F420480

General Info

Members Datasets Scaffolds Average Seq Length
356 190 712 130

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_11453910|Ga0105241_114539102
Length 156
Sequence MLRPERTENEPGANKARSDPSTKELYMRFIPTKFHAPLDYIVGGALIAAPWIFQFSEHTAATTVPIVLGIGLIAYSLFTDYELGVWKVAPMAVHNLIDIVAGILLAASPWIFGFADETANVWAPFVVIGLAAVFLGLTTKQVGGYSYRRRPTAATG

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
123 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
124 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
125 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
126 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
127 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
128 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
129 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
142 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
143 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 15.45
Rhizosphere 83.15
Stem 0
Stem Tuber 0
Unclassified 10.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_11453910 3300009174 Bacteria 658
2 JGI25406J46586_10003837 3300003203 Bacteria 7024
3 Ga0070683_100230271 3300005329 Bacteria 1762
4 Ga0070690_100064851 3300005330 Bacteria 2361
5 Ga0068869_100506804 3300005334 Bacteria 1008
6 Ga0070666_11054571 3300005335 Bacteria 604
7 Ga0070680_100116802 3300005336 Bacteria 2224
8 Ga0070682_100002294 3300005337 Bacteria 10577
9 Ga0068868_100115562 3300005338 Bacteria 2184
10 Ga0068868_100147043 3300005338 Bacteria 1938
11 Ga0068868_100245139 3300005338 Unclassified 1507
12 Ga0070687_100262388 3300005343 Bacteria 1079
13 Ga0070668_100322668 3300005347 Bacteria 1300
14 Ga0070668_100405924 3300005347 Unclassified 1164
15 Ga0070669_101231556 3300005353 Bacteria 647
16 Ga0070671_100462690 3300005355 Bacteria 1089
17 Ga0070673_100756523 3300005364 Bacteria 895
18 Ga0070659_100491961 3300005366 Unclassified 1045
19 Ga0070709_10245245 3300005434 Bacteria 1288
20 Ga0070713_100196788 3300005436 Bacteria 1818
21 Ga0070710_10068562 3300005437 Bacteria 2038
22 Ga0070705_100824819 3300005440 Bacteria 740
23 Ga0070705_100828136 3300005440 Bacteria 738
24 Ga0070694_100743021 3300005444 Bacteria 801
25 Ga0070708_100259798 3300005445 Unclassified 1632
26 Ga0070708_101045078 3300005445 Bacteria 765
27 Ga0070678_100126298 3300005456 Bacteria 2025
28 Ga0070662_100019350 3300005457 Bacteria 4622
29 Ga0070662_100083334 3300005457 Bacteria 2386
30 Ga0070681_10328523 3300005458 Bacteria 1439
31 Ga0068867_100030029 3300005459 Bacteria 3920
32 Ga0070685_10837091 3300005466 Bacteria 681
33 Ga0070706_100041574 3300005467 Bacteria 4243
34 Ga0070706_101468035 3300005467 Bacteria 623
35 Ga0070707_100024825 3300005468 Bacteria 5681
36 Ga0070698_100001311 3300005471 Bacteria 27698
37 Ga0070699_100014443 3300005518 Bacteria 6790
38 Ga0070699_100039845 3300005518 Bacteria 4068
39 Ga0070697_100230932 3300005536 Bacteria 1578
40 Ga0070697_100466105 3300005536 Bacteria 1102
41 Ga0070697_100601723 3300005536 Bacteria 966
42 Ga0070686_100015577 3300005544 Bacteria 4407
43 Ga0070686_100170065 3300005544 Bacteria 1541
44 Ga0070695_100286860 3300005545 Bacteria 1212
45 Ga0070696_100006125 3300005546 Bacteria 8031
46 Ga0070696_100047536 3300005546 Bacteria 2977
47 Ga0070693_100036122 3300005547 Bacteria 2744
48 Ga0070693_100167898 3300005547 Bacteria 1403
49 Ga0068855_100261144 3300005563 Bacteria 1929
50 Ga0068855_100373144 3300005563 Bacteria 1568
51 Ga0068854_100096921 3300005578 Bacteria 2204
