F420450

General Info

Members Datasets Scaffolds Average Seq Length
356 188 712 133

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10051754|Ga0081538_100517543
Length 123
Sequence MSQYMLLVYQQEVDPAEQAEREAELPMLLEFHRSLREAGLLVGVGRLRSSITDGPFAVTKEVLVGYYLLECPDLDEALKQAARFPDAHHGTVEVRPVMPPDEWVNRARDAGADLPDEAVKDLA

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
124 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
127 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
128 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
129 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
130 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
131 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 7.58
Rhizosphere 91.85
Stem 0
Stem Tuber 0
Unclassified 3.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10051754 3300005981 Bacteria 2462
2 JGI25407J50210_10037160 3300003373 Bacteria 1252
3 Ga0070658_11160689 3300005327 Bacteria 672
4 Ga0070676_10080508 3300005328 Bacteria 1975
5 Ga0070676_10932852 3300005328 Bacteria 648
6 Ga0070683_100672391 3300005329 Bacteria 991
7 Ga0070683_100890440 3300005329 Bacteria 854
8 Ga0068869_100360743 3300005334 Bacteria 1187
9 Ga0070682_100325107 3300005337 Bacteria 1137
10 Ga0068868_100631500 3300005338 Bacteria 952
11 Ga0070687_101019747 3300005343 Bacteria 601
12 Ga0070687_101361110 3300005343 Unclassified 529
13 Ga0070661_100023936 3300005344 Bacteria 4381
14 Ga0070661_100458661 3300005344 Bacteria 1015
15 Ga0070661_100568861 3300005344 Bacteria 914
16 Ga0070692_10061652 3300005345 Bacteria 1978
17 Ga0070692_10170847 3300005345 Bacteria 1253
18 Ga0070692_10639525 3300005345 Bacteria 709
19 Ga0070668_100448318 3300005347 Bacteria 1109
20 Ga0070673_100159831 3300005364 Bacteria 1915
21 Ga0070673_101465459 3300005364 Bacteria 643
22 Ga0070688_101473862 3300005365 Bacteria 553
23 Ga0070659_100112825 3300005366 Bacteria 2195
24 Ga0070659_100388866 3300005366 Bacteria 1176
25 Ga0070701_10428340 3300005438 Bacteria 844
26 Ga0070700_100720601 3300005441 Bacteria 795
27 Ga0070708_101775476 3300005445 Unclassified 573
28 Ga0070663_100678104 3300005455 Bacteria 874
29 Ga0070663_100870268 3300005455 Bacteria 777
30 Ga0070663_102140189 3300005455 Bacteria 504
31 Ga0070678_100651375 3300005456 Bacteria 945
32 Ga0070678_100711732 3300005456 Bacteria 905
33 Ga0070662_100674936 3300005457 Bacteria 873
34 Ga0070662_101158561 3300005457 Bacteria 664
35 Ga0070662_101775908 3300005457 Bacteria 533
36 Ga0068867_100215749 3300005459 Bacteria 1543
37 Ga0068867_100475935 3300005459 Bacteria 1069
38 Ga0068867_101207158 3300005459 Bacteria 695
39 Ga0070706_100441900 3300005467 Bacteria 1211
40 Ga0070706_100934608 3300005467 Unclassified 801
41 Ga0070707_100485497 3300005468 Bacteria 1197
42 Ga0070699_100693042 3300005518 Bacteria 931
43 Ga0070679_100536212 3300005530 Bacteria 1114
44 Ga0070684_100010776 3300005535 Bacteria 7258
45 Ga0070697_101555242 3300005536 Archaea 591
46 Ga0070672_101130204 3300005543 Bacteria 697
47 Ga0070672_101524033 3300005543 Bacteria 599
48 Ga0070686_101873390 3300005544 Bacteria 511
49 Ga0070665_100762974 3300005548 Bacteria 980
50 Ga0070665_101570976 3300005548 Bacteria 666
51 Ga0070664_100141979 3300005564 Bacteria 2115
52 Ga0070664_100860645 3300005564 Bacteria 849
53 Ga0070664_100957031 3300005564 Bacteria 804
54 Ga0070664_100998739 3300005564 Bacteria 786
