_10019212 3300025942 Bacteria 5760
116 Ga0207668_10231223 3300025972 Bacteria 1491
117 Ga0207668_10654412 3300025972 Bacteria 920
118 Ga0207640_10021674 3300025981 Bacteria 3833
119 Ga0207658_10001313 3300025986 Bacteria 19550
120 Ga0207658_10892460 3300025986 Bacteria 809
121 Ga0207677_12294679 3300026023 Bacteria 502
122 Ga0207703_10300852 3300026035 Bacteria 1463
123 Ga0207703_10323242 3300026035 Bacteria 1413
124 Ga0207639_10601347 3300026041 Bacteria 1014
125 Ga0207702_11412277 3300026078 Bacteria 690
126 Ga0207676_10875793 3300026095 Bacteria 879
127 Ga0207674_10381238 3300026116 Bacteria 1363
128 Ga0207675_100096710 3300026118 Bacteria 2780
129 Ga0268266_10000336 3300028379 Bacteria 73612
130 Ga0268266_10137580 3300028379 Bacteria 2189
131 Ga0268266_11943798 3300028379 Bacteria 562
132 Ga0268265_10146445 3300028380 Bacteria 1985
133 Ga0265760_10062088 3300031090 Bacteria 1137
134 Ga0307415_101073288 3300032126 Bacteria 752
135 Ga0373954_0614176 3300035118 Bacteria 539
136 Ga0373956_0012286 3300035119 Bacteria 3548
137 Ga0373955_0560499 3300035172 Bacteria 699
138 Ga0373937_0017082 3300036401 Bacteria 6453
139 Ga0373937_1874947 3300036401 Bacteria 546
140 Ga0395900_0296595 3300037418 Bacteria 1604
141 Ga0395898_0066479 3300037466 Bacteria 3492
142 Ga0395898_0088017 3300037466 Bacteria 2991
143 Ga0436364_0728298 3300037853 Bacteria 793
144 Ga0436364_0813742 3300037853 Bacteria 1242
145 Ga0436362_0533374 3300039453 Bacteria 1059
146 Ga0451798_0934545 3300041458 Bacteria 634
147 Ga0451833_1204337 3300041491 Bacteria 837
148 Ga0439449_0090555 3300042007 Bacteria 1129
149 Ga0466968_0096440 3300044735 Bacteria 1316
150 Ga0495592_0236659 3300046454 Bacteria 1213
151 Ga0495592_0246156 3300046454 Bacteria 1184
152 Ga0495592_0631253 3300046454 Bacteria 651
153 Ga0495629_0513563 3300046459 Bacteria 807
154 Ga0495641_0447692 3300046461 Bacteria 588
155 Ga0495651_0002829 3300046462 Bacteria 13443
156 Ga0495653_0036380 3300046463 Bacteria 3878
157 Ga0495664_0128299 3300046477 Bacteria 1535
158 Ga0495608_0180241 3300046511 Bacteria 1336
159 Ga0495608_0429566 3300046511 Bacteria 805
160 Ga0495628_0041932 3300046516 Bacteria 3652
161 Ga0495628_0647303 3300046516 Bacteria 751
162 Ga0495652_0083513 3300046529 Bacteria 2629
163 Ga0495652_0216906 3300046529 Bacteria 1440
164 Ga0495640_0105798 3300046533 Bacteria 1843
165 Ga0495587_0018693 3300046536 Bacteria 4297
166 Ga0495587_0605932 3300046536 Bacteria 603
167 Ga0495645_0285994 3300046543 Bacteria 1082
168 Ga0495667_0031350 3300046559 Bacteria 3568
169 Ga0495625_0000213 3300046660 Bacteria 91768
170 Ga0495635_0262192 3300046663 Bacteria 1163
171 Ga0495657_0008831 3300046675 Bacteria 7673
172 Ga0495599_0036021 3300046678 Bacteria 3106
173 Ga0495623_0075963 3300046679 Bacteria 2085
174 Ga0495646_0019804 3300046680 Bacteria 4256
175 Ga0495646_0546256 3300046680 Bacteria 592
176 Ga0495613_1063764 3300046689 Bacteria 518
177 Ga0495600_0008063 3300046809 Bacteria 6458
178 Ga0495581_0551006 3300047315 Bacteria 669
179 Ga0495581_0661503 3300047315 Bacteria 603