52 Ga0068856_100119150 3300005614 Bacteria 2640
53 Ga0068856_100447871 3300005614 Bacteria 1312
54 Ga0068856_101037690 3300005614 Bacteria 838
55 Ga0070702_100271947 3300005615 Bacteria 1159
56 Ga0068861_100000835 3300005719 Bacteria 18614
57 Ga0068870_10203041 3300005840 Bacteria 1203
58 Ga0068863_100391036 3300005841 Unclassified 1359
59 Ga0068858_101795071 3300005842 Bacteria 606
60 Ga0068860_100575461 3300005843 Bacteria 1130
61 Ga0068862_100084210 3300005844 Bacteria 2762
62 Ga0068862_100213376 3300005844 Bacteria 1745
63 Ga0081455_10004035 3300005937 Bacteria 16651
64 Ga0081455_10010109 3300005937 Bacteria 9620
65 Ga0081455_10027440 3300005937 Bacteria 5217
66 Ga0081455_10028291 3300005937 Bacteria 5123
67 Ga0081538_10000278 3300005981 Bacteria 58482
68 Ga0081540_1005672 3300005983 Bacteria 9276
69 Ga0081540_1245365 3300005983 Bacteria 627
70 Ga0081539_10001821 3300005985 Bacteria 33639
71 Ga0081539_10002503 3300005985 Bacteria 25750
72 Ga0081539_10003845 3300005985 Bacteria 17613
73 Ga0075365_11065778 3300006038 Bacteria 569
74 Ga0070715_10150589 3300006163 Bacteria 1139
75 Ga0070716_100757482 3300006173 Bacteria 748
76 Ga0097621_100022471 3300006237 Bacteria 4896
77 Ga0097621_100701799 3300006237 Bacteria 932
78 Ga0068871_101007213 3300006358 Bacteria 776
79 Ga0068871_101200289 3300006358 Unclassified 712
80 Ga0075428_100017878 3300006844 Bacteria 7834
81 Ga0075428_100149521 3300006844 Bacteria 2537
82 Ga0075428_100438642 3300006844 Bacteria 1399
83 Ga0075430_100395643 3300006846 Bacteria 1140
84 Ga0075431_100123981 3300006847 Bacteria 2665
85 Ga0075431_100215123 3300006847 Bacteria 1962
86 Ga0075434_100111842 3300006871 Bacteria 2742
87 Ga0075434_100248386 3300006871 Bacteria 1798
88 Ga0075429_100045632 3300006880 Bacteria 3813
89 Ga0075436_100104211 3300006914 Unclassified 1977
90 Ga0075435_100005773 3300007076 Bacteria 8693
91 Ga0075435_100136150 3300007076 Bacteria 2058
92 Ga0111539_10611881 3300009094 Bacteria 1269
93 Ga0111539_11848633 3300009094 Bacteria 700
94 Ga0105245_10016574 3300009098 Bacteria 6429
95 Ga0105245_10047430 3300009098 Bacteria 3841
96 Ga0105245_10088607 3300009098 Bacteria 2843
97 Ga0105245_10105169 3300009098 Bacteria 2618
98 Ga0105245_10509815 3300009098 Bacteria 1220
99 Ga0105245_10596026 3300009098 Bacteria 1131
100 Ga0105245_11548112 3300009098 Bacteria 714
101 Ga0114129_10128770 3300009147 Bacteria 3478
102 Ga0105243_11471025 3300009148 Bacteria 704
103 Ga0105243_12920397 3300009148 Bacteria 518
104 Ga0105241_10012195 3300009174 Bacteria 6307
105 Ga0105242_10098524 3300009176 Bacteria 2473
106 Ga0105242_11064345 3300009176 Bacteria 821
107 Ga0105242_11758163 3300009176 Bacteria 657
108 Ga0105248_10271540 3300009177 Bacteria 1909
109 Ga0105248_10300315 3300009177 Bacteria 1808
110 Ga0105248_10859562 3300009177 Unclassified 1024
111 Ga0105249_10115521 3300009553 Unclassified 2543
112 Ga0105249_10152982 3300009553 Bacteria 2222
113 Ga0105249_10191255 3300009553 Bacteria 1997
114 Ga0105239_10089058 3300010375 Bacteria 3403
115 Ga0105239_10196978 3300010375 Bacteria 2256
116 Ga0105239_10365301 3300010375 Bacteria 1630
117 Ga0105246_10031456 3300011119 Bacteria 3512
118 Ga0105246_10524429 3300011119 Unclassified 1010
119 Ga0157343_1001583 3300012488 Bacteria 1133
120 Ga0157373_10161520 3300013100 Bacteria 1576
121 Ga0157374_10771658 3300013296 Bacteria 976
122 Ga0157374_11373169 3300013296 Bacteria 729
123 Ga0157378_10353940 3300013297 Unclassified 1435
124 Ga0163162_10515842 3300013306 Unclassified 1325