55 Ga0070664_101128628 3300005564 Bacteria 739
56 Ga0068857_100330701 3300005577 Bacteria 1408
57 Ga0068857_101204732 3300005577 Bacteria 733
58 Ga0068854_100706463 3300005578 Bacteria 871
59 Ga0068856_100533505 3300005614 Bacteria 1195
60 Ga0068856_101101590 3300005614 Bacteria 811
61 Ga0068852_100841916 3300005616 Bacteria 933
62 Ga0068864_100727713 3300005618 Bacteria 971
63 Ga0068866_11433909 3300005718 Bacteria 506
64 Ga0068861_101273649 3300005719 Bacteria 714
65 Ga0068851_10400135 3300005834 Bacteria 808
66 Ga0068870_10070038 3300005840 Bacteria 1910
67 Ga0081455_10055437 3300005937 Bacteria 3371
68 Ga0081455_10356079 3300005937 Bacteria 1031
69 Ga0081538_10000132 3300005981 Bacteria 77110
70 Ga0081538_10003548 3300005981 Bacteria 14671
71 Ga0081538_10005047 3300005981 Bacteria 12010
72 Ga0081538_10005189 3300005981 Bacteria 11788
73 Ga0081538_10010378 3300005981 Bacteria 7637
74 Ga0081538_10013807 3300005981 Bacteria 6374
75 Ga0081538_10015522 3300005981 Bacteria 5889
76 Ga0081538_10048072 3300005981 Bacteria 2608
77 Ga0081538_10049059 3300005981 Bacteria 2565
78 Ga0081538_10101195 3300005981 Bacteria 1451
79 Ga0081538_10142903 3300005981 Bacteria 1099
80 Ga0081538_10152428 3300005981 Bacteria 1044
81 Ga0081540_1011815 3300005983 Bacteria 5803
82 Ga0081539_10000489 3300005985 Bacteria 83671
83 Ga0081539_10006989 3300005985 Bacteria 10483
84 Ga0070715_10095581 3300006163 Bacteria 1376
85 Ga0070716_100747757 3300006173 Bacteria 752
86 Ga0068871_100634224 3300006358 Unclassified 974
87 Ga0075428_100560979 3300006844 Bacteria 1221
88 Ga0075428_101563068 3300006844 Bacteria 690
89 Ga0075430_100497592 3300006846 Bacteria 1006
90 Ga0075430_100629437 3300006846 Bacteria 885
91 Ga0075431_100117856 3300006847 Bacteria 2740
92 Ga0075431_100333703 3300006847 Bacteria 1527
93 Ga0075433_10311284 3300006852 Bacteria 1394
94 Ga0075434_100668024 3300006871 Bacteria 1057
95 Ga0075429_100870737 3300006880 Bacteria 788
96 Ga0068865_101174074 3300006881 Bacteria 679
97 Ga0111539_10020931 3300009094 Bacteria 8054
98 Ga0111539_10405359 3300009094 Bacteria 1588
99 Ga0111539_10869425 3300009094 Bacteria 1049
100 Ga0111539_10935374 3300009094 Bacteria 1008
101 Ga0111539_11348910 3300009094 Bacteria 828
102 Ga0105245_10302664 3300009098 Bacteria 1569
103 Ga0105245_10546260 3300009098 Bacteria 1180
104 Ga0105245_10577136 3300009098 Bacteria 1149
105 Ga0105245_10712276 3300009098 Bacteria 1038
106 Ga0105245_10725397 3300009098 Bacteria 1028
107 Ga0114129_10140653 3300009147 Bacteria 3309
108 Ga0114129_11690651 3300009147 Unclassified 772
109 Ga0105237_10027719 3300009545 Bacteria 5776
110 Ga0105237_12302846 3300009545 Bacteria 548
111 Ga0105238_10304030 3300009551 Bacteria 1579
112 Ga0105249_10632614 3300009553 Bacteria 1127
113 Ga0105249_10944111 3300009553 Bacteria 930
114 Ga0105239_11742534 3300010375 Bacteria 721
115 Ga0105239_11775048 3300010375 Bacteria 715
116 Ga0105239_12291294 3300010375 Bacteria 628
117 Ga0105246_11048940 3300011119 Bacteria 741
118 Ga0157371_11242713 3300013102 Bacteria 575
119 Ga0157369_10118823 3300013105 Bacteria 2806
120 Ga0157369_10676422 3300013105 Unclassified 1063
121 Ga0157374_10282360 3300013296 Bacteria 1639
122 Ga0163162_10967968 3300013306 Bacteria 961
123 Ga0157372_10742721 3300013307 Bacteria 1141
124 Ga0157375_10924355 3300013308 Bacteria 1015
125 Ga0157375_11642736 3300013308 Bacteria 760
126 Ga0163163_11324818 3300014325 Unclassified 782
