F420502

General Info

Members Datasets Scaffolds Average Seq Length
356 190 712 395

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10069542|Ga0163163_100695423
Length 413
Sequence MNTPINYPITQLPDSPMPPFSAALEGIRVLDVTQVMAGPFCAMMLADLGAAVIKVEPPAGDSTRQMPGAAGTDSPSFNTVNRSKRSIVLNLKTVKGREVFARLARSSDIVVENYRPGVMTSLGLDYAALSAANPRLIYASISGYGQTGPQRAKGGFDLIAQGIAGIMSITGESGGPPVKAGIPITDLGAGLFALVGILAALEHRHRTGVGQQIDTSLVDAGVALSVWEATEYFSGAGVPAALGSAHRMNAPYQAIRCADGYITLGAANERLFRRLSDVLGHREWADDEAFADNASRVRNRQALAERIEAITVTKPRAHWLSLLDASDIPCGPINDYAQVFADPQVLARDMVIETEHPTLGHFRTLGSPIKMSATPPNVARRAPQLGEHTAEILTEAGFSEEQIAALRGARAID

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
123 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
124 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
125 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
126 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
129 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
140 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
141 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.4
Nodule 0
Rhizoplane 3.65
Rhizosphere 94.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10069542 3300014325 Bacteria 3505
2 Ga0065712_10104949 3300005290 Bacteria 1950
3 Ga0070690_100012172 3300005330 Bacteria 5057
4 Ga0070670_100112366 3300005331 Bacteria 2348
5 Ga0070677_10032592 3300005333 Bacteria 2000
6 Ga0068869_100062190 3300005334 Bacteria 2740
7 Ga0070666_10001469 3300005335 Bacteria 14310
8 Ga0068868_100082925 3300005338 Bacteria 2573
9 Ga0070660_100036721 3300005339 Bacteria 3712
10 Ga0070660_100153874 3300005339 Bacteria 1850
11 Ga0070660_100184058 3300005339 Bacteria 1691
12 Ga0070691_10022182 3300005341 Bacteria 2944
13 Ga0070691_10074599 3300005341 Bacteria 1651
14 Ga0070687_100079329 3300005343 Bacteria 1787
15 Ga0070668_100053437 3300005347 Bacteria 3115
16 Ga0070669_100008959 3300005353 Bacteria 7142
17 Ga0070669_100051072 3300005353 Bacteria 3021
18 Ga0070669_100104678 3300005353 Bacteria 2139
19 Ga0070675_100013743 3300005354 Bacteria 6372
20 Ga0070675_100076274 3300005354 Bacteria 2788
21 Ga0070674_100003793 3300005356 Bacteria 8537
22 Ga0070659_100052416 3300005366 Bacteria 3209
23 Ga0070667_100001323 3300005367 Bacteria 22254
24 Ga0070709_10093798 3300005434 Bacteria 1985
25 Ga0070714_100033234 3300005435 Bacteria 4312
26 Ga0070714_100103510 3300005435 Bacteria 2511
27 Ga0070701_10006758 3300005438 Bacteria 4848
28 Ga0070711_100233463 3300005439 Bacteria 1435
29 Ga0070700_100095879 3300005441 Bacteria 1945
30 Ga0070700_100224890 3300005441 Bacteria 1332
31 Ga0070694_100013394 3300005444 Bacteria 5122
32 Ga0070694_100041226 3300005444 Bacteria 3079
33 Ga0070708_100018809 3300005445 Bacteria 5785
34 Ga0070708_100020833 3300005445 Bacteria 5535
35 Ga0070708_100023052 3300005445 Bacteria 5288
36 Ga0070678_100057016 3300005456 Bacteria 2860
37 Ga0070678_100161730 3300005456 Bacteria 1815
38 Ga0070681_10084493 3300005458 Bacteria 3126
39 Ga0068867_100191160 3300005459 Bacteria 1633
40 Ga0070685_10097256 3300005466 Bacteria 1792
41 Ga0070707_100075806 3300005468 Bacteria 3244
42 Ga0070699_100064698 3300005518 Bacteria 3172
43 Ga0070699_100116438 3300005518 Bacteria 2349
44 Ga0070699_100148357 3300005518 Bacteria 2073
45 Ga0070679_100005173 3300005530 Bacteria 12075
46 Ga0070679_100031695 3300005530 Bacteria 5225
47 Ga0070697_100162011 3300005536 Bacteria 1890
48 Ga0070697_100260067 3300005536 Bacteria 1486
49 Ga0070672_100017028 3300005543 Bacteria 5220
50 Ga0070686_100001886 3300005544 Bacteria 11676