125 Ga0163162_10689816 3300013306 Bacteria 1143
126 Ga0163162_12158935 3300013306 Bacteria 639
127 Ga0157372_10052784 3300013307 Bacteria 4528
128 Ga0157372_10231598 3300013307 Bacteria 2142
129 Ga0157375_10070990 3300013308 Bacteria 3494
130 Ga0163163_10429431 3300014325 Bacteria 1380
131 Ga0163163_12081266 3300014325 Unclassified 627
132 Ga0157380_11111164 3300014326 Bacteria 830
133 Ga0182008_10117732 3300014497 Bacteria 1319
134 Ga0182008_10205347 3300014497 Bacteria 1004
135 Ga0157377_10747180 3300014745 Unclassified 715
136 Ga0157377_11460436 3300014745 Bacteria 542
137 Ga0163161_10081775 3300017792 Bacteria 2379
138 Ga0163161_10148958 3300017792 Bacteria 1777
139 Ga0207692_10059031 3300025898 Bacteria 1979
140 Ga0207680_10420728 3300025903 Bacteria 946
141 Ga0207680_10439782 3300025903 Bacteria 925
142 Ga0207699_10208719 3300025906 Bacteria 1327
143 Ga0207684_10448714 3300025910 Unclassified 1107
144 Ga0207695_10570103 3300025913 Bacteria 1013
145 Ga0207693_10042493 3300025915 Bacteria 3578
146 Ga0207693_10147661 3300025915 Bacteria 1849
147 Ga0207663_10004992 3300025916 Bacteria 6652
148 Ga0207660_10051223 3300025917 Bacteria 2935
149 Ga0207660_10795979 3300025917 Bacteria 771
150 Ga0207662_10647735 3300025918 Bacteria 738
151 Ga0207652_11386115 3300025921 Bacteria 606
152 Ga0207646_10023049 3300025922 Bacteria 5724
153 Ga0207687_10082954 3300025927 Bacteria 2320
154 Ga0207687_10232466 3300025927 Bacteria 1457
155 Ga0207687_10461658 3300025927 Bacteria 1055
156 Ga0207687_10582998 3300025927 Bacteria 941
157 Ga0207700_10124729 3300025928 Bacteria 2093
158 Ga0207664_10286206 3300025929 Bacteria 1447
159 Ga0207664_11069094 3300025929 Bacteria 722
160 Ga0207644_10989741 3300025931 Bacteria 706
161 Ga0207690_10581186 3300025932 Bacteria 913
162 Ga0207706_10025900 3300025933 Bacteria 5252
163 Ga0207706_10064101 3300025933 Bacteria 3235
164 Ga0207686_10535247 3300025934 Unclassified 914
165 Ga0207709_10138782 3300025935 Bacteria 1668
166 Ga0207709_10196599 3300025935 Bacteria 1437
167 Ga0207709_10759194 3300025935 Bacteria 780
168 Ga0207704_10617996 3300025938 Bacteria 889
169 Ga0207665_10002419 3300025939 Bacteria 12632
170 Ga0207665_10875616 3300025939 Unclassified 712
171 Ga0207691_10511111 3300025940 Bacteria 1020
172 Ga0207711_10267040 3300025941 Unclassified 1574
173 Ga0207711_11338606 3300025941 Bacteria 658
174 Ga0207667_10425784 3300025949 Bacteria 1350
175 Ga0207651_10218549 3300025960 Bacteria 1539
176 Ga0207651_10966215 3300025960 Bacteria 760
177 Ga0207712_10529602 3300025961 Unclassified 1011
178 Ga0207712_10719022 3300025961 Unclassified 873
179 Ga0207712_11758547 3300025961 Bacteria 556
180 Ga0207668_10037468 3300025972 Bacteria 3246
181 Ga0207668_11912306 3300025972 Bacteria 535
182 Ga0207640_10483431 3300025981 Bacteria 1028
183 Ga0207640_10713394 3300025981 Bacteria 861
184 Ga0207677_10031810 3300026023 Bacteria 3383
185 Ga0207677_10195731 3300026023 Bacteria 1602
186 Ga0207677_10442207 3300026023 Bacteria 1112
187 Ga0207677_10511015 3300026023 Bacteria 1041
188 Ga0207708_10303489 3300026075 Bacteria 1299
189 Ga0207708_10941202 3300026075 Bacteria 749
190 Ga0207702_11281096 3300026078 Bacteria 727
191 Ga0207648_10033192 3300026089 Bacteria 4553
192 Ga0207648_11756927 3300026089 Unclassified 582
193 Ga0207675_100000592 3300026118 Bacteria 35478
194 Ga0207683_10001522 3300026121 Bacteria 20883
195 Ga0207683_10331048 3300026121 Bacteria 1396
196 Ga0209966_1017706 3300027695 Bacteria 1360