180 Ga0495604_0074450 3300047317 Bacteria 2559
181 Ga0495604_0193660 3300047317 Bacteria 1415
182 Ga0495674_0170689 3300047319 Bacteria 1815
183 Ga0495674_0302864 3300047319 Bacteria 1305
184 Ga0495680_0019096 3300047322 Bacteria 5800
185 Ga0495680_0408241 3300047322 Bacteria 936
186 Ga0495675_0155714 3300047444 Bacteria 1410
187 Ga0495684_0126602 3300047471 Bacteria 1921
188 Ga0495593_0166809 3300047673 Bacteria 1111
189 Ga0495602_0027158 3300048088 Bacteria 5509
190 Ga0495614_0444583 3300048089 Bacteria 613
191 Ga0495614_0651880 3300048089 Bacteria 508
192 Ga0496100_0294592 3300048903 Bacteria 1213
193 Ga0496100_0377909 3300048903 Bacteria 1075
194 Ga0496100_1665997 3300048903 Bacteria 504
195 Ga0496102_0035722 3300048905 Bacteria 4475
196 Ga0496102_0093115 3300048905 Bacteria 2792
197 Ga0496102_0156949 3300048905 Bacteria 2139
198 Ga0496102_1120408 3300048905 Bacteria 707
199 Ga0496103_0010668 3300048906 Bacteria 5436
200 Ga0496103_0043709 3300048906 Bacteria 2759
201 Ga0496103_0249954 3300048906 Bacteria 1141
202 Ga0496104_0055810 3300048907 Bacteria 3735
203 Ga0496104_0057868 3300048907 Bacteria 3669
204 Ga0496104_0148960 3300048907 Bacteria 2247
205 Ga0496104_0216642 3300048907 Bacteria 1826
206 Ga0496104_1024714 3300048907 Bacteria 729
207 Ga0496105_0115868 3300048908 Bacteria 2210
208 Ga0496105_0157631 3300048908 Bacteria 1864
209 Ga0496105_0310296 3300048908 Bacteria 1266
210 Ga0496105_0914510 3300048908 Bacteria 660
211 Ga0496107_0077949 3300048910 Bacteria 2414
212 Ga0496107_0275819 3300048910 Bacteria 1251
213 Ga0496108_0032823 3300048911 Bacteria 4311
214 Ga0496109_0283813 3300048912 Bacteria 1560
215 Ga0496109_0337495 3300048912 Bacteria 1423
216 Ga0496109_0760090 3300048912 Bacteria 907
217 Ga0496110_0141524 3300048913 Bacteria 2175
218 Ga0496110_0173180 3300048913 Bacteria 1958
219 Ga0496110_1776655 3300048913 Bacteria 527
220 Ga0496111_0113448 3300048914 Bacteria 1997
221 Ga0496112_0037871 3300048915 Bacteria 4709
222 Ga0496112_0316619 3300048915 Bacteria 1505
223 Ga0496113_0056168 3300048916 Bacteria 2954
224 Ga0496113_0059195 3300048916 Bacteria 2885
225 Ga0496114_0095712 3300048917 Bacteria 2527
226 Ga0496115_0061785 3300048918 Bacteria 3021
227 Ga0496115_0285371 3300048918 Bacteria 1355
228 Ga0496115_1332366 3300048918 Bacteria 533
229 Ga0496116_0302781 3300048919 Bacteria 760
230 Ga0496117_0018714 3300048920 Bacteria 5721
231 Ga0496118_0082944 3300048921 Bacteria 2243
232 Ga0496118_0100018 3300048921 Bacteria 1963
233 Ga0496118_0145738 3300048921 Bacteria 1491
234 Ga0496118_0560426 3300048921 Bacteria 555
235 Ga0496119_0000432 3300048922 Bacteria 57656
236 Ga0496119_0058351 3300048922 Bacteria 2326
237 Ga0496119_0079858 3300048922 Bacteria 1888
238 Ga0496119_0080593 3300048922 Bacteria 1877
239 Ga0496120_0380368 3300048923 Bacteria 628
240 Ga0496121_0003802 3300048924 Bacteria 21043
241 Ga0496121_0015223 3300048924 Bacteria 8083
242 Ga0496121_0017127 3300048924 Bacteria 7424
243 Ga0496124_0577251 3300048927 Bacteria 736
244 Ga0496125_0012026 3300048928 Bacteria 8616