51 Ga0070695_100005321 3300005545 Bacteria 7579
52 Ga0070695_100038723 3300005545 Bacteria 3011
53 Ga0070696_100012922 3300005546 Bacteria 5607
54 Ga0070665_100002515 3300005548 Bacteria 20150
55 Ga0070665_100027088 3300005548 Bacteria 5772
56 Ga0070704_100010104 3300005549 Bacteria 5739
57 Ga0070704_100014130 3300005549 Bacteria 4978
58 Ga0070704_100128962 3300005549 Bacteria 1957
59 Ga0068855_100400678 3300005563 Bacteria 1504
60 Ga0068855_100421410 3300005563 Bacteria 1460
61 Ga0068854_100001201 3300005578 Bacteria 15533
62 Ga0068854_100008170 3300005578 Bacteria 6711
63 Ga0068859_100034216 3300005617 Bacteria 5101
64 Ga0068864_100001667 3300005618 Bacteria 18294
65 Ga0068866_10041993 3300005718 Bacteria 2273
66 Ga0068866_10046346 3300005718 Bacteria 2186
67 Ga0068861_100004585 3300005719 Bacteria 9272
68 Ga0068861_100019550 3300005719 Bacteria 4838
69 Ga0068861_100070454 3300005719 Bacteria 2707
70 Ga0068861_100130460 3300005719 Bacteria 2039
71 Ga0068870_10161577 3300005840 Bacteria 1329
72 Ga0068863_100001577 3300005841 Bacteria 22546
73 Ga0068858_100036957 3300005842 Bacteria 4528
74 Ga0068860_100093704 3300005843 Bacteria 2862
75 Ga0068862_100006768 3300005844 Bacteria 9502
76 Ga0068862_100116175 3300005844 Bacteria 2354
77 Ga0068862_100226963 3300005844 Bacteria 1693
78 Ga0081455_10024510 3300005937 Bacteria 5585
79 Ga0081538_10002503 3300005981 Bacteria 17887
80 Ga0081538_10010270 3300005981 Bacteria 7690
81 Ga0081538_10024747 3300005981 Bacteria 4266
82 Ga0075364_10021686 3300006051 Bacteria 4049
83 Ga0075362_10001768 3300006177 Bacteria 7035
84 Ga0075367_10069056 3300006178 Bacteria 2121
85 Ga0068871_100007708 3300006358 Bacteria 7704
86 Ga0068871_100121763 3300006358 Bacteria 2204
87 Ga0075428_100009577 3300006844 Bacteria 10758
88 Ga0075428_100099714 3300006844 Bacteria 3167
89 Ga0075430_100004330 3300006846 Bacteria 11991
90 Ga0075431_100358811 3300006847 Bacteria 1464
91 Ga0075433_10158656 3300006852 Bacteria 2013
92 Ga0075434_100000448 3300006871 Bacteria 30710
93 Ga0075434_100045480 3300006871 Bacteria 4355
94 Ga0075434_100130137 3300006871 Bacteria 2535
95 Ga0075434_100173085 3300006871 Bacteria 2179
96 Ga0075429_100004908 3300006880 Bacteria 11522
97 Ga0075429_100015707 3300006880 Bacteria 6559
98 Ga0068865_100052802 3300006881 Bacteria 2818
99 Ga0068865_100169217 3300006881 Bacteria 1673
100 Ga0075436_100000366 3300006914 Bacteria 28897
101 Ga0075436_100009707 3300006914 Bacteria 6584
102 Ga0075436_100010418 3300006914 Bacteria 6373
103 Ga0075436_100040351 3300006914 Bacteria 3221
104 Ga0075436_100054221 3300006914 Bacteria 2767
105 Ga0075436_100103078 3300006914 Bacteria 1988
106 Ga0097620_100034216 3300006931 Bacteria 5101
107 Ga0075435_100000119 3300007076 Bacteria 44181
108 Ga0075435_100003845 3300007076 Bacteria 10239
109 Ga0075435_100022193 3300007076 Bacteria 4894
110 Ga0075435_100094072 3300007076 Bacteria 2477
111 Ga0075435_100098952 3300007076 Bacteria 2415
112 Ga0075435_100154022 3300007076 Bacteria 1934
113 Ga0075435_100249323 3300007076 Bacteria 1511
114 Ga0099794_10037806 3300007265 Bacteria 2286
115 Ga0099794_10071820 3300007265 Bacteria 1696
116 Ga0105240_10130772 3300009093 Bacteria 3011
117 Ga0111539_10009192 3300009094 Bacteria 12491
118 Ga0111539_10009283 3300009094 Bacteria 12421
119 Ga0111539_10012369 3300009094 Bacteria 10699
120 Ga0111539_10028961 3300009094 Bacteria 6754
121 Ga0111539_10113573 3300009094 Bacteria 3177
122 Ga0105245_10015703 3300009098 Bacteria 6602