197 Ga0209998_10078696 3300027717 Bacteria 796
198 Ga0207428_10592690 3300027907 Bacteria 799
199 Ga0268265_11185611 3300028380 Unclassified 761
200 Ga0307416_100610338 3300032002 Unclassified 1172
201 Ga0373948_0183880 3300034817 Bacteria 538
202 Ga0373950_0141685 3300034818 Bacteria 545
203 Ga0373959_0204875 3300034820 Bacteria 523
204 Ga0373928_0002079 3300035084 Bacteria 3905
205 Ga0373929_0088994 3300035085 Bacteria 763
206 Ga0373949_0037982 3300035090 Bacteria 1173
207 Ga0373952_0125452 3300035092 Bacteria 700
208 Ga0373932_0284535 3300035112 Bacteria 613
209 Ga0373939_0032961 3300035114 Bacteria 1509
210 Ga0373941_0138471 3300035115 Bacteria 883
211 Ga0373960_0053408 3300035121 Bacteria 1205
212 Ga0373942_0019969 3300035207 Bacteria 1678
213 Ga0373961_0003625 3300035241 Bacteria 3798
214 Ga0373931_0006346 3300035691 Bacteria 5518
215 Ga0395899_0021149 3300037312 Bacteria 4935
216 Ga0395899_0068713 3300037312 Bacteria 2597
217 Ga0395899_0124671 3300037312 Bacteria 1842
218 Ga0395899_0305074 3300037312 Bacteria 1076
219 Ga0395899_0334920 3300037312 Bacteria 1016
220 Ga0395899_0498384 3300037312 Bacteria 790
221 Ga0395900_0006105 3300037418 Bacteria 12563
222 Ga0395900_0023403 3300037418 Bacteria 6323
223 Ga0395900_0110917 3300037418 Bacteria 2818
224 Ga0395900_0132844 3300037418 Bacteria 2550
225 Ga0395900_0139786 3300037418 Bacteria 2480
226 Ga0395900_0218667 3300037418 Bacteria 1921
227 Ga0395900_0258427 3300037418 Unclassified 1740
228 Ga0395900_0671933 3300037418 Bacteria 971
229 Ga0395898_0001382 3300037466 Bacteria 34742
230 Ga0395898_0036772 3300037466 Bacteria 4860
231 Ga0395898_0051250 3300037466 Bacteria 4037
232 Ga0395898_0051309 3300037466 Bacteria 4034
233 Ga0395898_0101330 3300037466 Bacteria 2765
234 Ga0395898_0141952 3300037466 Bacteria 2299
235 Ga0395898_0167150 3300037466 Bacteria 2103
236 Ga0395898_0281820 3300037466 Bacteria 1585
237 Ga0395898_0894338 3300037466 Bacteria 826
238 Ga0395905_0169408 3300037471 Bacteria 2051
239 Ga0395905_0170698 3300037471 Bacteria 2043
240 Ga0395905_0175316 3300037471 Unclassified 2013
241 Ga0395905_0185261 3300037471 Bacteria 1954
242 Ga0395905_0247348 3300037471 Bacteria 1666
243 Ga0395905_0287076 3300037471 Bacteria 1532
244 Ga0395905_0643626 3300037471 Bacteria 962
245 Ga0395901_0011768 3300038443 Bacteria 8871
246 Ga0395901_0041759 3300038443 Bacteria 4754
247 Ga0395901_0147719 3300038443 Bacteria 2470
248 Ga0395901_0169985 3300038443 Bacteria 2287
249 Ga0395901_0437318 3300038443 Bacteria 1339
250 Ga0395901_0591721 3300038443 Bacteria 1120
251 Ga0395901_1125159 3300038443 Bacteria 754
252 Ga0395901_1682184 3300038443 Unclassified 586
253 Ga0451807_1322138 3300041486 Bacteria 704
254 Ga0451839_0312314 3300041496 Bacteria 553
255 Ga0451839_1310097 3300041496 Bacteria 737
256 Ga0439450_057762 3300042008 Bacteria 933
257 Ga0466964_0476251 3300044706 Bacteria 666
258 Ga0466968_0310804 3300044735 Bacteria 760
259 Ga0466960_0091392 3300044901 Bacteria 1552
260 Ga0466960_0293129 3300044901 Bacteria 915
261 Ga0466967_0506131 3300045976 Bacteria 1186
262 Ga0466967_1763961 3300045976 Bacteria 616
263 Ga0495603_0059593 3300046455 Bacteria 2257
264 Ga0495584_0311189 3300046491 Bacteria 800
265 Ga0495656_0394613 3300046615 Bacteria 723
266 Ga0495656_0628737 3300046615 Unclassified 576
267 Ga0495668_0202158 3300046616 Bacteria 1088
268 Ga0495670_0180100 3300046691 Bacteria 1116
269 Ga0496100_0031012 3300048903 Bacteria 3320