245 Ga0496125_0081631 3300048928 Bacteria 2469
246 Ga0496126_0150393 3300048929 Bacteria 1996
247 Ga0496126_0189873 3300048929 Bacteria 1741
248 Ga0501031_0000057 3300049568 Bacteria 60418
249 Ga0501031_0001533 3300049568 Bacteria 14365
250 Ga0501031_0049429 3300049568 Bacteria 2741
251 Ga0501032_0002504 3300049569 Bacteria 14348
252 Ga0501032_0004756 3300049569 Bacteria 10179
253 Ga0501032_0056609 3300049569 Bacteria 2635
254 Ga0501032_0661253 3300049569 Bacteria 663
255 Ga0501033_0001110 3300049570 Bacteria 24422
256 Ga0501033_0005233 3300049570 Bacteria 10299
257 Ga0501033_0272701 3300049570 Bacteria 1195
258 Ga0501033_0532666 3300049570 Bacteria 810
259 Ga0501034_0003417 3300049571 Bacteria 18129
260 Ga0501034_0020384 3300049571 Bacteria 6768
261 Ga0501034_0023411 3300049571 Bacteria 6293
262 Ga0501034_0101062 3300049571 Bacteria 2877
263 Ga0501034_0246041 3300049571 Bacteria 1733
264 Ga0501036_0001873 3300049572 Bacteria 16312
265 Ga0501036_0005530 3300049572 Bacteria 10251
266 Ga0501036_0090263 3300049572 Bacteria 2588
267 Ga0501037_0000170 3300049573 Bacteria 61439
268 Ga0501037_0000608 3300049573 Bacteria 27799
269 Ga0501037_0024526 3300049573 Bacteria 4460
270 Ga0501038_0000243 3300049574 Bacteria 46069
271 Ga0501038_0004163 3300049574 Bacteria 13454
272 Ga0501038_0010396 3300049574 Bacteria 8507
273 Ga0501039_0021635 3300049575 Bacteria 4934
274 Ga0501039_0042225 3300049575 Bacteria 3523
275 Ga0501039_0073260 3300049575 Bacteria 2661
276 Ga0501040_0056427 3300049576 Bacteria 2695
277 Ga0501042_0015220 3300049578 Bacteria 5264
278 Ga0501042_0020567 3300049578 Bacteria 4595
279 Ga0501043_0000275 3300049579 Bacteria 46467
280 Ga0501043_0001653 3300049579 Bacteria 19370
281 Ga0501043_0007448 3300049579 Bacteria 8691
282 Ga0501046_0000329 3300049580 Bacteria 47714
283 Ga0501046_0001973 3300049580 Bacteria 19493
284 Ga0501046_0033192 3300049580 Bacteria 4173
285 Ga0501047_0000270 3300049581 Bacteria 60001
286 Ga0501047_0000634 3300049581 Bacteria 36926
287 Ga0501047_0028332 3300049581 Bacteria 5399
288 Ga0501047_0106113 3300049581 Bacteria 2689
289 Ga0501047_0294120 3300049581 Bacteria 1467
290 Ga0501048_0000110 3300049582 Bacteria 46328
291 Ga0501048_0002210 3300049582 Bacteria 14810
292 Ga0501048_0010700 3300049582 Bacteria 6842
293 Ga0501048_0904972 3300049582 Bacteria 634
294 Ga0501067_0049570 3300049583 Bacteria 2327
295 Ga0501067_0205649 3300049583 Bacteria 1096
296 Ga0501067_0326482 3300049583 Bacteria 854
297 Ga0501068_0011787 3300049584 Bacteria 4942
298 Ga0501068_0061769 3300049584 Bacteria 2277
299 Ga0501069_0013186 3300049585 Bacteria 4404
300 Ga0501069_0027930 3300049585 Bacteria 3093
301 Ga0501069_0040242 3300049585 Bacteria 2583
302 Ga0501070_0000577 3300049586 Bacteria 33431
303 Ga0501070_0006079 3300049586 Bacteria 10285
304 Ga0501070_0070621 3300049586 Bacteria 2891
305 Ga0501070_0459382 3300049586 Bacteria 1026
306 Ga0501070_0671464 3300049586 Bacteria 821
307 Ga0501071_0034074 3300049587 Bacteria 3622
308 Ga0501071_0045467 3300049587 Bacteria 3152