127 Ga0182008_10037493 3300014497 Bacteria 2425
128 Ga0157379_11082226 3300014968 Bacteria 767
129 Ga0206353_11578226 3300020082 Bacteria 2519
130 Ga0207426_1029145 3300025302 Bacteria 1824
131 Ga0207642_10091739 3300025899 Bacteria 1502
132 Ga0207685_10020680 3300025905 Bacteria 2192
133 Ga0207643_10216601 3300025908 Bacteria 1170
134 Ga0207643_10308774 3300025908 Bacteria 986
135 Ga0207693_10179875 3300025915 Bacteria 1664
136 Ga0207660_10261045 3300025917 Bacteria 1370
137 Ga0207657_10045274 3300025919 Bacteria 3863
138 Ga0207657_10334125 3300025919 Bacteria 1196
139 Ga0207649_11237488 3300025920 Bacteria 590
140 Ga0207646_10469546 3300025922 Bacteria 1135
141 Ga0207687_10255625 3300025927 Bacteria 1395
142 Ga0207687_10381270 3300025927 Bacteria 1155
143 Ga0207687_10608941 3300025927 Bacteria 921
144 Ga0207664_11043541 3300025929 Unclassified 732
145 Ga0207690_10449177 3300025932 Bacteria 1036
146 Ga0207690_11740085 3300025932 Bacteria 521
147 Ga0207706_10240361 3300025933 Bacteria 1583
148 Ga0207706_10565036 3300025933 Bacteria 979
149 Ga0207709_10289507 3300025935 Bacteria 1213
150 Ga0207669_11054859 3300025937 Bacteria 685
151 Ga0207704_10257801 3300025938 Bacteria 1313
152 Ga0207691_10141439 3300025940 Bacteria 2120
153 Ga0207691_11257894 3300025940 Bacteria 612
154 Ga0207661_10156963 3300025944 Bacteria 1971
155 Ga0207661_10227996 3300025944 Bacteria 1649
156 Ga0207661_10471017 3300025944 Bacteria 1146
157 Ga0207661_10892426 3300025944 Bacteria 819
158 Ga0207679_10203481 3300025945 Bacteria 1655
159 Ga0207679_10981434 3300025945 Bacteria 774
160 Ga0207679_11750223 3300025945 Bacteria 568
161 Ga0207668_11253929 3300025972 Bacteria 667
162 Ga0207640_10615074 3300025981 Bacteria 921
163 Ga0207677_10558075 3300026023 Bacteria 999
164 Ga0207677_11677913 3300026023 Bacteria 589
165 Ga0207703_10235002 3300026035 Bacteria 1645
166 Ga0207639_10141501 3300026041 Bacteria 2005
167 Ga0207639_10383084 3300026041 Bacteria 1263
168 Ga0207678_10491466 3300026067 Bacteria 1069
169 Ga0207678_10710290 3300026067 Bacteria 885
170 Ga0207678_10905544 3300026067 Bacteria 780
171 Ga0207678_11118094 3300026067 Bacteria 698
172 Ga0207708_11125158 3300026075 Bacteria 685
173 Ga0207648_10204383 3300026089 Bacteria 1753
174 Ga0207648_10606862 3300026089 Bacteria 1009
175 Ga0207676_10593867 3300026095 Bacteria 1063
176 Ga0207674_10086634 3300026116 Bacteria 3126
177 Ga0207674_10196055 3300026116 Bacteria 1969
178 Ga0207674_10848636 3300026116 Bacteria 881
179 Ga0207675_100160898 3300026118 Bacteria 2141
180 Ga0207675_101005344 3300026118 Bacteria 852
181 Ga0207675_101991037 3300026118 Bacteria 598
182 Ga0207683_10334060 3300026121 Bacteria 1389
183 Ga0207683_10382002 3300026121 Bacteria 1295
184 Ga0207683_10607291 3300026121 Bacteria 1013
185 Ga0207428_10222386 3300027907 Bacteria 1415
186 Ga0207428_10710851 3300027907 Bacteria 718
187 Ga0268266_10971937 3300028379 Bacteria 822
188 Ga0307405_10053318 3300031731 Bacteria 2519
189 Ga0307405_11088834 3300031731 Bacteria 686
190 Ga0307405_11546204 3300031731 Bacteria 584
191 Ga0307405_11953311 3300031731 Bacteria 524
192 Ga0307413_10154553 3300031824 Bacteria 1603
193 Ga0307413_11001331 3300031824 Bacteria 716
194 Ga0307410_10071250 3300031852 Bacteria 2410
195 Ga0307410_10094471 3300031852 Bacteria 2130
196 Ga0307410_10145243 3300031852 Bacteria 1760