123 Ga0105245_10065509 3300009098 Bacteria 3286
124 Ga0114129_10003700 3300009147 Bacteria 21537
125 Ga0114129_10006040 3300009147 Bacteria 17170
126 Ga0114129_10008880 3300009147 Bacteria 14333
127 Ga0114129_10011546 3300009147 Bacteria 12578
128 Ga0114129_10011616 3300009147 Bacteria 12538
129 Ga0114129_10012284 3300009147 Bacteria 12184
130 Ga0114129_10025366 3300009147 Bacteria 8400
131 Ga0114129_10027060 3300009147 Bacteria 8120
132 Ga0114129_10049871 3300009147 Bacteria 5880
133 Ga0114129_10070805 3300009147 Bacteria 4863
134 Ga0114129_10078199 3300009147 Bacteria 4602
135 Ga0114129_10230724 3300009147 Bacteria 2493
136 Ga0114129_10386158 3300009147 Bacteria 1848
137 Ga0105243_10031721 3300009148 Bacteria 4076
138 Ga0105243_10086814 3300009148 Bacteria 2567
139 Ga0105242_10002869 3300009176 Bacteria 13500
140 Ga0105242_10009699 3300009176 Bacteria 7379
141 Ga0105242_10145494 3300009176 Bacteria 2061
142 Ga0105248_10004581 3300009177 Bacteria 15309
143 Ga0105248_10010436 3300009177 Bacteria 10231
144 Ga0105248_10016485 3300009177 Bacteria 8133
145 Ga0105248_10028518 3300009177 Bacteria 6220
146 Ga0105248_10465119 3300009177 Bacteria 1426
147 Ga0105248_10509468 3300009177 Bacteria 1357
148 Ga0105249_10044585 3300009553 Bacteria 4032
149 Ga0105239_10017176 3300010375 Bacteria 7998
150 Ga0105239_10044897 3300010375 Bacteria 4844
151 Ga0157375_10312572 3300013308 Bacteria 1736
152 Ga0163163_10001687 3300014325 Bacteria 18652
153 Ga0163163_10029341 3300014325 Bacteria 5290
154 Ga0163163_10034604 3300014325 Bacteria 4895
155 Ga0163163_10278333 3300014325 Bacteria 1725
156 Ga0157380_10016581 3300014326 Bacteria 5436
157 Ga0157380_10099191 3300014326 Bacteria 2422
158 Ga0157379_10026515 3300014968 Bacteria 5159
159 Ga0157379_10028601 3300014968 Bacteria 4957
160 Ga0157376_10001464 3300014969 Bacteria 15555
161 Ga0157376_10095574 3300014969 Bacteria 2584
162 Ga0207680_10019650 3300025903 Bacteria 3617
163 Ga0207645_10013091 3300025907 Bacteria 5603
164 Ga0207707_10076919 3300025912 Bacteria 2912
165 Ga0207707_10211643 3300025912 Bacteria 1688
166 Ga0207695_10093565 3300025913 Bacteria 3015
167 Ga0207657_10048480 3300025919 Bacteria 3709
168 Ga0207646_10061362 3300025922 Bacteria 3356
169 Ga0207681_10009346 3300025923 Bacteria 5990
170 Ga0207681_10217753 3300025923 Bacteria 1475
171 Ga0207659_10008728 3300025926 Bacteria 6309
172 Ga0207659_10028540 3300025926 Bacteria 3793
173 Ga0207687_10046328 3300025927 Bacteria 3010
174 Ga0207687_10149104 3300025927 Bacteria 1783
175 Ga0207700_10093634 3300025928 Bacteria 2378
176 Ga0207644_10027955 3300025931 Bacteria 3899
177 Ga0207644_10057211 3300025931 Bacteria 2815
178 Ga0207706_10122697 3300025933 Bacteria 2285
179 Ga0207686_10015236 3300025934 Bacteria 4295
180 Ga0207686_10019606 3300025934 Bacteria 3850
181 Ga0207709_10053881 3300025935 Bacteria 2477
182 Ga0207709_10054544 3300025935 Bacteria 2465
183 Ga0207670_10146504 3300025936 Bacteria 1747
184 Ga0207669_10140189 3300025937 Bacteria 1677
185 Ga0207704_10012608 3300025938 Bacteria 4199
186 Ga0207704_10017412 3300025938 Bacteria 3725
187 Ga0207691_10057082 3300025940 Bacteria 3555
188 Ga0207691_10144056 3300025940 Bacteria 2098
189 Ga0207711_10006205 3300025941 Bacteria 10093
190 Ga0207711_10045121 3300025941 Bacteria 3766
191 Ga0207711_10092620 3300025941 Bacteria 2660
192 Ga0207711_10094002 3300025941 Bacteria 2641
193 Ga0207711_10152334 3300025941 Bacteria 2087
194 Ga0207689_10053355 3300025942 Bacteria 3331
195 Ga0207679_10269859 3300025945 Bacteria 1455