309 Ga0501072_0113520 3300049588 Bacteria 2157
310 Ga0501073_0005035 3300049589 Bacteria 9908
311 Ga0501073_0008160 3300049589 Bacteria 7767
312 Ga0501073_0039143 3300049589 Bacteria 3360
313 Ga0501073_0907655 3300049589 Bacteria 607
314 Ga0501074_0001888 3300049590 Bacteria 14391
315 Ga0501074_0030941 3300049590 Bacteria 3878
316 Ga0501074_0048478 3300049590 Bacteria 3068
317 Ga0501076_0022960 3300049592 Bacteria 4801
318 Ga0501079_0001500 3300049741 Bacteria 16533
319 Ga0501079_0060018 3300049741 Bacteria 2933
320 Ga0501080_0022988 3300049742 Bacteria 5782
321 Ga0501080_0026319 3300049742 Bacteria 5405
322 Ga0501080_0061107 3300049742 Bacteria 3508
323 Ga0501081_0795544 3300049743 Bacteria 712
324 Ga0501083_0001972 3300049744 Bacteria 14110
325 Ga0501083_0004639 3300049744 Bacteria 9704
326 Ga0501083_0024976 3300049744 Bacteria 4138
327 Ga0501083_0212311 3300049744 Bacteria 1261
328 Ga0501035_0000206 3300049822 Bacteria 71942
329 Ga0501035_0000642 3300049822 Bacteria 38504
330 Ga0501035_0867090 3300049822 Bacteria 717
331 Ga0501044_0000527 3300049823 Bacteria 46627
332 Ga0501044_0008632 3300049823 Bacteria 11156
333 Ga0501044_0047632 3300049823 Bacteria 4433
334 Ga0501044_0218523 3300049823 Bacteria 1857
335 Ga0501044_1439528 3300049823 Bacteria 554
336 Ga0501045_0043078 3300049824 Bacteria 3286
337 Ga0501045_0124894 3300049824 Bacteria 1911
338 Ga0501045_0362154 3300049824 Bacteria 1079
339 nmdc:mga03n38_121688_c1 3300050490 Bacteria 1283
340 nmdc:mga0yw44_101708_c1 3300050492 Bacteria 1831
341 nmdc:mga0yw44_67044_c1 3300050492 Bacteria 2217
342 nmdc:mga0a205_1142970_c1 3300050515 Bacteria 626
343 Ga0495601_0109640 3300053077 Bacteria 1787
344 Ga0495612_0344164 3300053078 Bacteria 673
345 Ga0495655_0097817 3300053083 Bacteria 865
346 Ga0495595_0136131 3300053084 Bacteria 1203
347 Ga0495619_0049434 3300053085 Bacteria 2773
348 Ga0500650_0284321 3300053098 Bacteria 735
349 Ga0500595_045345 3300053119 Bacteria 1389
350 Ga0500658_0073208 3300053134 Bacteria 1450
351 Ga0501084_0047679 3300054114 Bacteria 3588
352 Ga0501084_0275595 3300054114 Bacteria 1420
353 Ga0501084_0931334 3300054114 Bacteria 731
354 Ga0501082_0005793 3300060353 Bacteria 10725
355 Ga0501082_0009318 3300060353 Bacteria 8462
356 Ga0501082_0011436 3300060353 Bacteria 7637
357 Ga0157379_12196914
358 Ga0070670_100287707
359 Ga0070666_10003880
360 Ga0070680_100288448
361 Ga0070689_100138440
362 Ga0070692_10054540
363 Ga0070668_100908211
364 Ga0070668_101594825
365 Ga0070669_101521211
366 Ga0070675_100670873
367 Ga0070659_100030960
368 Ga0070659_100612086
369 Ga0070659_101465007
370 Ga0070667_100004761
371 Ga0070667_100500695
372 Ga0070709_10433011
373 Ga0070709_11132077
374 Ga0070714_100018701
375 Ga0070714_100133743
376 Ga0070714_101575870
377 Ga0070713_100098013
378 Ga0070713_100133854
379 Ga0070710_10027942
380 Ga0070710_10989831
381 Ga0070711_100207128
382 Ga0070681_10742613
383 Ga0068853_100384805
384 Ga0070696_100317745
385 Ga0070665_100003634
386 Ga0068854_101379246
387 Ga0068856_100873661
388 Ga0070702_100094358