270 Ga0496100_0100028 3300048903 Bacteria 1996
271 Ga0496100_0162163 3300048903 Bacteria 1603
272 Ga0496100_0351657 3300048903 Unclassified 1113
273 Ga0496100_0529370 3300048903 Bacteria 910
274 Ga0496101_0152021 3300048904 Bacteria 1771
275 Ga0496101_0322489 3300048904 Bacteria 1212
276 Ga0496102_0202223 3300048905 Bacteria 1872
277 Ga0496103_0007519 3300048906 Bacteria 6493
278 Ga0496103_0406202 3300048906 Unclassified 875
279 Ga0496104_0023723 3300048907 Bacteria 5642
280 Ga0496104_0028807 3300048907 Bacteria 5147
281 Ga0496104_0196603 3300048907 Bacteria 1928
282 Ga0496104_0584173 3300048907 Bacteria 1027
283 Ga0496105_0024431 3300048908 Bacteria 4909
284 Ga0496105_0083257 3300048908 Bacteria 2642
285 Ga0496106_0087304 3300048909 Bacteria 2403
286 Ga0496106_0109805 3300048909 Bacteria 2147
287 Ga0496107_0075295 3300048910 Bacteria 2457
288 Ga0496107_0368441 3300048910 Bacteria 1068
289 Ga0496107_0920389 3300048910 Bacteria 637
290 Ga0496108_0036523 3300048911 Unclassified 4089
291 Ga0496108_0036601 3300048911 Bacteria 4084
292 Ga0496108_0038365 3300048911 Bacteria 3990
293 Ga0496108_1061862 3300048911 Bacteria 689
294 Ga0496109_0052005 3300048912 Bacteria 3732
295 Ga0496109_0077053 3300048912 Bacteria 3068
296 Ga0496109_0169689 3300048912 Bacteria 2046
297 Ga0496109_0290952 3300048912 Bacteria 1540
298 Ga0496109_0783683 3300048912 Bacteria 891
299 Ga0496110_0017664 3300048913 Bacteria 5965
300 Ga0496110_0044148 3300048913 Bacteria 3892
301 Ga0496110_0311994 3300048913 Bacteria 1432
302 Ga0496110_0678473 3300048913 Bacteria 931
303 Ga0496110_0866197 3300048913 Bacteria 809
304 Ga0496111_0001708 3300048914 Bacteria 12830
305 Ga0496111_0005493 3300048914 Bacteria 8135
306 Ga0496111_0032186 3300048914 Bacteria 3738
307 Ga0496111_0733434 3300048914 Bacteria 717
308 Ga0496112_0010678 3300048915 Bacteria 8345
309 Ga0496112_0260879 3300048915 Unclassified 1682
310 Ga0496112_0477563 3300048915 Bacteria 1183
311 Ga0496112_0482317 3300048915 Bacteria 1176
312 Ga0496112_1394243 3300048915 Unclassified 615
313 Ga0496113_0031676 3300048916 Bacteria 3839
314 Ga0496113_0396981 3300048916 Unclassified 1107
315 Ga0496113_1337127 3300048916 Bacteria 556
316 Ga0496114_0025518 3300048917 Bacteria 4830
317 Ga0496114_0055071 3300048917 Bacteria 3317
318 Ga0496114_0077625 3300048917 Bacteria 2800
319 Ga0496114_0317346 3300048917 Unclassified 1377
320 Ga0496114_0390654 3300048917 Unclassified 1232
321 Ga0496115_0042147 3300048918 Bacteria 3636
322 Ga0496115_0083005 3300048918 Bacteria 2611
323 Ga0501039_0481251 3300049575 Bacteria 975
324 Ga0501041_0055489 3300049577 Bacteria 2419
325 Ga0501067_0017063 3300049583 Bacteria 4012
326 Ga0501067_0022384 3300049583 Bacteria 3498
327 Ga0501067_0022482 3300049583 Bacteria 3490
328 Ga0501067_0047083 3300049583 Bacteria 2393
329 Ga0501067_0179805 3300049583 Bacteria 1178
330 Ga0501067_0307400 3300049583 Unclassified 883
331 Ga0501067_0337932 3300049583 Bacteria 839
332 Ga0501068_0000010 3300049584 Bacteria 66003
333 Ga0501069_0000548 3300049585 Bacteria 17217
334 Ga0501069_0240504 3300049585 Bacteria 1055
335 Ga0501070_0053220 3300049586 Bacteria 3359
336 Ga0501071_0013167 3300049587 Bacteria 5631
337 Ga0501075_0095749 3300049591 Bacteria 2253
338 Ga0501075_0907226 3300049591 Bacteria 670
339 Ga0501077_0776923 3300049593 Bacteria 616
340 Ga0501079_0407459 3300049741 Bacteria 1067
341 nmdc:mga0yw44_919560_c1 3300050492 Bacteria 593
342 nmdc:mga0yw44_959911_c1 3300050492 Bacteria 579
343 nmdc:mga05p37_341471_c1 3300050507 Bacteria 1766