196 Ga0207667_10218083 3300025949 Bacteria 1955
197 Ga0207651_10015322 3300025960 Bacteria 4452
198 Ga0207651_10048126 3300025960 Bacteria 2880
199 Ga0207712_10039917 3300025961 Bacteria 3218
200 Ga0207640_10027610 3300025981 Bacteria 3460
201 Ga0207640_10129695 3300025981 Bacteria 1821
202 Ga0207658_10056173 3300025986 Bacteria 2920
203 Ga0207703_10009716 3300026035 Bacteria 7548
204 Ga0207703_10017646 3300026035 Bacteria 5571
205 Ga0207708_10002087 3300026075 Bacteria 14700
206 Ga0207708_10033763 3300026075 Bacteria 3889
207 Ga0207708_10069365 3300026075 Bacteria 2699
208 Ga0207708_10277726 3300026075 Bacteria 1356
209 Ga0207641_10001595 3300026088 Bacteria 22140
210 Ga0207641_10051346 3300026088 Bacteria 3492
211 Ga0207648_10008295 3300026089 Bacteria 10088
212 Ga0207648_10065298 3300026089 Bacteria 3173
213 Ga0207648_10210643 3300026089 Bacteria 1725
214 Ga0207676_10402573 3300026095 Bacteria 1279
215 Ga0207675_100001616 3300026118 Bacteria 22585
216 Ga0207675_100016962 3300026118 Bacteria 6806
217 Ga0207675_100034676 3300026118 Bacteria 4706
218 Ga0207675_100042148 3300026118 Bacteria 4260
219 Ga0207675_100269604 3300026118 Bacteria 1652
220 Ga0207683_10070561 3300026121 Bacteria 3087
221 Ga0207683_10127444 3300026121 Bacteria 2288
222 Ga0207683_10161622 3300026121 Bacteria 2025
223 Ga0207428_10007394 3300027907 Bacteria 10017
224 Ga0207428_10103203 3300027907 Bacteria 2201
225 Ga0207428_10138877 3300027907 Bacteria 1857
226 Ga0207428_10236407 3300027907 Bacteria 1366
227 Ga0268266_10036363 3300028379 Bacteria 4191
228 Ga0268266_10282632 3300028379 Bacteria 1543
229 Ga0268265_10006230 3300028380 Bacteria 8082
230 Ga0268265_10066603 3300028380 Bacteria 2785
231 Ga0307408_100033749 3300031548 Bacteria 3578
232 Ga0307406_10017580 3300031901 Bacteria 4166
233 Ga0307406_10186084 3300031901 Bacteria 1516
234 Ga0307409_100117872 3300031995 Bacteria 2241
235 Ga0307416_100013371 3300032002 Bacteria 5575
236 Ga0307416_100116206 3300032002 Bacteria 2371
237 Ga0307414_10237808 3300032004 Bacteria 1506
238 Ga0307411_10025934 3300032005 Bacteria 3520
239 Ga0307411_10115284 3300032005 Bacteria 1932
240 Ga0307411_10139006 3300032005 Bacteria 1788
241 Ga0373950_0001550 3300034818 Bacteria 3019
242 Ga0373958_0000154 3300034819 Bacteria 7715
243 Ga0373959_0012279 3300034820 Bacteria 1526
244 Ga0373938_0012065 3300034957 Bacteria 1615
245 Ga0373929_0002300 3300035085 Bacteria 3523
246 Ga0373934_0067432 3300035086 Bacteria 1429
247 Ga0373949_0003665 3300035090 Bacteria 3606
248 Ga0373951_0000326 3300035091 Bacteria 14833
249 Ga0373932_0000456 3300035112 Bacteria 12511
250 Ga0373939_0009462 3300035114 Bacteria 2416
251 Ga0373939_0023093 3300035114 Bacteria 1720
252 Ga0373941_0000683 3300035115 Bacteria 6905
253 Ga0373960_0004272 3300035121 Bacteria 3263
254 Ga0373961_0001131 3300035241 Bacteria 8401
255 Ga0373962_0001633 3300035242 Bacteria 5324
256 Ga0373931_0028835 3300035691 Bacteria 2846
257 Ga0373931_0047536 3300035691 Bacteria 2272
258 Ga0373925_0086929 3300037068 Bacteria 2386
259 Ga0436364_1305431 3300037853 Bacteria 36077
260 Ga0439446_0004627 3300042156 Bacteria 3491
261 Ga0439435_0012869 3300042436 Bacteria 2037
262 Ga0439464_0010659 3300042439 Bacteria 2427
263 Ga0466963_0059048 3300044694 Bacteria 2559
264 Ga0451576_0003807 3300045051 Bacteria 20318
265 Ga0466967_0187770 3300045976 Bacteria 1952
266 Ga0495651_0117769 3300046462 Bacteria 1955
267 Ga0495628_0074419 3300046516 Bacteria 2646
268 Ga0495652_0099732 3300046529 Bacteria 2358
269 Ga0495645_0035904 3300046543 Bacteria 3614