389 Ga0068852_100413169
390 Ga0068859_100632247
391 Ga0068864_100441170
392 Ga0068864_102211875
393 Ga0068861_102259445
394 Ga0068851_10537978
395 Ga0068870_10084333
396 Ga0068860_100752989
397 Ga0068862_102675807
398 Ga0081455_10002091
399 Ga0081455_10029108
400 Ga0081455_10795151
401 Ga0081539_10001862
402 Ga0081539_10006571
403 Ga0081539_10214090
404 Ga0070717_10419097
405 Ga0070717_10441910
406 Ga0070717_11061718
407 Ga0075365_10935673
408 Ga0075364_10135715
409 Ga0070715_10465032
410 Ga0070716_100274109
411 Ga0070716_101179562
412 Ga0070712_100040342
413 Ga0070712_100157927
414 Ga0070712_100202074
415 Ga0075428_100157782
416 Ga0068865_100637113
417 Ga0097620_100632302
418 Ga0105245_10052659
419 Ga0105245_10172929
420 Ga0105245_10766000
421 Ga0105247_10820159
422 Ga0105243_10804076
423 Ga0105243_11211708
424 Ga0105242_11289635
425 Ga0105242_13057120
426 Ga0105248_10336982
427 Ga0105248_12454730
428 Ga0105238_11942466
429 Ga0105249_10156276
430 Ga0105239_10050847
431 Ga0105246_10184097
432 Ga0157371_10457373
433 Ga0157369_10581091
434 Ga0163162_13133474
435 Ga0157375_10587242
436 Ga0163163_10162213
437 Ga0163163_10551100
438 Ga0163163_11132435
439 Ga0157380_12868558
440 Ga0157379_10004036
441 Ga0157379_10926892
442 Ga0157376_10101598
443 Ga0163161_10479033
444 Ga0206351_10686533
445 Ga0224572_1006928
446 Ga0207692_10095593
447 Ga0207692_10781707
448 Ga0207642_10152522
449 Ga0207680_10007189
450 Ga0207685_10576573
451 Ga0207699_10140904
452 Ga0207645_10154961
453 Ga0207693_10025348
454 Ga0207693_10169340
455 Ga0207693_10508625
456 Ga0207663_10034003
457 Ga0207663_10665133
458 Ga0207663_11740059
459 Ga0207650_10362901
460 Ga0207687_10072370
461 Ga0207700_10083683
462 Ga0207700_10497998
463 Ga0207700_11375413
464 Ga0207664_10325022
465 Ga0207690_10562414
466 Ga0207686_11131724
467 Ga0207709_10167054
468 Ga0207670_10841273
469 Ga0207704_10016527
470 Ga0207665_10376209
471 Ga0207689_10019212
472 Ga0207668_10231223
473 Ga0207668_10654412
474 Ga0207640_10021674
475 Ga0207658_10001313
476 Ga0207658_10892460
477 Ga0207677_12294679
478 Ga0207703_10300852
479 Ga0207703_10323242
480 Ga0207639_10601347
481 Ga0207702_11412277
482 Ga0207676_10875793
483 Ga0207674_10381238
484 Ga0207675_100096710
485 Ga0268266_10000336
486 Ga0268266_10137580
487 Ga0268266_11943798
488 Ga0268265_10146445
489 Ga0265760_10062088
490 Ga0307415_101073288
491 Ga0373954_0614176
492 Ga0373956_0012286
493 Ga0373955_0560499
494 Ga0373937_0017082
495 Ga0373937_1874947
496 Ga0395900_0296595
497 Ga0395898_0066479
498 Ga0395898_0088017
499 Ga0436364_0728298
500 Ga0436364_0813742
501 Ga0436362_0533374
502 Ga0451798_0934545
503 Ga0451833_1204337
504 Ga0439449_0090555
505 Ga0466968_0096440
506 Ga0495592_0236659
507 Ga0495592_0246156
508 Ga0495592_0631253
509 Ga0495629_0513563
510 Ga0495641_0447692
511 Ga0495651_0002829
512 Ga0495653_0036380
513 Ga0495664_0128299
514 Ga0495608_0180241
515 Ga0495608_0429566
516 Ga0495628_0041932
517 Ga0495628_0647303
518 Ga0495652_0083513
519 Ga0495652_0216906
520 Ga0495640_0105798
521 Ga0495587_0018693