344 nmdc:mga09592_791442_c1 3300050508 Bacteria 803
345 nmdc:mga0qj67_66404_c1 3300050509 Bacteria 2873
346 nmdc:mga06r32_106255_c1 3300050510 Bacteria 2758
347 nmdc:mga06r32_258516_c1 3300050510 Bacteria 1729
348 nmdc:mga08y16_345591_c1 3300050511 Unclassified 1529
349 nmdc:mga0n895_1108491_c1 3300050512 Bacteria 769
350 nmdc:mga0n895_983861_c1 3300050512 Bacteria 826
351 nmdc:mga0rr50_137286_c1 3300050513 Bacteria 1964
352 nmdc:mga08x19_718284_c1 3300050514 Bacteria 709
353 nmdc:mga0a205_20633_c1 3300050515 Bacteria 6222
354 nmdc:mga0a205_346256_c1 3300050515 Bacteria 1354
355 Ga0501084_1397617 3300054114 Bacteria 586
356 Ga0530510_0040563 3300061734 Bacteria 3360
357 Ga0105241_11453910
358 JGI25406J46586_10003837
359 Ga0070683_100230271
360 Ga0070690_100064851
361 Ga0068869_100506804
362 Ga0070666_11054571
363 Ga0070680_100116802
364 Ga0070682_100002294
365 Ga0068868_100115562
366 Ga0068868_100147043
367 Ga0068868_100245139
368 Ga0070687_100262388
369 Ga0070668_100322668
370 Ga0070668_100405924
371 Ga0070669_101231556
372 Ga0070671_100462690
373 Ga0070673_100756523
374 Ga0070659_100491961
375 Ga0070709_10245245
376 Ga0070713_100196788
377 Ga0070710_10068562
378 Ga0070705_100824819
379 Ga0070705_100828136
380 Ga0070694_100743021
381 Ga0070708_100259798
382 Ga0070708_101045078
383 Ga0070678_100126298
384 Ga0070662_100019350
385 Ga0070662_100083334
386 Ga0070681_10328523
387 Ga0068867_100030029
388 Ga0070685_10837091
389 Ga0070706_100041574
390 Ga0070706_101468035
391 Ga0070707_100024825
392 Ga0070698_100001311
393 Ga0070699_100014443
394 Ga0070699_100039845
395 Ga0070697_100230932
396 Ga0070697_100466105
397 Ga0070697_100601723
398 Ga0070686_100015577
399 Ga0070686_100170065
400 Ga0070695_100286860
401 Ga0070696_100006125
402 Ga0070696_100047536
403 Ga0070693_100036122
404 Ga0070693_100167898
405 Ga0068855_100261144
406 Ga0068855_100373144
407 Ga0068854_100096921
408 Ga0068856_100119150
409 Ga0068856_100447871
410 Ga0068856_101037690
411 Ga0070702_100271947
412 Ga0068861_100000835
413 Ga0068870_10203041
414 Ga0068863_100391036
415 Ga0068858_101795071
416 Ga0068860_100575461
417 Ga0068862_100084210
418 Ga0068862_100213376
419 Ga0081455_10004035
420 Ga0081455_10010109
421 Ga0081455_10027440
422 Ga0081455_10028291
423 Ga0081538_10000278
424 Ga0081540_1005672
425 Ga0081540_1245365
426 Ga0081539_10001821
427 Ga0081539_10002503
428 Ga0081539_10003845
429 Ga0075365_11065778
430 Ga0070715_10150589
431 Ga0070716_100757482
432 Ga0097621_100022471
433 Ga0097621_100701799
434 Ga0068871_101007213
435 Ga0068871_101200289
436 Ga0075428_100017878
437 Ga0075428_100149521
438 Ga0075428_100438642
439 Ga0075430_100395643
440 Ga0075431_100123981
441 Ga0075431_100215123
442 Ga0075434_100111842
443 Ga0075434_100248386
444 Ga0075429_100045632
445 Ga0075436_100104211
446 Ga0075435_100005773
447 Ga0075435_100136150
448 Ga0111539_10611881
449 Ga0111539_11848633
450 Ga0105245_10016574
451 Ga0105245_10047430
452 Ga0105245_10088607
453 Ga0105245_10105169
454 Ga0105245_10509815
455 Ga0105245_10596026
456 Ga0105245_11548112
457 Ga0114129_10128770
458 Ga0105243_11471025
459 Ga0105243_12920397
460 Ga0105241_10012195
461 Ga0105242_10098524
462 Ga0105242_11064345
463 Ga0105242_11758163
464 Ga0105248_10271540
465 Ga0105248_10300315
466 Ga0105248_10859562
467 Ga0105249_10115521
468 Ga0105249_10152982
469 Ga0105249_10191255
470 Ga0105239_10089058
471 Ga0105239_10196978
472 Ga0105239_10365301
473 Ga0105246_10031456
474 Ga0105246_10524429