270 Ga0495635_0049234 3300046663 Bacteria 2904
271 Ga0495647_0029320 3300046681 Bacteria 2035
272 Ga0496102_0000074 3300048905 Bacteria 148938
273 Ga0496103_0047042 3300048906 Bacteria 2665
274 Ga0496104_0291865 3300048907 Bacteria 1543
275 Ga0496106_0205656 3300048909 Bacteria 1567
276 Ga0496107_0055220 3300048910 Bacteria 2869
277 Ga0496107_0056344 3300048910 Bacteria 2840
278 Ga0496108_0175788 3300048911 Bacteria 1853
279 Ga0496112_0153559 3300048915 Bacteria 2269
280 Ga0496112_0177004 3300048915 Bacteria 2098
281 Ga0496112_0209156 3300048915 Bacteria 1909
282 Ga0496112_0413065 3300048915 Bacteria 1289
283 Ga0496113_0005340 3300048916 Bacteria 8003
284 Ga0496114_0052440 3300048917 Bacteria 3399
285 Ga0501303_002506 3300049526 Bacteria 1422
286 Ga0501039_0018382 3300049575 Bacteria 5365
287 Ga0501039_0054439 3300049575 Bacteria 3097
288 Ga0501039_0223586 3300049575 Bacteria 1480
289 Ga0501041_0033316 3300049577 Bacteria 3117
290 Ga0501048_0167600 3300049582 Bacteria 1555
291 Ga0501068_0153706 3300049584 Bacteria 1447
292 Ga0501071_0080872 3300049587 Bacteria 2377
293 Ga0501072_0033540 3300049588 Bacteria 4023
294 Ga0501072_0053617 3300049588 Bacteria 3176
295 Ga0501072_0099293 3300049588 Bacteria 2314
296 Ga0501072_0112929 3300049588 Bacteria 2163
297 Ga0501075_0032859 3300049591 Bacteria 3858
298 Ga0501075_0043466 3300049591 Bacteria 3370
299 Ga0501075_0108221 3300049591 Bacteria 2113
300 Ga0501077_0254103 3300049593 Bacteria 1118
301 Ga0501079_0137005 3300049741 Bacteria 1906
302 Ga0501080_0062744 3300049742 Bacteria 3459
303 Ga0501081_0022237 3300049743 Bacteria 4241
304 Ga0501081_0080932 3300049743 Bacteria 2274
305 Ga0501045_0014141 3300049824 Bacteria 5652
306 Ga0501045_0217656 3300049824 Bacteria 1422
307 nmdc:mga00v17_34511_c1 3300050491 Bacteria 3006
308 nmdc:mga0yw44_50675_c1 3300050492 Bacteria 2511
309 nmdc:mga05p37_184263_c1 3300050507 Bacteria 2539
310 nmdc:mga05p37_284096_c1 3300050507 Bacteria 1972
311 nmdc:mga05p37_301353_c1 3300050507 Bacteria 1904
312 nmdc:mga05p37_3042_c1 3300050507 Bacteria 19468
313 nmdc:mga05p37_30531_c1 3300050507 Bacteria 6575
314 nmdc:mga05p37_488961_c1 3300050507 Bacteria 1415
315 nmdc:mga05p37_56260_c1 3300050507 Bacteria 4843
316 nmdc:mga05p37_62498_c1 3300050507 Bacteria 4583
317 nmdc:mga05p37_7953_c1 3300050507 Bacteria 12514
318 nmdc:mga05p37_87926_c1 3300050507 Bacteria 3830
319 nmdc:mga05p37_9119_c1 3300050507 Bacteria 11724
320 nmdc:mga05p37_92554_c1 3300050507 Bacteria 3725
321 nmdc:mga09592_48986_c1 3300050508 Bacteria 3562
322 nmdc:mga09592_70027_c1 3300050508 Bacteria 2976
323 nmdc:mga06r32_22588_c1 3300050510 Bacteria 5817
324 nmdc:mga06r32_33339_c1 3300050510 Bacteria 4850
325 nmdc:mga06r32_375937_c1 3300050510 Bacteria 1404
326 nmdc:mga06r32_76446_c1 3300050510 Bacteria 3251
327 nmdc:mga06r32_79956_c1 3300050510 Bacteria 3181
328 nmdc:mga08y16_10660_c1 3300050511 Bacteria 9647
329 nmdc:mga08y16_4051_c1 3300050511 Bacteria 15292
330 nmdc:mga08y16_6046_c1 3300050511 Bacteria 12684
331 nmdc:mga0n895_134526_c1 3300050512 Bacteria 2498
332 nmdc:mga0n895_17098_c1 3300050512 Bacteria 6679
333 nmdc:mga0n895_255_c1 3300050512 Bacteria 34281
334 nmdc:mga0n895_386008_c1 3300050512 Bacteria 1417
335 nmdc:mga0rr50_20246_c1 3300050513 Bacteria 4512
336 nmdc:mga0rr50_21_c1 3300050513 Bacteria 125964
337 nmdc:mga0rr50_74911_c1 3300050513 Bacteria 2593
338 nmdc:mga0rr50_99062_c1 3300050513 Bacteria 2286
339 nmdc:mga08x19_10757_c1 3300050514 Bacteria 5500
340 nmdc:mga08x19_279_c1 3300050514 Bacteria 38642