522 Ga0495587_0605932
523 Ga0495645_0285994
524 Ga0495667_0031350
525 Ga0495625_0000213
526 Ga0495635_0262192
527 Ga0495657_0008831
528 Ga0495599_0036021
529 Ga0495623_0075963
530 Ga0495646_0019804
531 Ga0495646_0546256
532 Ga0495613_1063764
533 Ga0495600_0008063
534 Ga0495581_0551006
535 Ga0495581_0661503
536 Ga0495604_0074450
537 Ga0495604_0193660
538 Ga0495674_0170689
539 Ga0495674_0302864
540 Ga0495680_0019096
541 Ga0495680_0408241
542 Ga0495675_0155714
543 Ga0495684_0126602
544 Ga0495593_0166809
545 Ga0495602_0027158
546 Ga0495614_0444583
547 Ga0495614_0651880
548 Ga0496100_0294592
549 Ga0496100_0377909
550 Ga0496100_1665997
551 Ga0496102_0035722
552 Ga0496102_0093115
553 Ga0496102_0156949
554 Ga0496102_1120408
555 Ga0496103_0010668
556 Ga0496103_0043709
557 Ga0496103_0249954
558 Ga0496104_0055810
559 Ga0496104_0057868
560 Ga0496104_0148960
561 Ga0496104_0216642
562 Ga0496104_1024714
563 Ga0496105_0115868
564 Ga0496105_0157631
565 Ga0496105_0310296
566 Ga0496105_0914510
567 Ga0496107_0077949
568 Ga0496107_0275819
569 Ga0496108_0032823
570 Ga0496109_0283813
571 Ga0496109_0337495
572 Ga0496109_0760090
573 Ga0496110_0141524
574 Ga0496110_0173180
575 Ga0496110_1776655
576 Ga0496111_0113448
577 Ga0496112_0037871
578 Ga0496112_0316619
579 Ga0496113_0056168
580 Ga0496113_0059195
581 Ga0496114_0095712
582 Ga0496115_0061785
583 Ga0496115_0285371
584 Ga0496115_1332366
585 Ga0496116_0302781
586 Ga0496117_0018714
587 Ga0496118_0082944
588 Ga0496118_0100018
589 Ga0496118_0145738
590 Ga0496118_0560426
591 Ga0496119_0000432
592 Ga0496119_0058351
593 Ga0496119_0079858
594 Ga0496119_0080593
595 Ga0496120_0380368
596 Ga0496121_0003802
597 Ga0496121_0015223
598 Ga0496121_0017127
599 Ga0496124_0577251
600 Ga0496125_0012026
601 Ga0496125_0081631
602 Ga0496126_0150393
603 Ga0496126_0189873
604 Ga0501031_0000057
605 Ga0501031_0001533
606 Ga0501031_0049429
607 Ga0501032_0002504
608 Ga0501032_0004756
609 Ga0501032_0056609
610 Ga0501032_0661253
611 Ga0501033_0001110
612 Ga0501033_0005233
613 Ga0501033_0272701
614 Ga0501033_0532666
615 Ga0501034_0003417
616 Ga0501034_0020384
617 Ga0501034_0023411
618 Ga0501034_0101062
619 Ga0501034_0246041
620 Ga0501036_0001873
621 Ga0501036_0005530
622 Ga0501036_0090263
623 Ga0501037_0000170
624 Ga0501037_0000608
625 Ga0501037_0024526
626 Ga0501038_0000243
627 Ga0501038_0004163
628 Ga0501038_0010396
629 Ga0501039_0021635
630 Ga0501039_0042225
631 Ga0501039_0073260
632 Ga0501040_0056427
633 Ga0501042_0015220
634 Ga0501042_0020567
635 Ga0501043_0000275
636 Ga0501043_0001653
637 Ga0501043_0007448
638 Ga0501046_0000329
639 Ga0501046_0001973
640 Ga0501046_0033192
641 Ga0501047_0000270
642 Ga0501047_0000634
643 Ga0501047_0028332
644 Ga0501047_0106113
645 Ga0501047_0294120
646 Ga0501048_0000110
647 Ga0501048_0002210
648 Ga0501048_0010700
649 Ga0501048_0904972
650 Ga0501067_0049570
651 Ga0501067_0205649
652 Ga0501067_0326482
653 Ga0501068_0011787
654 Ga0501068_0061769
655 Ga0501069_0013186
656 Ga0501069_0027930
657 Ga0501069_0040242
658 Ga0501070_0000577
659 Ga0501070_0006079