475 Ga0157343_1001583
476 Ga0157373_10161520
477 Ga0157374_10771658
478 Ga0157374_11373169
479 Ga0157378_10353940
480 Ga0163162_10515842
481 Ga0163162_10689816
482 Ga0163162_12158935
483 Ga0157372_10052784
484 Ga0157372_10231598
485 Ga0157375_10070990
486 Ga0163163_10429431
487 Ga0163163_12081266
488 Ga0157380_11111164
489 Ga0182008_10117732
490 Ga0182008_10205347
491 Ga0157377_10747180
492 Ga0157377_11460436
493 Ga0163161_10081775
494 Ga0163161_10148958
495 Ga0207692_10059031
496 Ga0207680_10420728
497 Ga0207680_10439782
498 Ga0207699_10208719
499 Ga0207684_10448714
500 Ga0207695_10570103
501 Ga0207693_10042493
502 Ga0207693_10147661
503 Ga0207663_10004992
504 Ga0207660_10051223
505 Ga0207660_10795979
506 Ga0207662_10647735
507 Ga0207652_11386115
508 Ga0207646_10023049
509 Ga0207687_10082954
510 Ga0207687_10232466
511 Ga0207687_10461658
512 Ga0207687_10582998
513 Ga0207700_10124729
514 Ga0207664_10286206
515 Ga0207664_11069094
516 Ga0207644_10989741
517 Ga0207690_10581186
518 Ga0207706_10025900
519 Ga0207706_10064101
520 Ga0207686_10535247
521 Ga0207709_10138782
522 Ga0207709_10196599
523 Ga0207709_10759194
524 Ga0207704_10617996
525 Ga0207665_10002419
526 Ga0207665_10875616
527 Ga0207691_10511111
528 Ga0207711_10267040
529 Ga0207711_11338606
530 Ga0207667_10425784
531 Ga0207651_10218549
532 Ga0207651_10966215
533 Ga0207712_10529602
534 Ga0207712_10719022
535 Ga0207712_11758547
536 Ga0207668_10037468
537 Ga0207668_11912306
538 Ga0207640_10483431
539 Ga0207640_10713394
540 Ga0207677_10031810
541 Ga0207677_10195731
542 Ga0207677_10442207
543 Ga0207677_10511015
544 Ga0207708_10303489
545 Ga0207708_10941202
546 Ga0207702_11281096
547 Ga0207648_10033192
548 Ga0207648_11756927
549 Ga0207675_100000592
550 Ga0207683_10001522
551 Ga0207683_10331048
552 Ga0209966_1017706
553 Ga0209998_10078696
554 Ga0207428_10592690
555 Ga0268265_11185611
556 Ga0307416_100610338
557 Ga0373948_0183880
558 Ga0373950_0141685
559 Ga0373959_0204875
560 Ga0373928_0002079
561 Ga0373929_0088994
562 Ga0373949_0037982
563 Ga0373952_0125452
564 Ga0373932_0284535
565 Ga0373939_0032961
566 Ga0373941_0138471
567 Ga0373960_0053408
568 Ga0373942_0019969
569 Ga0373961_0003625
570 Ga0373931_0006346
571 Ga0395899_0021149
572 Ga0395899_0068713
573 Ga0395899_0124671
574 Ga0395899_0305074
575 Ga0395899_0334920
576 Ga0395899_0498384
577 Ga0395900_0006105
578 Ga0395900_0023403
579 Ga0395900_0110917
580 Ga0395900_0132844
581 Ga0395900_0139786
582 Ga0395900_0218667
583 Ga0395900_0258427
584 Ga0395900_0671933
585 Ga0395898_0001382
586 Ga0395898_0036772
587 Ga0395898_0051250
588 Ga0395898_0051309
589 Ga0395898_0101330
590 Ga0395898_0141952
591 Ga0395898_0167150
592 Ga0395898_0281820
593 Ga0395898_0894338
594 Ga0395905_0169408
595 Ga0395905_0170698
596 Ga0395905_0175316
597 Ga0395905_0185261
598 Ga0395905_0247348
599 Ga0395905_0287076
600 Ga0395905_0643626
601 Ga0395901_0011768
602 Ga0395901_0041759
603 Ga0395901_0147719
604 Ga0395901_0169985
605 Ga0395901_0437318
606 Ga0395901_0591721
607 Ga0395901_1125159
608 Ga0395901_1682184
609 Ga0451807_1322138
610 Ga0451839_0312314
611 Ga0451839_1310097
612 Ga0439450_057762
613 Ga0466964_0476251
614 Ga0466968_0310804
615 Ga0466960_0091392
616 Ga0466960_0293129
617 Ga0466967_0506131
618 Ga0466967_1763961
619 Ga0495603_0059593
620 Ga0495584_0311189
621 Ga0495656_0394613
622 Ga0495656_0628737
623 Ga0495668_0202158
624 Ga0495670_0180100
625 Ga0496100_0031012
626 Ga0496100_0100028
627 Ga0496100_0162163
628 Ga0496100_0351657