341 nmdc:mga08x19_50775_c1 3300050514 Bacteria 2662
342 nmdc:mga08x19_71635_c1 3300050514 Bacteria 2260
343 nmdc:mga0a205_173972_c1 3300050515 Bacteria 2049
344 nmdc:mga0a205_3911_c1 3300050515 Bacteria 13332
345 Ga0495601_0094527 3300053077 Bacteria 1927
346 Ga0495619_0103144 3300053085 Bacteria 1943
347 Ga0501084_0248052 3300054114 Bacteria 1503
348 Ga0590074_000342 3300059423 Bacteria 6493
349 Ga0590074_001276 3300059423 Bacteria 4003
350 Ga0590075_000506 3300059424 Bacteria 10572
351 Ga0590075_001424 3300059424 Bacteria 5995
352 Ga0590077_000203 3300059426 Bacteria 17280
353 Ga0590077_000905 3300059426 Bacteria 7572
354 Ga0501082_0071724 3300060353 Bacteria 2983
355 Ga0501082_0156582 3300060353 Bacteria 1979
356 Ga0530510_0042299 3300061734 Bacteria 3291
357 Ga0163163_10069542
358 Ga0065712_10104949
359 Ga0070690_100012172
360 Ga0070670_100112366
361 Ga0070677_10032592
362 Ga0068869_100062190
363 Ga0070666_10001469
364 Ga0068868_100082925
365 Ga0070660_100036721
366 Ga0070660_100153874
367 Ga0070660_100184058
368 Ga0070691_10022182
369 Ga0070691_10074599
370 Ga0070687_100079329
371 Ga0070668_100053437
372 Ga0070669_100008959
373 Ga0070669_100051072
374 Ga0070669_100104678
375 Ga0070675_100013743
376 Ga0070675_100076274
377 Ga0070674_100003793
378 Ga0070659_100052416
379 Ga0070667_100001323
380 Ga0070709_10093798
381 Ga0070714_100033234
382 Ga0070714_100103510
383 Ga0070701_10006758
384 Ga0070711_100233463
385 Ga0070700_100095879
386 Ga0070700_100224890
387 Ga0070694_100013394
388 Ga0070694_100041226
389 Ga0070708_100018809
390 Ga0070708_100020833
391 Ga0070708_100023052
392 Ga0070678_100057016
393 Ga0070678_100161730
394 Ga0070681_10084493
395 Ga0068867_100191160
396 Ga0070685_10097256
397 Ga0070707_100075806
398 Ga0070699_100064698
399 Ga0070699_100116438
400 Ga0070699_100148357
401 Ga0070679_100005173
402 Ga0070679_100031695
403 Ga0070697_100162011
404 Ga0070697_100260067
405 Ga0070672_100017028
406 Ga0070686_100001886
407 Ga0070695_100005321
408 Ga0070695_100038723
409 Ga0070696_100012922
410 Ga0070665_100002515
411 Ga0070665_100027088
412 Ga0070704_100010104
413 Ga0070704_100014130
414 Ga0070704_100128962
415 Ga0068855_100400678
416 Ga0068855_100421410
417 Ga0068854_100001201
418 Ga0068854_100008170
419 Ga0068859_100034216
420 Ga0068864_100001667
421 Ga0068866_10041993
422 Ga0068866_10046346
423 Ga0068861_100004585
424 Ga0068861_100019550
425 Ga0068861_100070454
426 Ga0068861_100130460
427 Ga0068870_10161577
428 Ga0068863_100001577
429 Ga0068858_100036957
430 Ga0068860_100093704
431 Ga0068862_100006768
432 Ga0068862_100116175
433 Ga0068862_100226963
434 Ga0081455_10024510
435 Ga0081538_10002503
436 Ga0081538_10010270
437 Ga0081538_10024747
438 Ga0075364_10021686
439 Ga0075362_10001768
440 Ga0075367_10069056
441 Ga0068871_100007708
442 Ga0068871_100121763
443 Ga0075428_100009577
444 Ga0075428_100099714
445 Ga0075430_100004330
446 Ga0075431_100358811
447 Ga0075433_10158656
448 Ga0075434_100000448
449 Ga0075434_100045480
450 Ga0075434_100130137
451 Ga0075434_100173085
452 Ga0075429_100004908
453 Ga0075429_100015707
454 Ga0068865_100052802
455 Ga0068865_100169217
456 Ga0075436_100000366
457 Ga0075436_100009707
458 Ga0075436_100010418
459 Ga0075436_100040351
460 Ga0075436_100054221
461 Ga0075436_100103078
462 Ga0097620_100034216
463 Ga0075435_100000119
464 Ga0075435_100003845
465 Ga0075435_100022193
466 Ga0075435_100094072
467 Ga0075435_100098952
468 Ga0075435_100154022
469 Ga0075435_100249323
470 Ga0099794_10037806