660 Ga0501070_0070621
661 Ga0501070_0459382
662 Ga0501070_0671464
663 Ga0501071_0034074
664 Ga0501071_0045467
665 Ga0501072_0113520
666 Ga0501073_0005035
667 Ga0501073_0008160
668 Ga0501073_0039143
669 Ga0501073_0907655
670 Ga0501074_0001888
671 Ga0501074_0030941
672 Ga0501074_0048478
673 Ga0501076_0022960
674 Ga0501079_0001500
675 Ga0501079_0060018
676 Ga0501080_0022988
677 Ga0501080_0026319
678 Ga0501080_0061107
679 Ga0501081_0795544
680 Ga0501083_0001972
681 Ga0501083_0004639
682 Ga0501083_0024976
683 Ga0501083_0212311
684 Ga0501035_0000206
685 Ga0501035_0000642
686 Ga0501035_0867090
687 Ga0501044_0000527
688 Ga0501044_0008632
689 Ga0501044_0047632
690 Ga0501044_0218523
691 Ga0501044_1439528
692 Ga0501045_0043078
693 Ga0501045_0124894
694 Ga0501045_0362154
695 nmdc:mga03n38_121688_c1
696 nmdc:mga0yw44_101708_c1
697 nmdc:mga0yw44_67044_c1
698 nmdc:mga0a205_1142970_c1
699 Ga0495601_0109640
700 Ga0495612_0344164
701 Ga0495655_0097817
702 Ga0495595_0136131
703 Ga0495619_0049434
704 Ga0500650_0284321
705 Ga0500595_045345
706 Ga0500658_0073208
707 Ga0501084_0047679
708 Ga0501084_0275595
709 Ga0501084_0931334
710 Ga0501082_0005793
711 Ga0501082_0009318
712 Ga0501082_0011436

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5sxy-assembly1.cif.gz_A the solution nmr structure for the pqqd truncation of methylobacterium extorquens pqqcd representing a functional and stand-alone ribosomally synthesized and post-translational modified (ripp) recognition element (rre) 0.7435 16 101
6jx3-assembly1.cif.gz_B lasso peptide synthetase b1 complexed with the leader peptide 0.7368 22 100
2ysc-assembly1.cif.gz_A solution structure of the ww domain from the human amyloid beta a4 precursor protein-binding family b member 3, apbb3 0.7142 25 52
6jx3-assembly1.cif.gz_B lasso peptide synthetase b1 complexed with the leader peptide 0.6898 22 100
5sxy-assembly1.cif.gz_A the solution nmr structure for the pqqd truncation of methylobacterium extorquens pqqcd representing a functional and stand-alone ribosomally synthesized and post-translational modified (ripp) recognition element (rre) 0.6856 16 101
ID Description Score Start End Superfamily
af_P95038_1_109_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8172 1 105 1.10.10.10
af_P95038_1_109_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8096 1 105 1.10.10.10
af_A0A0P0X9W6_3_135_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7977 28 53 2.120.10.80
af_Q8H8M2_120_401_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7939 28 53 2.120.10.80
af_F1LN76_36_212_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7901 27 52 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A418KJF2-F1-model_v4 Mycofactocin biosynthesis chaperone MftB 0.9914 18 102
AF-A0A6J6BYW0-F1-model_v4 Unannotated protein 0.9876 19 101
AF-A0A7Z0DHQ9-F1-model_v4 Putative mycofactocin binding protein MftB 0.9866 18 101
AF-A4FCB3-F1-model_v4 Mycofactocin binding protein MftB 0.9858 30 98
AF-A0A0J0UVA8-F1-model_v4 Putative mycofactocin binding protein MftB 0.9849 17 101

Map