197 Ga0307410_10473120 3300031852 Bacteria 1026
198 Ga0307410_11232056 3300031852 Bacteria 653
199 Ga0307406_10044363 3300031901 Bacteria 2786
200 Ga0307406_10289271 3300031901 Bacteria 1254
201 Ga0307406_10691382 3300031901 Bacteria 851
202 Ga0307406_10804684 3300031901 Bacteria 793
203 Ga0307407_10038090 3300031903 Bacteria 2662
204 Ga0307407_10137799 3300031903 Bacteria 1570
205 Ga0307407_10140456 3300031903 Bacteria 1558
206 Ga0307412_10070438 3300031911 Bacteria 2384
207 Ga0307412_10631906 3300031911 Bacteria 911
208 Ga0307412_10843609 3300031911 Bacteria 799
209 Ga0307409_100001536 3300031995 Bacteria 11455
210 Ga0307409_100155444 3300031995 Bacteria 1992
211 Ga0307409_100167546 3300031995 Bacteria 1930
212 Ga0307409_100185669 3300031995 Bacteria 1845
213 Ga0307409_100414059 3300031995 Bacteria 1291
214 Ga0307409_100468465 3300031995 Bacteria 1220
215 Ga0307409_100699238 3300031995 Bacteria 1013
216 Ga0307409_100728666 3300031995 Bacteria 993
217 Ga0307416_100000259 3300032002 Bacteria 28147
218 Ga0307416_100012854 3300032002 Bacteria 5663
219 Ga0307416_100042658 3300032002 Bacteria 3544
220 Ga0307416_100225401 3300032002 Bacteria 1802
221 Ga0307416_100985047 3300032002 Bacteria 946
222 Ga0307416_101486034 3300032002 Bacteria 783
223 Ga0307414_10171071 3300032004 Bacteria 1737
224 Ga0307414_10316392 3300032004 Bacteria 1327
225 Ga0307411_10060562 3300032005 Bacteria 2515
226 Ga0307415_100000015 3300032126 Bacteria 79927
227 Ga0307415_100026027 3300032126 Bacteria 3683
228 Ga0307415_100266197 3300032126 Bacteria 1401
229 Ga0307415_100424575 3300032126 Bacteria 1142
230 Ga0307415_100516456 3300032126 Bacteria 1047
231 Ga0307415_100691187 3300032126 Bacteria 919
232 Ga0307415_101114215 3300032126 Bacteria 740
233 Ga0373935_1278391 3300035692 Bacteria 548
234 Ga0395900_0012854 3300037418 Bacteria 8554
235 Ga0395900_0230793 3300037418 Bacteria 1861
236 Ga0395900_1528219 3300037418 Unclassified 579
237 Ga0395898_0030097 3300037466 Bacteria 5435
238 Ga0395898_0260625 3300037466 Bacteria 1653
239 Ga0395898_1143363 3300037466 Bacteria 711
240 Ga0395905_0070733 3300037471 Bacteria 3270
241 Ga0395905_0388002 3300037471 Bacteria 1291
242 Ga0395901_0031268 3300038443 Bacteria 5488
243 Ga0395901_0061597 3300038443 Bacteria 3904
244 Ga0395901_0144972 3300038443 Bacteria 2496
245 Ga0395901_0158743 3300038443 Bacteria 2375
246 Ga0395901_0320546 3300038443 Bacteria 1604
247 Ga0395901_0507172 3300038443 Bacteria 1227
248 Ga0395901_0758854 3300038443 Unclassified 962
249 Ga0395901_0858832 3300038443 Bacteria 892
250 Ga0395901_0934832 3300038443 Bacteria 847
251 Ga0436362_0860690 3300039453 Unclassified 808
252 Ga0439453_0084240 3300041408 Bacteria 690
253 Ga0451797_0621960 3300041453 Bacteria 559
254 Ga0451853_0992257 3300041512 Bacteria 878
255 Ga0439448_0059575 3300042005 Bacteria 1260
256 Ga0439450_031165 3300042008 Bacteria 1200
257 Ga0439455_0009140 3300042012 Bacteria 2143
258 Ga0439463_017503 3300042016 Bacteria 1777
259 Ga0439463_082573 3300042016 Bacteria 827
260 Ga0439458_0037320 3300042157 Bacteria 1171
261 Ga0439464_0045635 3300042439 Bacteria 1258
262 Ga0466967_0616637 3300045976 Bacteria 1071
263 Ga0495603_0070763 3300046455 Bacteria 2050
264 Ga0495582_0476590 3300046473 Bacteria 721
265 Ga0495584_0570269 3300046491 Bacteria 577
266 Ga0495596_0049310 3300046500 Bacteria 1651
267 Ga0495631_0241884 3300046518 Unclassified 770