471 Ga0099794_10071820
472 Ga0105240_10130772
473 Ga0111539_10009192
474 Ga0111539_10009283
475 Ga0111539_10012369
476 Ga0111539_10028961
477 Ga0111539_10113573
478 Ga0105245_10015703
479 Ga0105245_10065509
480 Ga0114129_10003700
481 Ga0114129_10006040
482 Ga0114129_10008880
483 Ga0114129_10011546
484 Ga0114129_10011616
485 Ga0114129_10012284
486 Ga0114129_10025366
487 Ga0114129_10027060
488 Ga0114129_10049871
489 Ga0114129_10070805
490 Ga0114129_10078199
491 Ga0114129_10230724
492 Ga0114129_10386158
493 Ga0105243_10031721
494 Ga0105243_10086814
495 Ga0105242_10002869
496 Ga0105242_10009699
497 Ga0105242_10145494
498 Ga0105248_10004581
499 Ga0105248_10010436
500 Ga0105248_10016485
501 Ga0105248_10028518
502 Ga0105248_10465119
503 Ga0105248_10509468
504 Ga0105249_10044585
505 Ga0105239_10017176
506 Ga0105239_10044897
507 Ga0157375_10312572
508 Ga0163163_10001687
509 Ga0163163_10029341
510 Ga0163163_10034604
511 Ga0163163_10278333
512 Ga0157380_10016581
513 Ga0157380_10099191
514 Ga0157379_10026515
515 Ga0157379_10028601
516 Ga0157376_10001464
517 Ga0157376_10095574
518 Ga0207680_10019650
519 Ga0207645_10013091
520 Ga0207707_10076919
521 Ga0207707_10211643
522 Ga0207695_10093565
523 Ga0207657_10048480
524 Ga0207646_10061362
525 Ga0207681_10009346
526 Ga0207681_10217753
527 Ga0207659_10008728
528 Ga0207659_10028540
529 Ga0207687_10046328
530 Ga0207687_10149104
531 Ga0207700_10093634
532 Ga0207644_10027955
533 Ga0207644_10057211
534 Ga0207706_10122697
535 Ga0207686_10015236
536 Ga0207686_10019606
537 Ga0207709_10053881
538 Ga0207709_10054544
539 Ga0207670_10146504
540 Ga0207669_10140189
541 Ga0207704_10012608
542 Ga0207704_10017412
543 Ga0207691_10057082
544 Ga0207691_10144056
545 Ga0207711_10006205
546 Ga0207711_10045121
547 Ga0207711_10092620
548 Ga0207711_10094002
549 Ga0207711_10152334
550 Ga0207689_10053355
551 Ga0207679_10269859
552 Ga0207667_10218083
553 Ga0207651_10015322
554 Ga0207651_10048126
555 Ga0207712_10039917
556 Ga0207640_10027610
557 Ga0207640_10129695
558 Ga0207658_10056173
559 Ga0207703_10009716
560 Ga0207703_10017646
561 Ga0207708_10002087
562 Ga0207708_10033763
563 Ga0207708_10069365
564 Ga0207708_10277726
565 Ga0207641_10001595
566 Ga0207641_10051346
567 Ga0207648_10008295
568 Ga0207648_10065298
569 Ga0207648_10210643
570 Ga0207676_10402573
571 Ga0207675_100001616
572 Ga0207675_100016962
573 Ga0207675_100034676
574 Ga0207675_100042148
575 Ga0207675_100269604
576 Ga0207683_10070561
577 Ga0207683_10127444
578 Ga0207683_10161622
579 Ga0207428_10007394
580 Ga0207428_10103203
581 Ga0207428_10138877
582 Ga0207428_10236407
583 Ga0268266_10036363
584 Ga0268266_10282632
585 Ga0268265_10006230
586 Ga0268265_10066603
587 Ga0307408_100033749
588 Ga0307406_10017580
589 Ga0307406_10186084
590 Ga0307409_100117872
591 Ga0307416_100013371
592 Ga0307416_100116206
593 Ga0307414_10237808
594 Ga0307411_10025934
595 Ga0307411_10115284
596 Ga0307411_10139006
597 Ga0373950_0001550
598 Ga0373958_0000154
599 Ga0373959_0012279
600 Ga0373938_0012065
601 Ga0373929_0002300
602 Ga0373934_0067432
603 Ga0373949_0003665
604 Ga0373951_0000326
605 Ga0373932_0000456
606 Ga0373939_0009462
607 Ga0373939_0023093
608 Ga0373941_0000683
609 Ga0373960_0004272
610 Ga0373961_0001131
611 Ga0373962_0001633
612 Ga0373931_0028835
613 Ga0373931_0047536
614 Ga0373925_0086929
615 Ga0436364_1305431
616 Ga0439446_0004627
617 Ga0439435_0012869
618 Ga0439464_0010659
619 Ga0466963_0059048
620 Ga0451576_0003807
621 Ga0466967_0187770
622 Ga0495651_0117769
623 Ga0495628_0074419
624 Ga0495652_0099732