629 Ga0496100_0529370
630 Ga0496101_0152021
631 Ga0496101_0322489
632 Ga0496102_0202223
633 Ga0496103_0007519
634 Ga0496103_0406202
635 Ga0496104_0023723
636 Ga0496104_0028807
637 Ga0496104_0196603
638 Ga0496104_0584173
639 Ga0496105_0024431
640 Ga0496105_0083257
641 Ga0496106_0087304
642 Ga0496106_0109805
643 Ga0496107_0075295
644 Ga0496107_0368441
645 Ga0496107_0920389
646 Ga0496108_0036523
647 Ga0496108_0036601
648 Ga0496108_0038365
649 Ga0496108_1061862
650 Ga0496109_0052005
651 Ga0496109_0077053
652 Ga0496109_0169689
653 Ga0496109_0290952
654 Ga0496109_0783683
655 Ga0496110_0017664
656 Ga0496110_0044148
657 Ga0496110_0311994
658 Ga0496110_0678473
659 Ga0496110_0866197
660 Ga0496111_0001708
661 Ga0496111_0005493
662 Ga0496111_0032186
663 Ga0496111_0733434
664 Ga0496112_0010678
665 Ga0496112_0260879
666 Ga0496112_0477563
667 Ga0496112_0482317
668 Ga0496112_1394243
669 Ga0496113_0031676
670 Ga0496113_0396981
671 Ga0496113_1337127
672 Ga0496114_0025518
673 Ga0496114_0055071
674 Ga0496114_0077625
675 Ga0496114_0317346
676 Ga0496114_0390654
677 Ga0496115_0042147
678 Ga0496115_0083005
679 Ga0501039_0481251
680 Ga0501041_0055489
681 Ga0501067_0017063
682 Ga0501067_0022384
683 Ga0501067_0022482
684 Ga0501067_0047083
685 Ga0501067_0179805
686 Ga0501067_0307400
687 Ga0501067_0337932
688 Ga0501068_0000010
689 Ga0501069_0000548
690 Ga0501069_0240504
691 Ga0501070_0053220
692 Ga0501071_0013167
693 Ga0501075_0095749
694 Ga0501075_0907226
695 Ga0501077_0776923
696 Ga0501079_0407459
697 nmdc:mga0yw44_919560_c1
698 nmdc:mga0yw44_959911_c1
699 nmdc:mga05p37_341471_c1
700 nmdc:mga09592_791442_c1
701 nmdc:mga0qj67_66404_c1
702 nmdc:mga06r32_106255_c1
703 nmdc:mga06r32_258516_c1
704 nmdc:mga08y16_345591_c1
705 nmdc:mga0n895_1108491_c1
706 nmdc:mga0n895_983861_c1
707 nmdc:mga0rr50_137286_c1
708 nmdc:mga08x19_718284_c1
709 nmdc:mga0a205_20633_c1
710 nmdc:mga0a205_346256_c1
711 Ga0501084_1397617
712 Ga0530510_0040563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03779

SPW

SPW repeat

34

137

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fig-assembly2.cif.gz_E-2 apo-csp3 (copper storage protein 3) from bacillus subtilis 0.5324 10 110
6qvh-assembly1.cif.gz_A streptomyces lividans ccsp mutant - h113a 0.5308 10 111
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.5199 10 112
5fig-assembly2.cif.gz_E-2 apo-csp3 (copper storage protein 3) from bacillus subtilis 0.5095 10 110
6q6b-assembly1.cif.gz_A structure of the copper storage protein, ccsp, from streptomyces lividans loaded with 10 copper equivalents 0.4864 2 111
ID Description Score Start End Superfamily
af_C7G056_1_101_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7132 10 111 1.10.10.1740
af_B4FD53_81_205_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6953 2 111 1.10.10.1740
af_I1N8W8_92_215_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6812 10 111 1.10.10.1740
af_C7G056_1_101_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.673 10 111 1.10.10.1740
af_Q93V66_87_209_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6503 10 111 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A6J4TYS3-F1-model_v4 Uncharacterized protein 0.9162 12 114
AF-A0A6J4TYS3-F1-model_v4 Uncharacterized protein 0.8839 12 114
AF-A0A7V9JDE0-F1-model_v4 SPW repeat-containing protein 0.8793 9 116 GO:0016020
AF-A0A1M5D6E0-F1-model_v4 SPW repeat-containing protein 0.8462 9 111 GO:0016020
AF-A0A4Z0MP20-F1-model_v4 FUSC family protein 0.8387 6 111 GO:0016020

Map