268 Ga0495656_0815003 3300046615 Bacteria 505
269 Ga0495671_0187047 3300046692 Bacteria 1006
270 Ga0496100_0543003 3300048903 Bacteria 899
271 Ga0496100_0680831 3300048903 Bacteria 802
272 Ga0496101_0216115 3300048904 Bacteria 1487
273 Ga0496102_0099314 3300048905 Bacteria 2702
274 Ga0496104_1156245 3300048907 Bacteria 677
275 Ga0496105_0100954 3300048908 Bacteria 2383
276 Ga0496106_0028053 3300048909 Bacteria 4192
277 Ga0496106_0508015 3300048909 Bacteria 968
278 Ga0496107_0140733 3300048910 Bacteria 1783
279 Ga0496108_0048842 3300048911 Bacteria 3539
280 Ga0496108_0295959 3300048911 Bacteria 1409
281 Ga0496109_0056150 3300048912 Bacteria 3593
282 Ga0496109_0121229 3300048912 Bacteria 2437
283 Ga0496109_1431369 3300048912 Bacteria 626
284 Ga0496110_0780394 3300048913 Bacteria 859
285 Ga0496111_0041574 3300048914 Bacteria 3299
286 Ga0496111_0522542 3300048914 Bacteria 873
287 Ga0496111_0536088 3300048914 Bacteria 860
288 Ga0496112_0186591 3300048915 Bacteria 2037
289 Ga0496112_0601709 3300048915 Bacteria 1031
290 Ga0496112_0725937 3300048915 Bacteria 921
291 Ga0496113_0132854 3300048916 Bacteria 1954
292 Ga0496113_0471034 3300048916 Bacteria 1009
293 Ga0496113_0761354 3300048916 Bacteria 771
294 Ga0496115_0235415 3300048918 Bacteria 1510
295 Ga0496115_0283919 3300048918 Bacteria 1359
296 Ga0501031_0496285 3300049568 Bacteria 787
297 Ga0501032_0803039 3300049569 Bacteria 594
298 Ga0501033_0178561 3300049570 Bacteria 1523
299 Ga0501036_0088452 3300049572 Bacteria 2618
300 Ga0501036_0373876 3300049572 Bacteria 1190
301 Ga0501038_0216311 3300049574 Bacteria 1531
302 Ga0501038_0615379 3300049574 Bacteria 820
303 Ga0501038_0891922 3300049574 Bacteria 657
304 Ga0501039_0013323 3300049575 Bacteria 6286
305 Ga0501039_0068496 3300049575 Bacteria 2755
306 Ga0501039_1263892 3300049575 Bacteria 570
307 Ga0501040_0063368 3300049576 Bacteria 2544
308 Ga0501040_0091221 3300049576 Bacteria 2118
309 Ga0501040_0374037 3300049576 Bacteria 1022
310 Ga0501041_0070000 3300049577 Bacteria 2153
311 Ga0501041_0727212 3300049577 Bacteria 636
312 Ga0501042_0034916 3300049578 Bacteria 3567
313 Ga0501042_0104852 3300049578 Bacteria 2034
314 Ga0501043_0538007 3300049579 Bacteria 869
315 Ga0501048_0068821 3300049582 Bacteria 2500
316 Ga0501048_0395497 3300049582 Bacteria 987
317 Ga0501067_0167643 3300049583 Bacteria 1223
318 Ga0501067_0784231 3300049583 Bacteria 537
319 Ga0501068_0128616 3300049584 Bacteria 1583
320 Ga0501071_0142314 3300049587 Bacteria 1786
321 Ga0501071_0332736 3300049587 Bacteria 1154
322 Ga0501072_0039064 3300049588 Bacteria 3727
323 Ga0501072_0343466 3300049588 Bacteria 1185
324 Ga0501074_0049346 3300049590 Bacteria 3039
325 Ga0501075_0090648 3300049591 Bacteria 2319
326 Ga0501075_0176251 3300049591 Bacteria 1631
327 Ga0501076_0074763 3300049592 Bacteria 2715
328 Ga0501076_0197504 3300049592 Bacteria 1642
329 Ga0501076_0506589 3300049592 Bacteria 995
330 Ga0501077_0050427 3300049593 Bacteria 2646
331 Ga0501079_0086559 3300049741 Bacteria 2425
332 Ga0501080_1619004 3300049742 Bacteria 548
333 Ga0501081_0026600 3300049743 Bacteria 3902
334 Ga0501081_0032244 3300049743 Bacteria 3554
335 Ga0501045_0028284 3300049824 Bacteria 4043
336 Ga0501045_0067616 3300049824 Bacteria 2624
337 nmdc:mga05p37_1455645_c1 3300050507 Unclassified 685
338 nmdc:mga05p37_229199_c1 3300050507 Bacteria 2239
339 nmdc:mga09592_169954_c1 3300050508 Bacteria 1885