625 Ga0495645_0035904
626 Ga0495635_0049234
627 Ga0495647_0029320
628 Ga0496102_0000074
629 Ga0496103_0047042
630 Ga0496104_0291865
631 Ga0496106_0205656
632 Ga0496107_0055220
633 Ga0496107_0056344
634 Ga0496108_0175788
635 Ga0496112_0153559
636 Ga0496112_0177004
637 Ga0496112_0209156
638 Ga0496112_0413065
639 Ga0496113_0005340
640 Ga0496114_0052440
641 Ga0501303_002506
642 Ga0501039_0018382
643 Ga0501039_0054439
644 Ga0501039_0223586
645 Ga0501041_0033316
646 Ga0501048_0167600
647 Ga0501068_0153706
648 Ga0501071_0080872
649 Ga0501072_0033540
650 Ga0501072_0053617
651 Ga0501072_0099293
652 Ga0501072_0112929
653 Ga0501075_0032859
654 Ga0501075_0043466
655 Ga0501075_0108221
656 Ga0501077_0254103
657 Ga0501079_0137005
658 Ga0501080_0062744
659 Ga0501081_0022237
660 Ga0501081_0080932
661 Ga0501045_0014141
662 Ga0501045_0217656
663 nmdc:mga00v17_34511_c1
664 nmdc:mga0yw44_50675_c1
665 nmdc:mga05p37_184263_c1
666 nmdc:mga05p37_284096_c1
667 nmdc:mga05p37_301353_c1
668 nmdc:mga05p37_3042_c1
669 nmdc:mga05p37_30531_c1
670 nmdc:mga05p37_488961_c1
671 nmdc:mga05p37_56260_c1
672 nmdc:mga05p37_62498_c1
673 nmdc:mga05p37_7953_c1
674 nmdc:mga05p37_87926_c1
675 nmdc:mga05p37_9119_c1
676 nmdc:mga05p37_92554_c1
677 nmdc:mga09592_48986_c1
678 nmdc:mga09592_70027_c1
679 nmdc:mga06r32_22588_c1
680 nmdc:mga06r32_33339_c1
681 nmdc:mga06r32_375937_c1
682 nmdc:mga06r32_76446_c1
683 nmdc:mga06r32_79956_c1
684 nmdc:mga08y16_10660_c1
685 nmdc:mga08y16_4051_c1
686 nmdc:mga08y16_6046_c1
687 nmdc:mga0n895_134526_c1
688 nmdc:mga0n895_17098_c1
689 nmdc:mga0n895_255_c1
690 nmdc:mga0n895_386008_c1
691 nmdc:mga0rr50_20246_c1
692 nmdc:mga0rr50_21_c1
693 nmdc:mga0rr50_74911_c1
694 nmdc:mga0rr50_99062_c1
695 nmdc:mga08x19_10757_c1
696 nmdc:mga08x19_279_c1
697 nmdc:mga08x19_50775_c1
698 nmdc:mga08x19_71635_c1
699 nmdc:mga0a205_173972_c1
700 nmdc:mga0a205_3911_c1
701 Ga0495601_0094527
702 Ga0495619_0103144
703 Ga0501084_0248052
704 Ga0590074_000342
705 Ga0590074_001276
706 Ga0590075_000506
707 Ga0590075_001424
708 Ga0590077_000203
709 Ga0590077_000905
710 Ga0501082_0071724
711 Ga0501082_0156582
712 Ga0530510_0042299

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

24

389

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yit-assembly2.cif.gz_D crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.9499 5 375
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.949 5 382
5yx6-assembly2.cif.gz_D crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.9475 5 374
5yit-assembly1.cif.gz_B crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.9471 5 377
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.9466 5 382
ID Description Score Start End Superfamily
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.982 227 318 3.30.1540.10
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9746 29 237 3.40.50.10540
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9746 227 318 3.30.1540.10
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9716 227 318 3.30.1540.10
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9687 5 283 3.40.50.10540
ID Description Score Start End GO Terms
AF-A0A1F9DFM9-F1-model_v4 Formyl-CoA transferase 0.985 5 392 GO:0008410
AF-A0A497KNB9-F1-model_v4 CoA transferase 0.9833 5 392 GO:0008410
AF-A0A536AL45-F1-model_v4 CoA transferase 0.9832 5 333 GO:0008410
AF-A0A5N9BBE6-F1-model_v4 CoA transferase 0.983 6 392 GO:0008410
AF-A0A2N4U3Y2-F1-model_v4 Crotonobetainyl-CoA:carnitine CoA-transferase CaiB-like acyl-CoA transferase 0.9828 18 392 GO:0008410

Map