340 nmdc:mga0qj67_657019_c1 3300050509 Bacteria 836
341 nmdc:mga06r32_668900_c1 3300050510 Bacteria 1005
342 nmdc:mga06r32_911007_c1 3300050510 Bacteria 835
343 nmdc:mga08y16_1166505_c1 3300050511 Bacteria 742
344 nmdc:mga08y16_18315_c1 3300050511 Bacteria 7378
345 nmdc:mga08y16_644330_c1 3300050511 Bacteria 1064
346 nmdc:mga0a205_195549_c1 3300050515 Bacteria 1913
347 nmdc:mga0a205_779830_c1 3300050515 Bacteria 804
348 Ga0495655_0049249 3300053083 Bacteria 1109
349 Ga0495655_0097524 3300053083 Bacteria 866
350 Ga0495619_0652354 3300053085 Bacteria 718
351 Ga0501084_0111544 3300054114 Bacteria 2298
352 Ga0590075_184963 3300059424 Unclassified 551
353 Ga0501082_0038558 3300060353 Bacteria 4123
354 Ga0501082_0064181 3300060353 Bacteria 3163
355 Ga0530510_0028497 3300061734 Bacteria 4005
356 Ga0530510_0140246 3300061734 Bacteria 1781
357 Ga0081538_10051754
358 JGI25407J50210_10037160
359 Ga0070658_11160689
360 Ga0070676_10080508
361 Ga0070676_10932852
362 Ga0070683_100672391
363 Ga0070683_100890440
364 Ga0068869_100360743
365 Ga0070682_100325107
366 Ga0068868_100631500
367 Ga0070687_101019747
368 Ga0070687_101361110
369 Ga0070661_100023936
370 Ga0070661_100458661
371 Ga0070661_100568861
372 Ga0070692_10061652
373 Ga0070692_10170847
374 Ga0070692_10639525
375 Ga0070668_100448318
376 Ga0070673_100159831
377 Ga0070673_101465459
378 Ga0070688_101473862
379 Ga0070659_100112825
380 Ga0070659_100388866
381 Ga0070701_10428340
382 Ga0070700_100720601
383 Ga0070708_101775476
384 Ga0070663_100678104
385 Ga0070663_100870268
386 Ga0070663_102140189
387 Ga0070678_100651375
388 Ga0070678_100711732
389 Ga0070662_100674936
390 Ga0070662_101158561
391 Ga0070662_101775908
392 Ga0068867_100215749
393 Ga0068867_100475935
394 Ga0068867_101207158
395 Ga0070706_100441900
396 Ga0070706_100934608
397 Ga0070707_100485497
398 Ga0070699_100693042
399 Ga0070679_100536212
400 Ga0070684_100010776
401 Ga0070697_101555242
402 Ga0070672_101130204
403 Ga0070672_101524033
404 Ga0070686_101873390
405 Ga0070665_100762974
406 Ga0070665_101570976
407 Ga0070664_100141979
408 Ga0070664_100860645
409 Ga0070664_100957031
410 Ga0070664_100998739
411 Ga0070664_101128628
412 Ga0068857_100330701
413 Ga0068857_101204732
414 Ga0068854_100706463
415 Ga0068856_100533505
416 Ga0068856_101101590
417 Ga0068852_100841916
418 Ga0068864_100727713
419 Ga0068866_11433909
420 Ga0068861_101273649
421 Ga0068851_10400135
422 Ga0068870_10070038
423 Ga0081455_10055437
424 Ga0081455_10356079
425 Ga0081538_10000132
426 Ga0081538_10003548
427 Ga0081538_10005047
428 Ga0081538_10005189
429 Ga0081538_10010378
430 Ga0081538_10013807
431 Ga0081538_10015522
432 Ga0081538_10048072
433 Ga0081538_10049059
434 Ga0081538_10101195
435 Ga0081538_10142903
436 Ga0081538_10152428
437 Ga0081540_1011815
438 Ga0081539_10000489
439 Ga0081539_10006989
440 Ga0070715_10095581
441 Ga0070716_100747757
442 Ga0068871_100634224
443 Ga0075428_100560979
444 Ga0075428_101563068
445 Ga0075430_100497592
446 Ga0075430_100629437
447 Ga0075431_100117856
448 Ga0075431_100333703
449 Ga0075433_10311284
450 Ga0075434_100668024
451 Ga0075429_100870737
452 Ga0068865_101174074
453 Ga0111539_10020931
454 Ga0111539_10405359
455 Ga0111539_10869425
456 Ga0111539_10935374
457 Ga0111539_11348910
458 Ga0105245_10302664
459 Ga0105245_10546260
460 Ga0105245_10577136
461 Ga0105245_10712276
462 Ga0105245_10725397
463 Ga0114129_10140653
464 Ga0114129_11690651
465 Ga0105237_10027719
466 Ga0105237_12302846
467 Ga0105238_10304030
468 Ga0105249_10632614
469 Ga0105249_10944111
470 Ga0105239_11742534
471 Ga0105239_11775048
472 Ga0105239_12291294
473 Ga0105246_11048940
474 Ga0157371_11242713
475 Ga0157369_10118823
476 Ga0157369_10676422
477 Ga0157374_10282360
478 Ga0163162_10967968
479 Ga0157372_10742721
480 Ga0157375_10924355
481 Ga0157375_11642736
482 Ga0163163_11324818
483 Ga0182008_10037493
484 Ga0157379_11082226
485 Ga0206353_11578226
486 Ga0207426_1029145
487 Ga0207642_10091739
488 Ga0207685_10020680
489 Ga0207643_10216601
490 Ga0207643_10308774
491 Ga0207693_10179875
492 Ga0207660_10261045
493 Ga0207657_10045274
494 Ga0207657_10334125
495 Ga0207649_11237488
496 Ga0207646_10469546
497 Ga0207687_10255625
498 Ga0207687_10381270
499 Ga0207687_10608941
500 Ga0207664_11043541
501 Ga0207690_10449177
502 Ga0207690_11740085
503 Ga0207706_10240361
504 Ga0207706_10565036
505 Ga0207709_10289507
506 Ga0207669_11054859
507 Ga0207704_10257801
508 Ga0207691_10141439
509 Ga0207691_11257894
510 Ga0207661_10156963
511 Ga0207661_10227996
512 Ga0207661_10471017
513 Ga0207661_10892426
514 Ga0207679_10203481
515 Ga0207679_10981434
516 Ga0207679_11750223
517 Ga0207668_11253929
518 Ga0207640_10615074
519 Ga0207677_10558075
520 Ga0207677_11677913
521 Ga0207703_10235002
522 Ga0207639_10141501
523 Ga0207639_10383084
524 Ga0207678_10491466
525 Ga0207678_10710290
526 Ga0207678_10905544
527 Ga0207678_11118094
528 Ga0207708_11125158
529 Ga0207648_10204383
530 Ga0207648_10606862
531 Ga0207676_10593867
532 Ga0207674_10086634
533 Ga0207674_10196055
534 Ga0207674_10848636
535 Ga0207675_100160898
536 Ga0207675_101005344
537 Ga0207675_101991037
538 Ga0207683_10334060
539 Ga0207683_10382002
540 Ga0207683_10607291
541 Ga0207428_10222386
542 Ga0207428_10710851
543 Ga0268266_10971937
544 Ga0307405_10053318
545 Ga0307405_11088834
546 Ga0307405_11546204
547 Ga0307405_11953311
548 Ga0307413_10154553
549 Ga0307413_11001331
550 Ga0307410_10071250
551 Ga0307410_10094471
552 Ga0307410_10145243
553 Ga0307410_10473120
554 Ga0307410_11232056
555 Ga0307406_10044363
556 Ga0307406_10289271
557 Ga0307406_10691382
558 Ga0307406_10804684
559 Ga0307407_10038090
560 Ga0307407_10137799
561 Ga0307407_10140456
562 Ga0307412_10070438
563 Ga0307412_10631906
564 Ga0307412_10843609
565 Ga0307409_100001536
566 Ga0307409_100155444
567 Ga0307409_100167546
568 Ga0307409_100185669
569 Ga0307409_100414059
570 Ga0307409_100468465
571 Ga0307409_100699238
572 Ga0307409_100728666
573 Ga0307416_100000259
574 Ga0307416_100012854
575 Ga0307416_100042658
576 Ga0307416_100225401
577 Ga0307416_100985047
578 Ga0307416_101486034
579 Ga0307414_10171071
580 Ga0307414_10316392
581 Ga0307411_10060562
582 Ga0307415_100000015
583 Ga0307415_100026027
584 Ga0307415_100266197
585 Ga0307415_100424575
586 Ga0307415_100516456
587 Ga0307415_100691187
588 Ga0307415_101114215
589 Ga0373935_1278391
590 Ga0395900_0012854
591 Ga0395900_0230793
592 Ga0395900_1528219
593 Ga0395898_0030097
594 Ga0395898_0260625
595 Ga0395898_1143363
596 Ga0395905_0070733
597 Ga0395905_0388002
598 Ga0395901_0031268
599 Ga0395901_0061597
600 Ga0395901_0144972
601 Ga0395901_0158743
602 Ga0395901_0320546
603 Ga0395901_0507172
604 Ga0395901_0758854
605 Ga0395901_0858832
606 Ga0395901_0934832
607 Ga0436362_0860690
608 Ga0439453_0084240
609 Ga0451797_0621960
610 Ga0451853_0992257
611 Ga0439448_0059575
612 Ga0439450_031165
613 Ga0439455_0009140
614 Ga0439463_017503
615 Ga0439463_082573
616 Ga0439458_0037320
617 Ga0439464_0045635
618 Ga0466967_0616637
619 Ga0495603_0070763
620 Ga0495582_0476590
621 Ga0495584_0570269
622 Ga0495596_0049310
623 Ga0495631_0241884
624 Ga0495656_0815003
625 Ga0495671_0187047
626 Ga0496100_0543003
627 Ga0496100_0680831
628 Ga0496101_0216115
629 Ga0496102_0099314
630 Ga0496104_1156245
631 Ga0496105_0100954
632 Ga0496106_0028053
633 Ga0496106_0508015
634 Ga0496107_0140733
635 Ga0496108_0048842
636 Ga0496108_0295959
637 Ga0496109_0056150
638 Ga0496109_0121229
639 Ga0496109_1431369
640 Ga0496110_0780394
641 Ga0496111_0041574
642 Ga0496111_0522542
643 Ga0496111_0536088
644 Ga0496112_0186591
645 Ga0496112_0601709
646 Ga0496112_0725937
647 Ga0496113_0132854
648 Ga0496113_0471034
649 Ga0496113_0761354
650 Ga0496115_0235415
651 Ga0496115_0283919
652 Ga0501031_0496285
653 Ga0501032_0803039
654 Ga0501033_0178561
655 Ga0501036_0088452
656 Ga0501036_0373876
657 Ga0501038_0216311
658 Ga0501038_0615379
659 Ga0501038_0891922
660 Ga0501039_0013323
661 Ga0501039_0068496
662 Ga0501039_1263892
663 Ga0501040_0063368
664 Ga0501040_0091221
665 Ga0501040_0374037
666 Ga0501041_0070000
667 Ga0501041_0727212
668 Ga0501042_0034916
669 Ga0501042_0104852
670 Ga0501043_0538007
671 Ga0501048_0068821
672 Ga0501048_0395497
673 Ga0501067_0167643
674 Ga0501067_0784231
675 Ga0501068_0128616
676 Ga0501071_0142314
677 Ga0501071_0332736
678 Ga0501072_0039064
679 Ga0501072_0343466
680 Ga0501074_0049346
681 Ga0501075_0090648
682 Ga0501075_0176251
683 Ga0501076_0074763
684 Ga0501076_0197504
685 Ga0501076_0506589
686 Ga0501077_0050427
687 Ga0501079_0086559
688 Ga0501080_1619004
689 Ga0501081_0026600
690 Ga0501081_0032244
691 Ga0501045_0028284
692 Ga0501045_0067616
693 nmdc:mga05p37_1455645_c1
694 nmdc:mga05p37_229199_c1
695 nmdc:mga09592_169954_c1
696 nmdc:mga0qj67_657019_c1
697 nmdc:mga06r32_668900_c1
698 nmdc:mga06r32_911007_c1
699 nmdc:mga08y16_1166505_c1
700 nmdc:mga08y16_18315_c1
701 nmdc:mga08y16_644330_c1
702 nmdc:mga0a205_195549_c1
703 nmdc:mga0a205_779830_c1
704 Ga0495655_0049249
705 Ga0495655_0097524
706 Ga0495619_0652354
707 Ga0501084_0111544
708 Ga0590075_184963
709 Ga0501082_0038558
710 Ga0501082_0064181
711 Ga0530510_0028497
712 Ga0530510_0140246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

2

103

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.898 2 111
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7954 2 111
4fpi-assembly1.cif.gz_C crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.7383 3 112
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7055 1 112
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6969 1 112
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.898 2 111 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7954 2 111 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.752 3 112 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7188 3 113 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6828 3 112 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A850DG38-F1-model_v4 YciI family protein 0.9753 6 112
AF-A0A526TM44-F1-model_v4 YciI family protein 0.9632 23 120
AF-A0A7C5ITJ9-F1-model_v4 YciI family protein 0.9553 20 112
AF-A0A840AF49-F1-model_v4 YCII-related domain-containing protein 0.9489 3 114
AF-A0A3D0I5F3-F1-model_v4 YCII-related domain-containing protein 0.9459 3 110

Map